Citrus Sinensis ID: 011648


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480
MIKVYHSRNKMISGCISFLRRYNSSEPSTEALDAAKSISKIMLSSPKVVLDTALDQSGIRVSPEIVEDVLEKFRNAGTLAFCFFKWAEKQQNYEHSVRAYHSMIESLAKIRQYQIMWDLVNAMRTKRMLNVETFCIIMRKYARVQKVEEAVYTFNVMQKYGVTQNLAAFNGLLSALCKSKNVRKAQEIFDCMKDRFIPDSKTYSILLEGWGKDPNLPRAREIFREMVDTGCNPDIVTYGIMVDVLCKAGRVDEALGIVKSMDSTVCRPTSFIYSVLVHTYGVENRIEDAVDTFLEMEKNGILADVAMYNALIGAFCKANKFKNVYRVLKDMNSKGVAPNSRTCNIILNGLIGRGETDEAYRVFRRMIKLCEADADTYTMMIKMFCQGGELEKAFKVWKYMKLKRFIPSMHTFSVLINGLCDKGIVSDSCVLLEDMIEKGIRPSGETFGKLRKLLIKEGREDVLKFLQEKMNLLVKEPLCD
cccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHcHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccc
cccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHcccccccccHHHHcccccEEHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccc
MIKVYHSRNKMISGCISFLRrynssepsteALDAAKSISKImlsspkvvldtaldqsgirvspEIVEDVLEKFRNAGTLAFCFFKWAEKQQNYEHSVRAYHSMIESLAKIRQYQIMWDLVNAMRTKRMLNVETFCIIMRKYARVQKVEEAVYTFNVMQKYGVTQNLAAFNGLLSALCKSKNVRKAQEIFDCmkdrfipdsktYSILLEgwgkdpnlprAREIFREMVdtgcnpdivTYGIMVDVLCKAGRVDEALGIVksmdstvcrptsFIYSVLVHTYGVENRIEDAVDTFLEMEKNGILADVAMYNALIGAFCKANKFKNVYRVLKDmnskgvapnsrtcniilngligrgetDEAYRVFRRMIKLCEADADTYTMMIKMFCQGGELEKAFKVWKYMKLKRFIPSMHTFSVLINGLcdkgivsdSCVLLEDMIekgirpsgetFGKLRKLLIKEGREDVLKFLQEKMNLLVKEPLCD
MIKVYHSRNKMISGCISFLRRYNSSEPSTEALDAAKSISKIMLSSPKVVLDTALDQSGIRVSPEIVEDVLEKFRNAGTLAFCFFKWAEKQQNYEHSVRAYHSMIESLAKIRQYQIMWDLVNAMRTKRMLNVETFCIIMRKYARVQKVEEAVYTFNVMQKYGVTQNLAAFNGLLSALCKSKNVRKAQEIfdcmkdrfipdSKTYSILLegwgkdpnlpRAREIFREMVDTGCNPDIVTYGIMVDVLCKAGRVDEALGivksmdstvcrpTSFIYSVLVHTYGVENRIEDAVDTFLEMEKNGILADVAMYNALIGAFCKANKFKNVYRVLKDmnskgvapnsrtcniilngligrgetDEAYRVFRRMIKLCEADADTYTMMIKMFCQGGELEKAFKVWKYMKLKRFIPSMHTFSVLINGLCDKGIVSDSCVLLEDMIekgirpsgetfgKLRKLLIKEGREDVLKFLQEkmnllvkeplcd
MIKVYHSRNKMISGCISFLRRYNSSEPSTEALDAAKSISKIMLSSPKVVLDTALDQSGIRVSPEIVEDVLEKFRNAGTLAFCFFKWAEKQQNYEHSVRAYHSMIESLAKIRQYQIMWDLVNAMRTKRMLNVETFCIIMRKYARVQKVEEAVYTFNVMQKYGVTQNLAAFNGLLSALCKSKNVRKAQEIFDCMKDRFIPDSKTYSILLEGWGKDPNLPRAREIFREMVDTGCNPDIVTYGIMVDVLCKAGRVDEALGIVKSMDSTVCRPTSFIYSVLVHTYGVENRIEDAVDTFLEMEKNGILADVAMYNALIGAFCKANKFKNVYRVLKDMNSKGVAPNSRTCNIILNGLIGRGETDEAYRVFRRMIKLCEADADTYTMMIKMFCQGGELEKAFKVWKYMKLKRFIPSMHTFSVLINGLCDKGIVSDSCVLLEDMIEKGIRPSGETFGKLRKLLIKEGREDVLKFLQEKMNLLVKEPLCD
*********KMISGCISFLRRY******************IMLSSPKVVLDTALDQSGIRVSPEIVEDVLEKFRNAGTLAFCFFKWAEKQQNYEHSVRAYHSMIESLAKIRQYQIMWDLVNAMRTKRMLNVETFCIIMRKYARVQKVEEAVYTFNVMQKYGVTQNLAAFNGLLSALCKSKNVRKAQEIFDCMKDRFIPDSKTYSILLEGWGKDPNLPRAREIFREMVDTGCNPDIVTYGIMVDVLCKAGRVDEALGIVKSMDSTVCRPTSFIYSVLVHTYGVENRIEDAVDTFLEMEKNGILADVAMYNALIGAFCKANKFKNVYRVLKDMNSKGVAPNSRTCNIILNGLIGRGETDEAYRVFRRMIKLCEADADTYTMMIKMFCQGGELEKAFKVWKYMKLKRFIPSMHTFSVLINGLCDKGIVSDSCVLLEDMIEKGIRPSGETFGKLRKLLIKEGREDVLKFLQEKMNLLV******
**************CISFLRRYNSSEPSTEALDAAKSISKIMLSSPKVVLDTALDQSGIRVSPEIVEDVLEKFRNAGTLAFCFFKWAEKQQNYEHSVRAYHSMIESLAKIRQYQIMWDLVNAMRTKRMLNVETFCIIMRKYARVQKVEEAVYTFNVMQKYGVTQNLAAFNGLLSALCKSKNVRKAQEIFDCMKDRFIPDSKTYSILLEGWGKDPNLPRAREIFREMVDTGCNPDIVTYGIMVDVLCKAGRVDEALGIVKSMDSTVCRPTSFIYSVLVHTYGVENRIEDAVDTFLEMEKNGILADVAMYNALIGAFCKANKFKNVYRVLKDMNSKGVAPNSRTCNIILNGLIGRGETDEAYRVFRRMIKLCEADADTYTMMIKMFCQGGELEKAFKVWKYMKLKRFIPSMHTFSVLINGLCDKGIVSDSCVLLEDMIEKGIRPSGETFGKLRKLLIKEGREDVLKFLQEKMNLLVKEPLC*
MIKVYHSRNKMISGCISFLRRYNSSEPSTEALDAAKSISKIMLSSPKVVLDTALDQSGIRVSPEIVEDVLEKFRNAGTLAFCFFKWAEKQQNYEHSVRAYHSMIESLAKIRQYQIMWDLVNAMRTKRMLNVETFCIIMRKYARVQKVEEAVYTFNVMQKYGVTQNLAAFNGLLSALCKSKNVRKAQEIFDCMKDRFIPDSKTYSILLEGWGKDPNLPRAREIFREMVDTGCNPDIVTYGIMVDVLCKAGRVDEALGIVKSMDSTVCRPTSFIYSVLVHTYGVENRIEDAVDTFLEMEKNGILADVAMYNALIGAFCKANKFKNVYRVLKDMNSKGVAPNSRTCNIILNGLIGRGETDEAYRVFRRMIKLCEADADTYTMMIKMFCQGGELEKAFKVWKYMKLKRFIPSMHTFSVLINGLCDKGIVSDSCVLLEDMIEKGIRPSGETFGKLRKLLIKEGREDVLKFLQEKMNLLVKEPLCD
MIKVYHSRNKMISGCISFLRRYNSSEPSTEALDAAKSISKIMLSSPKVVLDTALDQSGIRVSPEIVEDVLEKFRNAGTLAFCFFKWAEKQQNYEHSVRAYHSMIESLAKIRQYQIMWDLVNAMRTKRMLNVETFCIIMRKYARVQKVEEAVYTFNVMQKYGVTQNLAAFNGLLSALCKSKNVRKAQEIFDCMKDRFIPDSKTYSILLEGWGKDPNLPRAREIFREMVDTGCNPDIVTYGIMVDVLCKAGRVDEALGIVKSMDSTVCRPTSFIYSVLVHTYGVENRIEDAVDTFLEMEKNGILADVAMYNALIGAFCKANKFKNVYRVLKDMNSKGVAPNSRTCNIILNGLIGRGETDEAYRVFRRMIKLCEADADTYTMMIKMFCQGGELEKAFKVWKYMKLKRFIPSMHTFSVLINGLCDKGIVSDSCVLLEDMIEKGIRPSGETFGKLRKLLIKEGREDVLKFLQEKMNLLVKEP***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKVYHSRNKMISGCISFLRRYNSSEPSTEALDAAKSISKIMLSSPKVVLDTALDQSGIRVSPEIVEDVLEKFRNAGTLAFCFFKWAEKQQNYEHSVRAYHSMIESLAKIRQYQIMWDLVNAMRTKRMLNVETFCIIMRKYARVQKVEEAVYTFNVMQKYGVTQNLAAFNGLLSALCKSKNVRKAQEIFDCMKDRFIPDSKTYSILLEGWGKDPNLPRAREIFREMVDTGCNPDIVTYGIMVDVLCKAGRVDEALGIVKSMDSTVCRPTSFIYSVLVHTYGVENRIEDAVDTFLEMEKNGILADVAMYNALIGAFCKANKFKNVYRVLKDMNSKGVAPNSRTCNIILNGLIGRGETDEAYRVFRRMIKLCEADADTYTMMIKMFCQGGELEKAFKVWKYMKLKRFIPSMHTFSVLINGLCDKGIVSDSCVLLEDMIEKGIRPSGETFGKLRKLLIKEGREDVLKFLQEKMNLLVKEPLCD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query480 2.2.26 [Sep-21-2011]
Q9FVX2517 Pentatricopeptide repeat- yes no 0.970 0.901 0.735 0.0
Q9C9A2510 Pentatricopeptide repeat- no no 0.945 0.890 0.404 1e-105
Q9SSR6523 Pentatricopeptide repeat- no no 0.912 0.837 0.310 1e-65
P0C8A0 638 Pentatricopeptide repeat- no no 0.870 0.655 0.321 7e-65
Q9LZP3599 Pentatricopeptide repeat- no no 0.875 0.701 0.311 2e-64
Q9S7R4482 Pentatricopeptide repeat- no no 0.895 0.892 0.318 6e-64
Q3EAF8599 Pentatricopeptide repeat- no no 0.875 0.701 0.308 7e-64
Q9LEQ7598 Pentatricopeptide repeat- no no 0.875 0.702 0.308 1e-63
Q9LFQ4572 Pentatricopeptide repeat- no no 0.814 0.683 0.325 4e-60
Q9FH87 637 Putative pentatricopeptid no no 0.897 0.676 0.306 1e-59
>sp|Q9FVX2|PP129_ARATH Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2 Back     alignment and function desciption
 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/468 (73%), Positives = 410/468 (87%), Gaps = 2/468 (0%)

Query: 15  CISFL--RRYNSSEPSTEALDAAKSISKIMLSSPKVVLDTALDQSGIRVSPEIVEDVLEK 72
           C SFL  R Y+SSE   +  D AK+ISK+++SSP++VLD+ALDQSG+RVS E+VEDVL +
Sbjct: 50  CKSFLSARLYSSSEQVRDVADVAKNISKVLMSSPQLVLDSALDQSGLRVSQEVVEDVLNR 109

Query: 73  FRNAGTLAFCFFKWAEKQQNYEHSVRAYHSMIESLAKIRQYQIMWDLVNAMRTKRMLNVE 132
           FRNAG L + FF+W+EKQ++YEHSVRAYH MIES AKIRQY++MWDL+NAMR K+MLNVE
Sbjct: 110 FRNAGLLTYRFFQWSEKQRHYEHSVRAYHMMIESTAKIRQYKLMWDLINAMRKKKMLNVE 169

Query: 133 TFCIIMRKYARVQKVEEAVYTFNVMQKYGVTQNLAAFNGLLSALCKSKNVRKAQEIFDCM 192
           TFCI+MRKYAR QKV+EA+Y FNVM+KY +  NL AFNGLLSALCKSKNVRKAQE+F+ M
Sbjct: 170 TFCIVMRKYARAQKVDEAIYAFNVMEKYDLPPNLVAFNGLLSALCKSKNVRKAQEVFENM 229

Query: 193 KDRFIPDSKTYSILLEGWGKDPNLPRAREIFREMVDTGCNPDIVTYGIMVDVLCKAGRVD 252
           +DRF PDSKTYSILLEGWGK+PNLP+ARE+FREM+D GC+PDIVTY IMVD+LCKAGRVD
Sbjct: 230 RDRFTPDSKTYSILLEGWGKEPNLPKAREVFREMIDAGCHPDIVTYSIMVDILCKAGRVD 289

Query: 253 EALGIVKSMDSTVCRPTSFIYSVLVHTYGVENRIEDAVDTFLEMEKNGILADVAMYNALI 312
           EALGIV+SMD ++C+PT+FIYSVLVHTYG ENR+E+AVDTFLEME++G+ ADVA++N+LI
Sbjct: 290 EALGIVRSMDPSICKPTTFIYSVLVHTYGTENRLEEAVDTFLEMERSGMKADVAVFNSLI 349

Query: 313 GAFCKANKFKNVYRVLKDMNSKGVAPNSRTCNIILNGLIGRGETDEAYRVFRRMIKLCEA 372
           GAFCKAN+ KNVYRVLK+M SKGV PNS++CNIIL  LI RGE DEA+ VFR+MIK+CE 
Sbjct: 350 GAFCKANRMKNVYRVLKEMKSKGVTPNSKSCNIILRHLIERGEKDEAFDVFRKMIKVCEP 409

Query: 373 DADTYTMMIKMFCQGGELEKAFKVWKYMKLKRFIPSMHTFSVLINGLCDKGIVSDSCVLL 432
           DADTYTM+IKMFC+  E+E A KVWKYM+ K   PSMHTFSVLINGLC++     +CVLL
Sbjct: 410 DADTYTMVIKMFCEKKEMETADKVWKYMRKKGVFPSMHTFSVLINGLCEERTTQKACVLL 469

Query: 433 EDMIEKGIRPSGETFGKLRKLLIKEGREDVLKFLQEKMNLLVKEPLCD 480
           E+MIE GIRPSG TFG+LR+LLIKE REDVLKFL EKMN+LV EPLCD
Sbjct: 470 EEMIEMGIRPSGVTFGRLRQLLIKEEREDVLKFLNEKMNVLVNEPLCD 517





Arabidopsis thaliana (taxid: 3702)
>sp|Q9C9A2|PP112_ARATH Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 Back     alignment and function description
>sp|Q9SSR6|PPR78_ARATH Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1 Back     alignment and function description
>sp|P0C8A0|PP275_ARATH Pentatricopeptide repeat-containing protein At3g49730 OS=Arabidopsis thaliana GN=At3g49730 PE=2 SV=1 Back     alignment and function description
>sp|Q9LZP3|PP293_ARATH Pentatricopeptide repeat-containing protein At3g62470, mitochondrial OS=Arabidopsis thaliana GN=At3g62470 PE=2 SV=1 Back     alignment and function description
>sp|Q9S7R4|PP125_ARATH Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 Back     alignment and function description
>sp|Q3EAF8|PP294_ARATH Pentatricopeptide repeat-containing protein At3g62540, mitochondrial OS=Arabidopsis thaliana GN=At3g62540 PE=2 SV=1 Back     alignment and function description
>sp|Q9LEQ7|PP382_ARATH Pentatricopeptide repeat-containing protein At5g14820, mitochondrial OS=Arabidopsis thaliana GN=At5g14820 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFQ4|PP383_ARATH Pentatricopeptide repeat-containing protein At5g15010, mitochondrial OS=Arabidopsis thaliana GN=At5g15010 PE=2 SV=2 Back     alignment and function description
>sp|Q9FH87|PP447_ARATH Putative pentatricopeptide repeat-containing protein At5g65820 OS=Arabidopsis thaliana GN=At5g65820 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query480
255558584439 pentatricopeptide repeat-containing prot 0.914 1.0 0.810 0.0
359492357476 PREDICTED: pentatricopeptide repeat-cont 0.954 0.962 0.772 0.0
224084978440 predicted protein [Populus trichocarpa] 0.914 0.997 0.799 0.0
11079489481 hypothetical protein [Arabidopsis thalia 0.970 0.968 0.735 0.0
334183972517 pentatricopeptide repeat-containing prot 0.970 0.901 0.735 0.0
297842515482 pentatricopeptide repeat-containing prot 1.0 0.995 0.712 0.0
449463418439 PREDICTED: pentatricopeptide repeat-cont 0.914 1.0 0.776 0.0
356515931461 PREDICTED: pentatricopeptide repeat-cont 0.933 0.971 0.747 0.0
357114607486 PREDICTED: pentatricopeptide repeat-cont 0.987 0.975 0.644 0.0
115455503484 Os03g0761300 [Oryza sativa Japonica Grou 0.964 0.956 0.655 0.0
>gi|255558584|ref|XP_002520317.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540536|gb|EEF42103.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/439 (81%), Positives = 395/439 (89%)

Query: 42  MLSSPKVVLDTALDQSGIRVSPEIVEDVLEKFRNAGTLAFCFFKWAEKQQNYEHSVRAYH 101
           M+SSP V L TALDQ+GIRVSPEIVEDVL +F NAG +A+ FF+WAEKQ +Y HSVRAYH
Sbjct: 1   MMSSPAVTLHTALDQNGIRVSPEIVEDVLRRFENAGMVAYRFFEWAEKQLHYTHSVRAYH 60

Query: 102 SMIESLAKIRQYQIMWDLVNAMRTKRMLNVETFCIIMRKYARVQKVEEAVYTFNVMQKYG 161
           +MIESLAKIRQYQIMWDL+NAM+ KRMLNVETFCIIMRKYAR QK+EEAVYTFNVM+KY 
Sbjct: 61  TMIESLAKIRQYQIMWDLINAMKRKRMLNVETFCIIMRKYARAQKLEEAVYTFNVMEKYD 120

Query: 162 VTQNLAAFNGLLSALCKSKNVRKAQEIFDCMKDRFIPDSKTYSILLEGWGKDPNLPRARE 221
           V  NLAAFNGL SALCKSKNVRKAQEIFD  KDRF+PDSKTY+ILLEGWGK PNLP+ARE
Sbjct: 121 VPPNLAAFNGLFSALCKSKNVRKAQEIFDSSKDRFVPDSKTYTILLEGWGKTPNLPKARE 180

Query: 222 IFREMVDTGCNPDIVTYGIMVDVLCKAGRVDEALGIVKSMDSTVCRPTSFIYSVLVHTYG 281
           IFREMVD GC+PDIVTYGIMVD+LCKAGRVDEAL IVK MD T+C+PTSFIYSVL+HTYG
Sbjct: 181 IFREMVDVGCSPDIVTYGIMVDILCKAGRVDEALDIVKEMDLTICKPTSFIYSVLIHTYG 240

Query: 282 VENRIEDAVDTFLEMEKNGILADVAMYNALIGAFCKANKFKNVYRVLKDMNSKGVAPNSR 341
           +ENRIEDAVDTFL MEKNG+ ADVA YNALIGAFCK NKFKNVYRVL +M+ KG+ PNSR
Sbjct: 241 IENRIEDAVDTFLGMEKNGVKADVAAYNALIGAFCKVNKFKNVYRVLNEMDYKGMQPNSR 300

Query: 342 TCNIILNGLIGRGETDEAYRVFRRMIKLCEADADTYTMMIKMFCQGGELEKAFKVWKYMK 401
           T NIILN LI RGETDEA+RVFRRMIK+CE DADTYTMMIKMFC+  ELE A KVWKYMK
Sbjct: 301 TLNIILNNLIARGETDEAFRVFRRMIKVCEPDADTYTMMIKMFCERNELEMALKVWKYMK 360

Query: 402 LKRFIPSMHTFSVLINGLCDKGIVSDSCVLLEDMIEKGIRPSGETFGKLRKLLIKEGRED 461
            K F+PSMHTFSVLINGLC++G VS +CV+LEDMIEKGIRPSG TFG+LR LLIKEGRED
Sbjct: 361 KKHFVPSMHTFSVLINGLCEEGDVSHACVMLEDMIEKGIRPSGVTFGRLRHLLIKEGRED 420

Query: 462 VLKFLQEKMNLLVKEPLCD 480
           VL+FLQ+K+N+L+KEPL D
Sbjct: 421 VLEFLQQKINVLIKEPLWD 439




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359492357|ref|XP_002284592.2| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224084978|ref|XP_002307458.1| predicted protein [Populus trichocarpa] gi|222856907|gb|EEE94454.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|11079489|gb|AAG29201.1|AC078898_11 hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334183972|ref|NP_177860.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806398|sp|Q9FVX2.2|PP129_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g77360, mitochondrial; Flags: Precursor gi|332197848|gb|AEE35969.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297842515|ref|XP_002889139.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297334980|gb|EFH65398.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449463418|ref|XP_004149431.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cucumis sativus] gi|449499065|ref|XP_004160711.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356515931|ref|XP_003526650.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|357114607|ref|XP_003559090.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|115455503|ref|NP_001051352.1| Os03g0761300 [Oryza sativa Japonica Group] gi|14488357|gb|AAK63924.1|AC084282_5 unknown protein [Oryza sativa Japonica Group] gi|108711214|gb|ABF99009.1| pentatricopeptide, putative, expressed [Oryza sativa Japonica Group] gi|113549823|dbj|BAF13266.1| Os03g0761300 [Oryza sativa Japonica Group] gi|125545804|gb|EAY91943.1| hypothetical protein OsI_13630 [Oryza sativa Indica Group] gi|125588003|gb|EAZ28667.1| hypothetical protein OsJ_12678 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query480
TAIR|locus:2026346510 AT1G71060 [Arabidopsis thalian 0.945 0.890 0.404 1.4e-96
TAIR|locus:2097395 638 AT3G49730 [Arabidopsis thalian 0.875 0.658 0.323 8.8e-63
TAIR|locus:2035206523 AT1G52640 [Arabidopsis thalian 0.912 0.837 0.310 1.6e-61
TAIR|locus:2096099599 AT3G62470 "AT3G62470" [Arabido 0.875 0.701 0.311 2.7e-61
TAIR|locus:2096074599 AT3G62540 "AT3G62540" [Arabido 0.875 0.701 0.308 1.9e-60
TAIR|locus:2185455598 AT5G14820 "AT5G14820" [Arabido 0.875 0.702 0.308 2.4e-60
TAIR|locus:2156213 637 AT5G65820 [Arabidopsis thalian 0.952 0.717 0.293 9.3e-59
TAIR|locus:2012883537 AT1G20300 [Arabidopsis thalian 0.904 0.808 0.305 3.6e-57
TAIR|locus:2094394562 AT3G22670 [Arabidopsis thalian 0.883 0.754 0.283 4.9e-53
TAIR|locus:2083671523 AT3G15200 [Arabidopsis thalian 0.945 0.868 0.282 2.8e-50
TAIR|locus:2026346 AT1G71060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 960 (343.0 bits), Expect = 1.4e-96, P = 1.4e-96
 Identities = 186/460 (40%), Positives = 292/460 (63%)

Query:    23 NSSEPSTEALDA---AKSISKIMLSSPKVVLDTALDQSGIRVSPEIVEDVLEKFRNAGTL 79
             +S E    A DA   A+ I KI+       ++T L+++ +++SP ++E+VL+K  NAG L
Sbjct:    51 SSVETQVSANDASQDAERICKILTKFTDSKVETLLNEASVKLSPALIEEVLKKLSNAGVL 110

Query:    80 AFCFFKWAEKQQNYEHSVRAYHSMIESLAKIRQYQIMWDLVNAMRTKRMLNVETFCIIMR 139
             A   FKWAE Q+ ++H+   Y+++IESL KI+Q++++W LV+ M+ K++L+ ETF +I R
Sbjct:   111 ALSVFKWAENQKGFKHTTSNYNALIESLGKIKQFKLIWSLVDDMKAKKLLSKETFALISR 170

Query:   140 KYARVQKVEEAVYTFNVMQKYGVTQNLAAFNGLLSALCKSKNVRKAQEIFDCMKD-RFIP 198
             +YAR +KV+EA+  F+ M+++G     + FN +L  L KS+NV  AQ++FD MK  RF P
Sbjct:   171 RYARARKVKEAIGAFHKMEEFGFKMESSDFNRMLDTLSKSRNVGDAQKVFDKMKKKRFEP 230

Query:   199 DSKTYSILLEGWGKDPNLPRAREIFREMVDTGCNPDIVTYGIMVDVLCKAGRVDEALGIV 258
             D K+Y+ILLEGWG++ NL R  E+ REM D G  PD+V YGI+++  CKA + +EA+   
Sbjct:   231 DIKSYTILLEGWGQELNLLRVDEVNREMKDEGFEPDVVAYGIIINAHCKAKKYEEAIRFF 290

Query:   259 KSMDSTVCRPTSFIYSVLVHTYGVENRIEDAVDTFLEMEKNGILADVAMYNALIGAFCKA 318
               M+   C+P+  I+  L++  G E ++ DA++ F   + +G   +   YNAL+GA+C +
Sbjct:   291 NEMEQRNCKPSPHIFCSLINGLGSEKKLNDALEFFERSKSSGFPLEAPTYNALVGAYCWS 350

Query:   319 NKFKNVYRVLKDMNSKGVAPNSRTCNIILNGLIGRGETDEAYRVFRRMIKLCEADADTYT 378
              + ++ Y+ + +M  KGV PN+RT +IIL+ LI    + EAY V++ M   CE    TY 
Sbjct:   351 QRMEDAYKTVDEMRLKGVGPNARTYDIILHHLIRMQRSKEAYEVYQTMS--CEPTVSTYE 408

Query:   379 MMIKMFCQGGELEKAFKVWKYMKLKRFIPSMHTFSVLINGLCDKGIVSDSCVLLEDMIEK 438
             +M++MFC    L+ A K+W  MK K  +P MH FS LI  LC +  + ++C    +M++ 
Sbjct:   409 IMVRMFCNKERLDMAIKIWDEMKGKGVLPGMHMFSSLITALCHENKLDEACEYFNEMLDV 468

Query:   439 GIRPSGETFGKLRKLLIKEGREDVLKFLQEKMNLLVKEPL 478
             GIRP G  F +L++ L+ EGR+D +  L  KM+ L K  L
Sbjct:   469 GIRPPGHMFSRLKQTLLDEGRKDKVTDLVVKMDRLRKTQL 508




GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2097395 AT3G49730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035206 AT1G52640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096099 AT3G62470 "AT3G62470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096074 AT3G62540 "AT3G62540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2185455 AT5G14820 "AT5G14820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156213 AT5G65820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012883 AT1G20300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094394 AT3G22670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083671 AT3G15200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FVX2PP129_ARATHNo assigned EC number0.73500.97080.9013yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0002017301
hypothetical protein (440 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query480
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-18
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-12
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-10
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-10
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-09
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-08
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-07
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 8e-07
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-06
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-06
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 9e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 6e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 8e-04
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.003
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score = 88.0 bits (218), Expect = 2e-18
 Identities = 72/310 (23%), Positives = 136/310 (43%), Gaps = 14/310 (4%)

Query: 142 ARVQKVEEAVYTFNVMQKYGVTQNLAAFNGLLSALCKSKNVRKAQEIFDCMKDRFI-PDS 200
           A+  KV+     F+ M   GV  N+  F  L+    ++  V KA   +  M+ + + PD 
Sbjct: 483 AKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDR 542

Query: 201 KTYSILLEGWGKDPNLPRAREIFREMV--DTGCNPDIVTYGIMVDVLCKAGRVDEALGIV 258
             ++ L+   G+   + RA ++  EM       +PD +T G ++     AG+VD A  + 
Sbjct: 543 VVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVY 602

Query: 259 KSMDSTVCRPTSFIYSVLVHTYGVENRIEDAVDTFLEMEKNGILADVAMYNALIGAFCKA 318
           + +     + T  +Y++ V++   +   + A+  + +M+K G+  D   ++AL+     A
Sbjct: 603 QMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHA 662

Query: 319 NKFKNVYRVLKDMNSKGVAPNSRTCNIILNGLIG----RGETDEAYRVFR--RMIKLCEA 372
                 + +L+D   +G+   +    +  + L+G         +A  ++   + IKL   
Sbjct: 663 GDLDKAFEILQDARKQGIKLGT----VSYSSLMGACSNAKNWKKALELYEDIKSIKL-RP 717

Query: 373 DADTYTMMIKMFCQGGELEKAFKVWKYMKLKRFIPSMHTFSVLINGLCDKGIVSDSCVLL 432
              T   +I   C+G +L KA +V   MK     P+  T+S+L+     K        LL
Sbjct: 718 TVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDLL 777

Query: 433 EDMIEKGIRP 442
               E GI+P
Sbjct: 778 SQAKEDGIKP 787


Length = 1060

>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 480
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.92
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.92
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.92
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.92
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.91
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.91
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.9
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.9
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.88
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.87
PRK14574 822 hmsH outer membrane protein; Provisional 99.85
PRK14574 822 hmsH outer membrane protein; Provisional 99.84
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.83
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.81
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.81
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.79
KOG2003 840 consensus TPR repeat-containing protein [General f 99.78
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.76
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.75
KOG2076 895 consensus RNA polymerase III transcription factor 99.74
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.73
KOG2076 895 consensus RNA polymerase III transcription factor 99.73
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.72
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.7
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.69
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.69
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.69
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.68
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.67
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.67
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.67
KOG1126638 consensus DNA-binding cell division cycle control 99.66
KOG2003 840 consensus TPR repeat-containing protein [General f 99.66
KOG1126638 consensus DNA-binding cell division cycle control 99.64
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.63
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.63
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.62
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.61
KOG0547606 consensus Translocase of outer mitochondrial membr 99.6
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.57
KOG0547606 consensus Translocase of outer mitochondrial membr 99.53
PRK12370553 invasion protein regulator; Provisional 99.5
PRK12370553 invasion protein regulator; Provisional 99.49
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.48
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.48
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.48
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.46
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.45
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.45
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.44
KOG1129478 consensus TPR repeat-containing protein [General f 99.44
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.42
KOG1129478 consensus TPR repeat-containing protein [General f 99.42
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.42
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.39
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.39
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.38
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.37
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.34
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.34
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.34
PF1304150 PPR_2: PPR repeat family 99.31
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.3
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.29
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.28
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.28
PF1304150 PPR_2: PPR repeat family 99.27
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.27
PRK11189296 lipoprotein NlpI; Provisional 99.25
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.24
PRK11189296 lipoprotein NlpI; Provisional 99.23
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.23
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.23
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.19
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.15
PRK04841 903 transcriptional regulator MalT; Provisional 99.1
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.09
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.07
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.07
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.05
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.03
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.02
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.0
PRK04841 903 transcriptional regulator MalT; Provisional 98.98
KOG1125579 consensus TPR repeat-containing protein [General f 98.97
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.94
PLN02789320 farnesyltranstransferase 98.94
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.94
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.93
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.91
KOG1125579 consensus TPR repeat-containing protein [General f 98.9
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.89
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.89
PLN02789320 farnesyltranstransferase 98.87
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.86
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.85
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.81
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.81
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.79
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.79
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.78
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.78
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.77
PRK10370198 formate-dependent nitrite reductase complex subuni 98.77
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.77
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.77
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.75
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.74
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.72
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.71
PF1285434 PPR_1: PPR repeat 98.69
PRK15359144 type III secretion system chaperone protein SscB; 98.67
PF1285434 PPR_1: PPR repeat 98.66
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.66
PRK10370198 formate-dependent nitrite reductase complex subuni 98.65
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.63
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.62
PRK15359144 type III secretion system chaperone protein SscB; 98.62
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.6
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.57
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.53
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.5
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.49
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.47
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.46
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.41
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.36
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.3
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.27
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.23
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.21
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.13
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.1
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.05
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.04
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.02
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.02
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.01
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.01
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.0
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.98
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.98
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.97
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.95
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.93
KOG0553304 consensus TPR repeat-containing protein [General f 97.92
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.91
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.91
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.9
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.89
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.83
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.82
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.81
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.8
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.79
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.79
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.78
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.78
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.75
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.75
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.74
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.74
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.69
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.67
PF12688120 TPR_5: Tetratrico peptide repeat 97.67
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.66
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.66
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.66
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.64
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.63
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.63
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.59
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.57
COG4700251 Uncharacterized protein conserved in bacteria cont 97.55
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.55
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.55
PF12688120 TPR_5: Tetratrico peptide repeat 97.55
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.51
KOG0553304 consensus TPR repeat-containing protein [General f 97.5
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.48
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.47
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.45
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.44
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.43
KOG1258 577 consensus mRNA processing protein [RNA processing 97.4
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.37
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.36
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.35
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.33
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.31
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.31
COG4700251 Uncharacterized protein conserved in bacteria cont 97.28
PRK15331165 chaperone protein SicA; Provisional 97.21
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.21
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.17
PRK10803263 tol-pal system protein YbgF; Provisional 97.17
PRK15331165 chaperone protein SicA; Provisional 97.16
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.1
PF1337173 TPR_9: Tetratricopeptide repeat 97.04
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.03
PRK10803263 tol-pal system protein YbgF; Provisional 96.99
KOG20411189 consensus WD40 repeat protein [General function pr 96.98
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.96
COG3898531 Uncharacterized membrane-bound protein [Function u 96.93
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.92
COG3898 531 Uncharacterized membrane-bound protein [Function u 96.86
PF1337173 TPR_9: Tetratricopeptide repeat 96.8
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.74
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.69
KOG1585308 consensus Protein required for fusion of vesicles 96.56
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.54
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.51
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.48
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.48
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.47
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.46
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.46
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.44
PF13512142 TPR_18: Tetratricopeptide repeat 96.44
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.39
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.38
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.37
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.36
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.36
smart00299140 CLH Clathrin heavy chain repeat homology. 96.3
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.14
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.13
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.08
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.04
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.96
KOG4555175 consensus TPR repeat-containing protein [Function 95.93
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.91
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.87
PRK11906458 transcriptional regulator; Provisional 95.84
PRK11906458 transcriptional regulator; Provisional 95.76
KOG1258577 consensus mRNA processing protein [RNA processing 95.7
PF1342844 TPR_14: Tetratricopeptide repeat 95.69
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.66
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.65
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.56
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.54
KOG2610491 consensus Uncharacterized conserved protein [Funct 95.53
PF1342844 TPR_14: Tetratricopeptide repeat 95.39
KOG3941 406 consensus Intermediate in Toll signal transduction 95.36
COG3629280 DnrI DNA-binding transcriptional activator of the 95.24
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.2
smart00299140 CLH Clathrin heavy chain repeat homology. 95.1
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.04
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.01
KOG2610491 consensus Uncharacterized conserved protein [Funct 94.99
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.9
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.86
PF13512142 TPR_18: Tetratricopeptide repeat 94.84
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.81
COG3629280 DnrI DNA-binding transcriptional activator of the 94.8
KOG3941406 consensus Intermediate in Toll signal transduction 94.79
KOG4555175 consensus TPR repeat-containing protein [Function 94.75
KOG1941518 consensus Acetylcholine receptor-associated protei 94.54
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.51
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.4
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.37
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.15
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.12
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 93.93
KOG1585308 consensus Protein required for fusion of vesicles 93.9
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.79
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 93.79
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.69
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.6
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 93.49
KOG4570 418 consensus Uncharacterized conserved protein [Funct 93.37
PF1343134 TPR_17: Tetratricopeptide repeat 93.34
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.31
PF1343134 TPR_17: Tetratricopeptide repeat 93.06
COG4649221 Uncharacterized protein conserved in bacteria [Fun 92.88
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 92.67
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.67
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 92.61
PF13929292 mRNA_stabil: mRNA stabilisation 92.6
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.55
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 92.52
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 92.52
COG3947361 Response regulator containing CheY-like receiver a 92.35
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 91.99
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.82
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.56
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 91.43
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 91.36
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 91.03
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 90.8
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 90.59
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 90.5
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 90.29
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 90.27
KOG4570 418 consensus Uncharacterized conserved protein [Funct 90.04
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 89.42
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 89.13
COG1747 711 Uncharacterized N-terminal domain of the transcrip 89.06
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 89.0
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.96
COG2976207 Uncharacterized protein conserved in bacteria [Fun 88.93
KOG4648 536 consensus Uncharacterized conserved protein, conta 88.7
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 88.68
COG4455273 ImpE Protein of avirulence locus involved in tempe 88.58
KOG4234271 consensus TPR repeat-containing protein [General f 88.46
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 88.21
COG5187412 RPN7 26S proteasome regulatory complex component, 88.19
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 87.97
PF13929292 mRNA_stabil: mRNA stabilisation 87.68
COG1747 711 Uncharacterized N-terminal domain of the transcrip 87.67
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 87.6
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 87.57
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 87.27
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 87.22
PF06552186 TOM20_plant: Plant specific mitochondrial import r 86.99
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 86.88
KOG1586288 consensus Protein required for fusion of vesicles 86.8
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.59
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 86.27
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 85.82
COG4455273 ImpE Protein of avirulence locus involved in tempe 85.23
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 85.18
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 84.93
KOG1586288 consensus Protein required for fusion of vesicles 84.73
KOG1550552 consensus Extracellular protein SEL-1 and related 84.64
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 84.59
PF07575566 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR0 84.3
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 84.29
KOG4648 536 consensus Uncharacterized conserved protein, conta 83.92
PRK09687280 putative lyase; Provisional 83.86
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 83.57
COG5159421 RPN6 26S proteasome regulatory complex component [ 83.16
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 82.46
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 82.21
KOG4234271 consensus TPR repeat-containing protein [General f 82.15
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 81.86
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 80.76
KOG1550552 consensus Extracellular protein SEL-1 and related 80.43
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=9.8e-62  Score=484.43  Aligned_cols=415  Identities=17%  Similarity=0.289  Sum_probs=362.1

Q ss_pred             CCCHHHHHHHHHHHhhCch--HHHHHHHHHhhcCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCHHHHHHH
Q 011648           60 RVSPEIVEDVLEKFRNAGT--LAFCFFKWAEKQQNYEHSVRAYHSMIESLAKIRQYQIMWDLVNAMRTKRMLNVETFCII  137 (480)
Q Consensus        60 ~~~~~~~~~~l~~~~~~~~--~A~~~f~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~l  137 (480)
                      ..+...+..++..+.+.++  .|+++|++|.+..-.+++...++.++..|.+.|.+++|..+|+.|..   |+..+|+.+
T Consensus       367 ~~~~~~~~~~y~~l~r~G~l~eAl~Lfd~M~~~gvv~~~~v~~~~li~~~~~~g~~~eAl~lf~~M~~---pd~~Tyn~L  443 (1060)
T PLN03218        367 KRKSPEYIDAYNRLLRDGRIKDCIDLLEDMEKRGLLDMDKIYHAKFFKACKKQRAVKEAFRFAKLIRN---PTLSTFNML  443 (1060)
T ss_pred             CCCchHHHHHHHHHHHCcCHHHHHHHHHHHHhCCCCCchHHHHHHHHHHHHHCCCHHHHHHHHHHcCC---CCHHHHHHH
Confidence            3455677778888877765  78999998877655667888888888888888888889888888865   788889999


Q ss_pred             HHHHHHcCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHccCChhhHHHHHHHhhc-CCCCChhhHHHHHHHHhcCCCh
Q 011648          138 MRKYARVQKVEEAVYTFNVMQKYGVTQNLAAFNGLLSALCKSKNVRKAQEIFDCMKD-RFIPDSKTYSILLEGWGKDPNL  216 (480)
Q Consensus       138 i~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~-~~~~~~~~~~~l~~~~~~~~~~  216 (480)
                      +.+|++.|+++.|.++|+.|.+.|+.||..+|+.+|.+|++.|++++|.++|++|.+ +..||..+|+.+|.+|++.|++
T Consensus       444 L~a~~k~g~~e~A~~lf~~M~~~Gl~pD~~tynsLI~~y~k~G~vd~A~~vf~eM~~~Gv~PdvvTynaLI~gy~k~G~~  523 (1060)
T PLN03218        444 MSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALIDGCARAGQV  523 (1060)
T ss_pred             HHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCcCH
Confidence            999999999999999999998888888989999999999999999999999988887 7788889999999999999999


Q ss_pred             hHHHHHHHHHHHcCCCCChhhHHHHHHHHHhcCCHHHHHHHHHHhHh--CCCCcCHHHHHHHHHHhhccCCHHHHHHHHH
Q 011648          217 PRAREIFREMVDTGCNPDIVTYGIMVDVLCKAGRVDEALGIVKSMDS--TVCRPTSFIYSVLVHTYGVENRIEDAVDTFL  294 (480)
Q Consensus       217 ~~a~~~~~~m~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~--~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~  294 (480)
                      ++|.++|++|.+.|+.||..+|+.++.+|++.|++++|.+++++|..  .|+.||..+|+.++.+|++.|++++|.++|+
T Consensus       524 eeAl~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~PD~vTynaLI~ay~k~G~ldeA~elf~  603 (1060)
T PLN03218        524 AKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQ  603 (1060)
T ss_pred             HHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHCCCHHHHHHHHH
Confidence            99999999998888888988999999999999999999999988865  5778888889999999999999999999999


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHHcCCHhHHHHHHHHHHhCCCCCChhhHHHHHHHHHhCCChhHHHHHHHHHHh-cCCCC
Q 011648          295 EMEKNGILADVAMYNALIGAFCKANKFKNVYRVLKDMNSKGVAPNSRTCNIILNGLIGRGETDEAYRVFRRMIK-LCEAD  373 (480)
Q Consensus       295 ~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~-~~~~~  373 (480)
                      +|.+.|+.|+..+|+.+|.+|++.|++++|..+|++|.+.|+.||..+|+.++.+|++.|++++|.++++.|.+ +.+|+
T Consensus       604 ~M~e~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~eeA~~l~~eM~k~G~~pd  683 (1060)
T PLN03218        604 MIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIKLG  683 (1060)
T ss_pred             HHHHcCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCC
Confidence            99888888888899999999999999999999999998888888888999999999999999999999988888 78888


Q ss_pred             HHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhCCChHHHHHHHHHHHHcCCCCCHHHHHHHHHH
Q 011648          374 ADTYTMMIKMFCQGGELEKAFKVWKYMKLKRFIPSMHTFSVLINGLCDKGIVSDSCVLLEDMIEKGIRPSGETFGKLRKL  453 (480)
Q Consensus       374 ~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~p~~~~~~~l~~~  453 (480)
                      ..+|+.++.+|++.|++++|.++|++|.+.|+.||..+|+.+|.+|++.|++++|.++|++|.+.|+.||..||..++.+
T Consensus       684 ~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~~Gi~Pd~~Ty~sLL~a  763 (1060)
T PLN03218        684 TVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKRLGLCPNTITYSILLVA  763 (1060)
T ss_pred             HHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHH
Confidence            88999999999999999999999998888888889999999999999999999999999998888888999999988889


Q ss_pred             HHhcCCHHHHHHHHHHHHhccCCC
Q 011648          454 LIKEGREDVLKFLQEKMNLLVKEP  477 (480)
Q Consensus       454 ~~~~g~~~~a~~~~~~~~~l~~~~  477 (480)
                      |.+.|+.++|.+++++|.+.+..|
T Consensus       764 ~~k~G~le~A~~l~~~M~k~Gi~p  787 (1060)
T PLN03218        764 SERKDDADVGLDLLSQAKEDGIKP  787 (1060)
T ss_pred             HHHCCCHHHHHHHHHHHHHcCCCC
Confidence            999999999999998888776654



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF07575 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR011502 This is a family of nucleoporins conserved from yeast to human Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query480
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-16
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-12
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-05
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 81.8 bits (200), Expect = 1e-16
 Identities = 16/206 (7%), Positives = 58/206 (28%), Gaps = 5/206 (2%)

Query: 132 ETFCIIMRKYARVQKVEEAVYTFNVMQKYGVTQNLAAFNGLLSALCKSKNVRKAQEIFDC 191
           E    ++++      ++          +  ++               +  +  A  +   
Sbjct: 93  EQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVV 152

Query: 192 MKD----RFIPDSKTYSILLEGWGKDPNLPRAREIFREMVDTGCNPDIVTYGIMVDVLCK 247
                  R +     Y+ ++ GW +         +   + D G  PD+++Y   +  + +
Sbjct: 153 HHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGR 212

Query: 248 AGRVDEALG-IVKSMDSTVCRPTSFIYSVLVHTYGVENRIEDAVDTFLEMEKNGILADVA 306
             +    +   ++ M     +  +   +VL+        ++              L    
Sbjct: 213 QDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPV 272

Query: 307 MYNALIGAFCKANKFKNVYRVLKDMN 332
             + L+      +   +  ++   + 
Sbjct: 273 NTSKLLRDVYAKDGRVSYPKLHLPLK 298


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query480
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.94
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.92
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.91
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.89
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.88
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.88
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.86
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.86
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.86
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.86
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.85
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.84
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.83
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.82
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.81
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.81
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.8
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.79
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.77
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.77
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.75
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.74
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.73
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.73
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.72
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.72
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.7
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.69
3u4t_A272 TPR repeat-containing protein; structural genomics 99.68
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.68
3u4t_A272 TPR repeat-containing protein; structural genomics 99.68
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.68
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.66
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.66
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.66
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.66
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.65
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.65
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.65
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.64
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.64
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.64
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.63
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.61
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.59
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.59
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.58
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.58
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.58
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.56
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.56
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.55
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.55
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.55
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.55
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.53
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.52
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.51
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.49
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.49
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.46
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.45
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.44
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.43
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.42
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.42
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.42
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.38
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.36
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.35
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.35
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.3
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.28
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.27
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.24
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.23
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.22
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.2
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.18
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.14
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.14
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.14
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.13
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.12
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.12
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.1
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.09
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.09
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.08
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.06
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.05
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.04
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.04
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.04
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.03
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.03
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.02
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.01
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.01
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.01
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.98
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.96
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.9
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.89
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.89
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.87
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.87
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.86
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.85
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.84
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.84
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.83
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.83
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.82
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.81
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.81
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.8
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.78
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.77
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.76
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.75
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.74
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.74
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.74
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.72
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.72
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.71
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.71
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.71
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.69
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.68
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.68
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.66
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.66
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.63
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.62
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.61
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.6
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.6
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.59
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.58
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.56
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.56
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.55
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.54
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.52
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.52
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.51
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.51
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.49
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.49
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.48
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.47
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.47
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.46
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.41
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.4
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.39
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.38
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.36
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.36
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.33
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.28
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.25
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.25
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.24
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.23
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.23
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.23
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.21
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.2
3k9i_A117 BH0479 protein; putative protein binding protein, 98.17
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.17
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.16
3k9i_A117 BH0479 protein; putative protein binding protein, 98.14
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.09
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.09
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.08
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.03
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.02
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.02
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.97
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.94
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.93
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.86
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.85
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.85
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.82
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.79
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.79
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.77
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.59
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.54
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.48
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.35
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.29
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.23
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.13
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.97
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.96
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.9
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.8
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.75
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.71
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.64
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.63
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.62
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.62
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.61
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.58
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.57
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.44
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.41
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.22
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.14
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.9
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.89
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.69
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.43
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.33
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.22
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.05
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.01
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 94.49
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 94.44
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.05
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.57
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 93.54
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.08
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.38
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 92.16
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 91.73
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 91.53
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 91.45
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 91.44
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.44
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 91.26
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 91.23
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.19
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 91.05
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 88.57
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 88.31
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 86.07
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 84.6
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 84.02
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 83.6
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 83.11
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 82.93
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 82.11
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 81.33
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 80.9
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 80.73
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.7e-36  Score=299.61  Aligned_cols=408  Identities=10%  Similarity=0.057  Sum_probs=340.6

Q ss_pred             CCCCHHHHHHHHHHHhhCch--HHHHHHHHHhhcCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHhCC---------
Q 011648           59 IRVSPEIVEDVLEKFRNAGT--LAFCFFKWAEKQQNYEHSVRAYHSMIESLAKIRQYQIMWDLVNAMRTKR---------  127 (480)
Q Consensus        59 ~~~~~~~~~~~l~~~~~~~~--~A~~~f~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~---------  127 (480)
                      ..|++..+..+...+...++  .|+.+|+.+...   ++++.+++.++..|.+.|++++|.++|+++....         
T Consensus       113 ~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~---~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~  189 (597)
T 2xpi_A          113 ITGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLY---NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKL  189 (597)
T ss_dssp             HHCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGG---GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC---------
T ss_pred             hCCCchHHHHHHHHHHHcCcHHHHHHHHHHHhcc---ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccc
Confidence            34566666667777766665  677888766433   3677888888888888888888888887432221         


Q ss_pred             -------CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCCCHHHHHHH----------------------------
Q 011648          128 -------MLNVETFCIIMRKYARVQKVEEAVYTFNVMQKYGVTQNLAAFNGL----------------------------  172 (480)
Q Consensus       128 -------~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l----------------------------  172 (480)
                             +.+..+|..++..|.+.|++++|+++|+++.+.+ +.+...+..+                            
T Consensus       190 ~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~  268 (597)
T 2xpi_A          190 LMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVD-AKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDA  268 (597)
T ss_dssp             -CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGH
T ss_pred             cccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-chhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchH
Confidence                   1246778888888888888888888888887764 3344443333                            


Q ss_pred             ----------HHHHHccCChhhHHHHHHHhhcCCCCChhhHHHHHHHHhcCCChhHHHHHHHHHHHcCCCCChhhHHHHH
Q 011648          173 ----------LSALCKSKNVRKAQEIFDCMKDRFIPDSKTYSILLEGWGKDPNLPRAREIFREMVDTGCNPDIVTYGIMV  242 (480)
Q Consensus       173 ----------l~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~l~  242 (480)
                                +..|.+.|++++|.++|+++... +++..+|+.++..|.+.|++++|.++|+++.+.+.. +..++..++
T Consensus       269 ~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~-~~~~~~~l~  346 (597)
T 2xpi_A          269 AFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL-EKSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPY-NLDVYPLHL  346 (597)
T ss_dssp             HHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG-GGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CCTTHHHHH
T ss_pred             HHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC-CchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcCcc-cHHHHHHHH
Confidence                      34455677788888888887664 578899999999999999999999999999977643 788899999


Q ss_pred             HHHHhcCCHHHHHHHHHHhHhCCCCcCHHHHHHHHHHhhccCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCHh
Q 011648          243 DVLCKAGRVDEALGIVKSMDSTVCRPTSFIYSVLVHTYGVENRIEDAVDTFLEMEKNGILADVAMYNALIGAFCKANKFK  322 (480)
Q Consensus       243 ~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~  322 (480)
                      .++.+.|++++|.++++++.+.. +.+..++..++.+|.+.|++++|.++|+++.+.. +.+..+|+.++.+|.+.|+++
T Consensus       347 ~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~  424 (597)
T 2xpi_A          347 ASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHD  424 (597)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHH
T ss_pred             HHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHH
Confidence            99999999999999999998654 6678899999999999999999999999998753 336889999999999999999


Q ss_pred             HHHHHHHHHHhCCCCCChhhHHHHHHHHHhCCChhHHHHHHHHHHhcCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHh
Q 011648          323 NVYRVLKDMNSKGVAPNSRTCNIILNGLIGRGETDEAYRVFRRMIKLCEADADTYTMMIKMFCQGGELEKAFKVWKYMKL  402 (480)
Q Consensus       323 ~a~~~~~~~~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~  402 (480)
                      +|..+|+++.+.+. .+..++..++.+|.+.|++++|.++|+++.+..+.+..+|..++..|.+.|++++|.++|+++.+
T Consensus       425 ~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~  503 (597)
T 2xpi_A          425 QAISAYTTAARLFQ-GTHLPYLFLGMQHMQLGNILLANEYLQSSYALFQYDPLLLNELGVVAFNKSDMQTAINHFQNALL  503 (597)
T ss_dssp             HHHHHHHHHHHTTT-TCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhCc-cchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHH
Confidence            99999999998744 37789999999999999999999999999998888999999999999999999999999999987


Q ss_pred             C----CCCCC--HHHHHHHHHHHHhCCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhccCC
Q 011648          403 K----RFIPS--MHTFSVLINGLCDKGIVSDSCVLLEDMIEKGIRPSGETFGKLRKLLIKEGREDVLKFLQEKMNLLVKE  476 (480)
Q Consensus       403 ~----~~~p~--~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~l~~~  476 (480)
                      .    +..|+  ..+|..++.+|.+.|++++|.++++++.+.+ +.+..+|..+..+|.+.|++++|.++++++.++++.
T Consensus       504 ~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~  582 (597)
T 2xpi_A          504 LVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLS-TNDANVHTAIALVYLHKKIPGLAITHLHESLAISPN  582 (597)
T ss_dssp             HHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-SCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT
T ss_pred             hhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCC
Confidence            5    55677  7899999999999999999999999999865 447899999999999999999999999999988765



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 480
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-05
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 43.1 bits (100), Expect = 5e-05
 Identities = 45/308 (14%), Positives = 109/308 (35%), Gaps = 13/308 (4%)

Query: 95  HSVRAYHSMIESLAKIRQYQIMWDLVNAMRTKRMLNVETFCIIMRKYARVQKVEEAVYTF 154
               AY ++     +  Q Q   +        +   ++ +  +         +E AV  +
Sbjct: 65  LLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAY 124

Query: 155 NVMQKYGVTQNLAAFNGLLSALCKSKNVRKAQEIFDCMKDRFIPDSKTYSILLEGWGKDP 214
               +Y         +           + +A+  +    +     +  +S L   +    
Sbjct: 125 VSALQYNPDLYCVRSDLGNLL-KALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQG 183

Query: 215 NLPRAREIFREMVDTGCNPDIV-TYGIMVDVLCKAGRVDEALGIVKSMDSTVCRPTSFIY 273
            +  A   F + V    +P+ +  Y  + +VL +A   D A+       S +    + ++
Sbjct: 184 EIWLAIHHFEKAVTL--DPNFLDAYINLGNVLKEARIFDRAVAAYLRALS-LSPNHAVVH 240

Query: 274 SVLVHTYGVENRIEDAVDTF---LEMEKNGILADVAMYNALIGAFCKANKFKNVYRVLKD 330
             L   Y  +  I+ A+DT+   +E++ +        Y  L  A  +             
Sbjct: 241 GNLACVYYEQGLIDLAIDTYRRAIELQPH----FPDAYCNLANALKEKGSVAEAEDCYNT 296

Query: 331 MNSKGVAPNSRTCNIILNGLIGRGETDEAYRVFRRMIKLCEADADTYTMMIKMFCQGGEL 390
              +    ++ + N + N    +G  +EA R++R+ +++    A  ++ +  +  Q G+L
Sbjct: 297 A-LRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKL 355

Query: 391 EKAFKVWK 398
           ++A   +K
Sbjct: 356 QEALMHYK 363


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query480
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.94
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.94
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.68
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.66
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.35
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.32
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.32
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.31
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.3
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.3
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.26
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.21
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.16
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.13
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.79
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.73
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.7
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.68
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.64
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.63
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.62
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.59
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.54
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.52
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.49
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.47
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.4
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.32
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.24
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.2
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.19
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.18
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.06
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.03
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.0
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.99
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.99
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.96
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.94
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.93
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.93
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.92
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.92
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.79
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.72
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.69
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.62
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.33
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.27
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.19
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.01
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.38
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.33
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.1
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.55
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.31
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 94.21
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 93.43
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 93.35
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 90.38
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 80.99
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94  E-value=1.3e-22  Score=186.38  Aligned_cols=371  Identities=12%  Similarity=0.079  Sum_probs=311.0

Q ss_pred             HHHHHHHHHhhcCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHH
Q 011648           79 LAFCFFKWAEKQQNYEHSVRAYHSMIESLAKIRQYQIMWDLVNAMRTKRMLNVETFCIIMRKYARVQKVEEAVYTFNVMQ  158 (480)
Q Consensus        79 ~A~~~f~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~  158 (480)
                      .|.+.|+.+.+..+  .++.++..+...+.+.|++++|...|+++.+.+|.+..+|..+...+.+.|++++|+..+....
T Consensus        17 ~A~~~~~~~l~~~p--~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A~~~~~~~~   94 (388)
T d1w3ba_          17 AAERHCMQLWRQEP--DNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHAL   94 (388)
T ss_dssp             HHHHHHHHHHHHCT--TCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhCC--CCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccccccccccccc
Confidence            89999988876643  5788999999999999999999999999999888888999999999999999999999999988


Q ss_pred             hcCCCCCHHHHHHHHHHHHccCChhhHHHHHHHhhcCCCCChhhHHHHHHHHhcCCChhHHHHHHHHHHHcCCCCChhhH
Q 011648          159 KYGVTQNLAAFNGLLSALCKSKNVRKAQEIFDCMKDRFIPDSKTYSILLEGWGKDPNLPRAREIFREMVDTGCNPDIVTY  238 (480)
Q Consensus       159 ~~~~~~~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~  238 (480)
                      +.. +.+..............+....+............................+....+...+.+...... -+...+
T Consensus        95 ~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~  172 (388)
T d1w3ba_          95 RLK-PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQP-NFAVAW  172 (388)
T ss_dssp             HHC-TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCT-TCHHHH
T ss_pred             ccc-cccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccCc-chhHHH
Confidence            875 455566666666666667777777766666655555666777777788888888999988888876542 256777


Q ss_pred             HHHHHHHHhcCCHHHHHHHHHHhHhCCCCcCHHHHHHHHHHhhccCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHc
Q 011648          239 GIMVDVLCKAGRVDEALGIVKSMDSTVCRPTSFIYSVLVHTYGVENRIEDAVDTFLEMEKNGILADVAMYNALIGAFCKA  318 (480)
Q Consensus       239 ~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~  318 (480)
                      ..+...+...|++++|...++...... +.+...+..+...+...|++++|...+.+....+. .+...+..+...+.+.
T Consensus       173 ~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~  250 (388)
T d1w3ba_         173 SNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSP-NHAVVHGNLACVYYEQ  250 (388)
T ss_dssp             HHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHT
T ss_pred             HhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhh-hHHHHHHHHHHHHHHC
Confidence            888889999999999999999987764 45677888899999999999999999999887643 3677788888999999


Q ss_pred             CCHhHHHHHHHHHHhCCCCCChhhHHHHHHHHHhCCChhHHHHHHHHHHhcCCCCHHHHHHHHHHHHhcCCHHHHHHHHH
Q 011648          319 NKFKNVYRVLKDMNSKGVAPNSRTCNIILNGLIGRGETDEAYRVFRRMIKLCEADADTYTMMIKMFCQGGELEKAFKVWK  398 (480)
Q Consensus       319 ~~~~~a~~~~~~~~~~~~~p~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~  398 (480)
                      |++++|...|++..+..+. +...+..+...+...|++++|.+.++......+.+...+..+...+...|++++|.+.++
T Consensus       251 ~~~~~A~~~~~~al~~~p~-~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~  329 (388)
T d1w3ba_         251 GLIDLAIDTYRRAIELQPH-FPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYR  329 (388)
T ss_dssp             TCHHHHHHHHHHHHHTCSS-CHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHHHHH
Confidence            9999999999999886433 567888899999999999999999999998888999999999999999999999999999


Q ss_pred             HHHhCCCCCCHHHHHHHHHHHHhCCChHHHHHHHHHHHHcCCCC-CHHHHHHHHHHHHhcCC
Q 011648          399 YMKLKRFIPSMHTFSVLINGLCDKGIVSDSCVLLEDMIEKGIRP-SGETFGKLRKLLIKEGR  459 (480)
Q Consensus       399 ~~~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~p-~~~~~~~l~~~~~~~g~  459 (480)
                      +..+.... +..++..+..+|...|++++|...|+++++.  .| +...+..+..++.+.|+
T Consensus       330 ~al~~~p~-~~~~~~~la~~~~~~g~~~~A~~~~~~al~l--~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         330 KALEVFPE-FAAAHSNLASVLQQQGKLQEALMHYKEAIRI--SPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHTTSCTT-CHHHHHHHHHHHHTTTCCHHHHHHHHHHHTT--CTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHhCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCC
Confidence            99876533 6788899999999999999999999999874  44 46778888888887775



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure