Citrus Sinensis ID: 011686
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 479 | ||||||
| 255557651 | 727 | lipid binding protein, putative [Ricinus | 0.993 | 0.654 | 0.882 | 0.0 | |
| 449456757 | 724 | PREDICTED: uncharacterized protein LOC10 | 0.991 | 0.656 | 0.859 | 0.0 | |
| 356496432 | 725 | PREDICTED: uncharacterized protein LOC10 | 0.995 | 0.657 | 0.851 | 0.0 | |
| 356531485 | 722 | PREDICTED: uncharacterized protein LOC10 | 0.989 | 0.656 | 0.843 | 0.0 | |
| 357484695 | 725 | Kinase-START [Medicago truncatula] gi|35 | 0.966 | 0.638 | 0.858 | 0.0 | |
| 224074418 | 723 | predicted protein [Populus trichocarpa] | 0.983 | 0.651 | 0.820 | 0.0 | |
| 297800150 | 718 | hypothetical protein ARALYDRAFT_492951 [ | 0.983 | 0.655 | 0.833 | 0.0 | |
| 42566947 | 718 | enhanced disease resistance 2 protein [A | 0.983 | 0.655 | 0.831 | 0.0 | |
| 225427393 | 716 | PREDICTED: uncharacterized protein LOC10 | 0.956 | 0.639 | 0.855 | 0.0 | |
| 224139070 | 725 | predicted protein [Populus trichocarpa] | 0.991 | 0.655 | 0.825 | 0.0 |
| >gi|255557651|ref|XP_002519855.1| lipid binding protein, putative [Ricinus communis] gi|223540901|gb|EEF42459.1| lipid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 902 bits (2330), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 422/478 (88%), Positives = 448/478 (93%), Gaps = 2/478 (0%)
Query: 3 SKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKKKPQDNQVPIKTLLIDGNCRVE 62
SKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYK+KPQDNQVPIKT+LIDGNCRVE
Sbjct: 2 SKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVE 61
Query: 63 DRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIELVIDQHQESQVSNGN 122
DRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIE VIDQHQESQV NGN
Sbjct: 62 DRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGN 121
Query: 123 KYVSFEYKSGMDNGRNGSSSDHESQFSAQEDEDDGHLNLMRRTTIGNGPPDLVHDWTREL 182
KY+SFEYKSGMDNGR SSSDHESQFSAQEDEDD + NL+RRTTIGNGPPD V DWTRE+
Sbjct: 122 KYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREV 181
Query: 183 DSDLSNQNINNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEASCEE 242
DS+LS QN NNQAFSRKHWRLLQCQNGLRIFEEL+EVDYLPRSCSRAMKAVGVVEA+CEE
Sbjct: 182 DSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEE 241
Query: 243 IFELVMSMDGTRYEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYWR 302
IFELVMSMDGTR+EWDCSFQYGSLVEEVDGHTAILYHRLQLDWFP F+WPRDLCYVRYWR
Sbjct: 242 IFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWR 301
Query: 303 RNDDGSYVVLFRSREHENCGPQPGYVRAHVESGGFNISPLKPRNGRPRTQVQHLMQIDLK 362
RNDDGSYVVLFRSREHENCGPQPG VRAHVESGGFNI+PLKPRNGRPRTQVQHLMQIDLK
Sbjct: 302 RNDDGSYVVLFRSREHENCGPQPGCVRAHVESGGFNIAPLKPRNGRPRTQVQHLMQIDLK 361
Query: 363 GWGVGYLSMFQQHCLFQMLNSVAGLREWFAQTDERSAHPRIPVMVNMASASVSSKKNQNL 422
GWGVGY+S FQQHCL QMLNSVAGLREWF+QTDER A PRIPVMVNMASAS S+KKN L
Sbjct: 362 GWGVGYVSSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVMVNMASASASTKKNFKL 421
Query: 423 QDSLIHPSSSLDQLNAGSRHSVMMDEYSDEDEEFQLAESEQEA--NEKKIENDFKRTG 478
Q+S +HP+ SLDQ+NA SR+S +MDEYSDEDEE+Q+AE EQEA +K+ END +RT
Sbjct: 422 QESSVHPAPSLDQINAASRNSTIMDEYSDEDEEYQIAEEEQEAYQTKKENENDMRRTA 479
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449456757|ref|XP_004146115.1| PREDICTED: uncharacterized protein LOC101209463 [Cucumis sativus] gi|449509520|ref|XP_004163612.1| PREDICTED: uncharacterized LOC101209463 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356496432|ref|XP_003517072.1| PREDICTED: uncharacterized protein LOC100806401 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356531485|ref|XP_003534308.1| PREDICTED: uncharacterized protein LOC100808706 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357484695|ref|XP_003612635.1| Kinase-START [Medicago truncatula] gi|355513970|gb|AES95593.1| Kinase-START [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224074418|ref|XP_002304367.1| predicted protein [Populus trichocarpa] gi|222841799|gb|EEE79346.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297800150|ref|XP_002867959.1| hypothetical protein ARALYDRAFT_492951 [Arabidopsis lyrata subsp. lyrata] gi|297313795|gb|EFH44218.1| hypothetical protein ARALYDRAFT_492951 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|42566947|ref|NP_193639.2| enhanced disease resistance 2 protein [Arabidopsis thaliana] gi|332658730|gb|AEE84130.1| enhanced disease resistance 2 protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|225427393|ref|XP_002262725.1| PREDICTED: uncharacterized protein LOC100246589 isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224139070|ref|XP_002326760.1| predicted protein [Populus trichocarpa] gi|222834082|gb|EEE72559.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 479 | ||||||
| TAIR|locus:2117134 | 724 | EDR2 "ENHANCED DISEASE RESISTA | 0.983 | 0.650 | 0.802 | 8.9e-212 | |
| TAIR|locus:2163548 | 719 | AT5G45560 [Arabidopsis thalian | 0.983 | 0.655 | 0.778 | 2e-205 | |
| TAIR|locus:2102465 | 733 | AT3G54800 [Arabidopsis thalian | 0.442 | 0.289 | 0.390 | 5.4e-49 | |
| TAIR|locus:2057547 | 737 | AT2G28320 [Arabidopsis thalian | 0.599 | 0.389 | 0.348 | 3.7e-48 | |
| TAIR|locus:2182417 | 811 | AT5G35180 [Arabidopsis thalian | 0.665 | 0.393 | 0.261 | 1.8e-22 | |
| UNIPROTKB|A1A4M6 | 213 | STARD5 "StAR-related lipid tra | 0.269 | 0.605 | 0.284 | 4.8e-05 | |
| UNIPROTKB|Q28918 | 285 | STAR "Steroidogenic acute regu | 0.256 | 0.431 | 0.323 | 0.00012 | |
| UNIPROTKB|Q28996 | 285 | STAR "Steroidogenic acute regu | 0.256 | 0.431 | 0.315 | 0.00074 | |
| UNIPROTKB|Q5Q0U1 | 285 | STAR "Steroidogenic acute regu | 0.256 | 0.431 | 0.315 | 0.00074 |
| TAIR|locus:2117134 EDR2 "ENHANCED DISEASE RESISTANCE 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2047 (725.6 bits), Expect = 8.9e-212, P = 8.9e-212
Identities = 385/480 (80%), Positives = 414/480 (86%)
Query: 3 SKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKKKPQDNQVPIKTLLIDGNCRVE 62
SKVVYEGWMVRYGRRKIGRS+IHMRYFVLE RLLAYYKKKPQD QVPIKT+LIDGNCRVE
Sbjct: 2 SKVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDYQVPIKTMLIDGNCRVE 61
Query: 63 DRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIELVIDQHQESQVSNGN 122
DRGLKTHHGHMVYVLSVYNKKEK HRITMAAFNIQEAL+WKEKIE VIDQHQESQV NG
Sbjct: 62 DRGLKTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKIESVIDQHQESQVPNGQ 121
Query: 123 KYVSFEYKSGMDNGRNGSSSDHESQ------FSAQEDEDDGHLNLMRRTTIGNGPPDLVH 176
+YVSFEYKSGMD GR SSSDHESQ FSA EDE+D +LMRRTTIGNGPP+ V
Sbjct: 122 QYVSFEYKSGMDTGRTASSSDHESQSAISFRFSAAEDEEDSRRSLMRRTTIGNGPPESVL 181
Query: 177 DWTRELDSDLSNQNINNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVV 236
DWT+E D++L+NQN +NQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVV
Sbjct: 182 DWTKEFDAELANQNSDNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVV 241
Query: 237 EASCEEIFELVMSMDGTRYEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLC 296
EA+CEEIFEL+MSMDGTRYEWDCSFQ+GSLVEEVDGHTA+LYHRL LDWFPM VWPRDLC
Sbjct: 242 EATCEEIFELLMSMDGTRYEWDCSFQFGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLC 301
Query: 297 YVRYWRRNDDGSYVVLFRSREHENCGPQPGYVRAHVESGGFNISPLKPRNGRPRTQVQHL 356
YVRYWRRNDDGSYVVLFRSREHENCGPQPG VRAH+ESGG+NISPLKPRNGRPRTQVQHL
Sbjct: 302 YVRYWRRNDDGSYVVLFRSREHENCGPQPGCVRAHLESGGYNISPLKPRNGRPRTQVQHL 361
Query: 357 MQIDLKGWGVGYLSMFQQHCLFQMLNSVAGLREWFAQTDERSAHPRIPVXXXXXXXXXXX 416
+QIDLKGWG GYL FQQHCL QMLNSVAGLREWF+QTDER H RIPV
Sbjct: 362 IQIDLKGWGAGYLPAFQQHCLLQMLNSVAGLREWFSQTDERGVHTRIPVMVNMASSSLSL 421
Query: 417 XXXQNLQDSLIHPSSSLDQLNAGSRHSVMMDEYSDEDEEFQLAESEQEANEKKIENDFKR 476
SL + SLDQ N+ +R+S++MDE SD+D+EFQ+AESEQE K E D KR
Sbjct: 422 TKSGK---SLHKSAFSLDQTNSVNRNSLLMDEDSDDDDEFQIAESEQEPETSKPETDVKR 478
|
|
| TAIR|locus:2163548 AT5G45560 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2102465 AT3G54800 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057547 AT2G28320 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2182417 AT5G35180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A1A4M6 STARD5 "StAR-related lipid transfer protein 5" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q28918 STAR "Steroidogenic acute regulatory protein, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q28996 STAR "Steroidogenic acute regulatory protein, mitochondrial" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5Q0U1 STAR "Steroidogenic acute regulatory protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pm.C_LG_III000277 | enhanced disease resistance protein (EDR2) (723 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 479 | |||
| PLN00188 | 719 | PLN00188, PLN00188, enhanced disease resistance pr | 0.0 | |
| cd00177 | 193 | cd00177, START, Lipid-binding START domain of mamm | 3e-49 | |
| smart00234 | 205 | smart00234, START, in StAR and phosphatidylcholine | 4e-41 | |
| pfam01852 | 205 | pfam01852, START, START domain | 1e-20 | |
| cd08869 | 197 | cd08869, START_RhoGAP, C-terminal lipid-binding ST | 3e-09 | |
| cd08876 | 195 | cd08876, START_1, Uncharacterized subgroup of the | 2e-08 | |
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 4e-08 | |
| cd08871 | 222 | cd08871, START_STARD10-like, Lipid-binding START d | 1e-07 | |
| cd08868 | 208 | cd08868, START_STARD1_3_like, Cholesterol-binding | 2e-06 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 3e-06 | |
| cd08903 | 208 | cd08903, START_STARD5-like, Lipid-binding START do | 3e-06 | |
| cd08867 | 206 | cd08867, START_STARD4_5_6-like, Lipid-binding STAR | 4e-06 | |
| cd13297 | 123 | cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin h | 1e-05 | |
| cd00821 | 92 | cd00821, PH, Pleckstrin homology (PH) domain | 4e-05 | |
| cd08905 | 209 | cd08905, START_STARD1-like, Cholesterol-binding ST | 5e-04 | |
| cd08909 | 205 | cd08909, START_STARD13-like, C-terminal lipid-bind | 5e-04 | |
| cd08904 | 204 | cd08904, START_STARD6-like, Lipid-binding START do | 6e-04 | |
| cd08872 | 235 | cd08872, START_STARD11-like, Ceramide-binding STAR | 6e-04 | |
| cd08873 | 235 | cd08873, START_STARD14_15-like, Lipid-binding STAR | 0.004 |
| >gnl|CDD|215094 PLN00188, PLN00188, enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
Score = 992 bits (2567), Expect = 0.0
Identities = 422/477 (88%), Positives = 441/477 (92%), Gaps = 6/477 (1%)
Query: 2 SSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKKKPQDNQVPIKTLLIDGNCRV 61
+SKVVYEGWMVRYGRRKIGRS+IHMRYFVLESRLLAYYKKKPQDNQVPIKTLLIDGNCRV
Sbjct: 1 ASKVVYEGWMVRYGRRKIGRSYIHMRYFVLESRLLAYYKKKPQDNQVPIKTLLIDGNCRV 60
Query: 62 EDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIELVIDQHQESQVSNG 121
EDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIE VIDQHQ+SQV NG
Sbjct: 61 EDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIESVIDQHQDSQVPNG 120
Query: 122 NKYVSFEYKSGMDNGRNGSSSDHESQFSAQEDEDDGHLNLMRRTTIGNGPPDLVHDWTRE 181
NKY SFEYKSGMDNGR SSSDHESQFSAQEDE+D H +L+RRTTIGNGPPD V DWT+E
Sbjct: 121 NKYASFEYKSGMDNGRTASSSDHESQFSAQEDEEDTHRDLLRRTTIGNGPPDSVLDWTKE 180
Query: 182 LDSDLSNQNINNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEASCE 241
DS+LSNQN NNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEA+CE
Sbjct: 181 FDSELSNQNSNNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEATCE 240
Query: 242 EIFELVMSMDGTRYEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYW 301
EIFELVMSMDGTR+EWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYW
Sbjct: 241 EIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYW 300
Query: 302 RRNDDGSYVVLFRSREHENCGPQPGYVRAHVESGGFNISPLKPRNGRPRTQVQHLMQIDL 361
RRNDDGSYVVLFRSREHENCGPQPG+VRAH+ESGGFNISPLKPRNGRPRTQVQHLMQIDL
Sbjct: 301 RRNDDGSYVVLFRSREHENCGPQPGFVRAHLESGGFNISPLKPRNGRPRTQVQHLMQIDL 360
Query: 362 KGWGVGYLSMFQQHCLFQMLNSVAGLREWFAQTDERSAHPRIPVMVNMASASVSSKKNQN 421
KGWGVGY+ FQQHCL QMLNSVAGLREWF+QTDER A PRIPVMVNMASASVSSKKNQ
Sbjct: 361 KGWGVGYIPSFQQHCLLQMLNSVAGLREWFSQTDERGAPPRIPVMVNMASASVSSKKNQK 420
Query: 422 LQDSLIHPSSSLDQLNAGSRHSVMMDEYSDEDEEFQLAESEQEANEKKIENDFKRTG 478
Q+S S SLDQ NA SR+SVMMDE SD+DEEFQ+ ESEQE K N+ K T
Sbjct: 421 PQES----SPSLDQTNAASRNSVMMDEDSDDDEEFQIPESEQEPETTK--NETKDTA 471
|
Length = 719 |
| >gnl|CDD|176851 cd00177, START, Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214575 smart00234, START, in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >gnl|CDD|216740 pfam01852, START, START domain | Back alignment and domain information |
|---|
| >gnl|CDD|176878 cd08869, START_RhoGAP, C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >gnl|CDD|176885 cd08876, START_1, Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|176880 cd08871, START_STARD10-like, Lipid-binding START domain of mammalian STARD10 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176877 cd08868, START_STARD1_3_like, Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|176912 cd08903, START_STARD5-like, Lipid-binding START domain of mammalian STARD5 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176876 cd08867, START_STARD4_5_6-like, Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|241451 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin homology (PH) domain, repeat 3 | Back alignment and domain information |
|---|
| >gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|176914 cd08905, START_STARD1-like, Cholesterol-binding START domain of mammalian STARD1 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176918 cd08909, START_STARD13-like, C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >gnl|CDD|176913 cd08904, START_STARD6-like, Lipid-binding START domain of mammalian STARD6 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176881 cd08872, START_STARD11-like, Ceramide-binding START domain of mammalian STARD11 and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|176882 cd08873, START_STARD14_15-like, Lipid-binding START domain of mammalian STARDT14, -15, and related proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 479 | |||
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 100.0 | |
| cd08914 | 236 | START_STARD15-like Lipid-binding START domain of m | 100.0 | |
| cd08873 | 235 | START_STARD14_15-like Lipid-binding START domain o | 100.0 | |
| cd08868 | 208 | START_STARD1_3_like Cholesterol-binding START doma | 100.0 | |
| cd08904 | 204 | START_STARD6-like Lipid-binding START domain of ma | 100.0 | |
| cd08913 | 240 | START_STARD14-like Lipid-binding START domain of m | 100.0 | |
| cd08906 | 209 | START_STARD3-like Cholesterol-binding START domain | 100.0 | |
| cd08903 | 208 | START_STARD5-like Lipid-binding START domain of ma | 100.0 | |
| cd08869 | 197 | START_RhoGAP C-terminal lipid-binding START domain | 100.0 | |
| cd08867 | 206 | START_STARD4_5_6-like Lipid-binding START domain o | 100.0 | |
| cd08874 | 205 | START_STARD9-like C-terminal START domain of mamma | 100.0 | |
| cd08871 | 222 | START_STARD10-like Lipid-binding START domain of m | 100.0 | |
| cd08905 | 209 | START_STARD1-like Cholesterol-binding START domain | 100.0 | |
| cd08909 | 205 | START_STARD13-like C-terminal lipid-binding START | 100.0 | |
| cd08902 | 202 | START_STARD4-like Lipid-binding START domain of ma | 100.0 | |
| smart00234 | 206 | START in StAR and phosphatidylcholine transfer pro | 100.0 | |
| cd08911 | 207 | START_STARD7-like Lipid-binding START domain of ma | 99.97 | |
| cd08872 | 235 | START_STARD11-like Ceramide-binding START domain o | 99.97 | |
| PF01852 | 206 | START: START domain; InterPro: IPR002913 START (St | 99.97 | |
| cd08910 | 207 | START_STARD2-like Lipid-binding START domain of ma | 99.97 | |
| cd08907 | 205 | START_STARD8-like C-terminal lipid-binding START d | 99.97 | |
| cd08870 | 209 | START_STARD2_7-like Lipid-binding START domain of | 99.97 | |
| cd00177 | 193 | START Lipid-binding START domain of mammalian STAR | 99.96 | |
| cd08908 | 204 | START_STARD12-like C-terminal lipid-binding START | 99.96 | |
| cd08876 | 195 | START_1 Uncharacterized subgroup of the steroidoge | 99.96 | |
| cd08877 | 215 | START_2 Uncharacterized subgroup of the steroidoge | 99.94 | |
| KOG2761 | 219 | consensus START domain-containing proteins involve | 99.89 | |
| cd08875 | 229 | START_ArGLABRA2_like C-terminal lipid-binding STAR | 99.55 | |
| cd08864 | 208 | SRPBCC_DUF3074 DUF3074, an uncharacterized ligand- | 99.41 | |
| KOG1739 | 611 | consensus Serine/threonine protein kinase GPBP [Si | 99.35 | |
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 99.2 | |
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 99.07 | |
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 99.05 | |
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 99.04 | |
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 99.03 | |
| cd07813 | 138 | COQ10p_like Coenzyme Q-binding protein COQ10p and | 98.91 | |
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 98.84 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 98.83 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 98.82 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 98.8 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 98.8 | |
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 98.8 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 98.79 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 98.78 | |
| cd08866 | 144 | SRPBCC_11 Ligand-binding SRPBCC domain of an uncha | 98.71 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 98.69 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 98.62 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 98.61 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 98.49 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 98.43 | |
| PF11274 | 184 | DUF3074: Protein of unknown function (DUF3074) | 98.42 | |
| cd07819 | 140 | SRPBCC_2 Ligand-binding SRPBCC domain of an unchar | 98.4 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 98.38 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 98.36 | |
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 98.32 | |
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 98.31 | |
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 98.23 | |
| PF15409 | 89 | PH_8: Pleckstrin homology domain | 98.23 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 98.22 | |
| cd05018 | 144 | CoxG Carbon monoxide dehydrogenase subunit G (CoxG | 98.21 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 98.2 | |
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 98.15 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 98.08 | |
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 98.04 | |
| PF03364 | 130 | Polyketide_cyc: Polyketide cyclase / dehydrase and | 98.01 | |
| cd01237 | 106 | Unc112 Unc-112 pleckstrin homology (PH) domain. Un | 98.0 | |
| cd08861 | 142 | OtcD1_ARO-CYC_like N-terminal and C-terminal aroma | 97.97 | |
| KOG0930 | 395 | consensus Guanine nucleotide exchange factor Cytoh | 97.74 | |
| cd07817 | 139 | SRPBCC_8 Ligand-binding SRPBCC domain of an unchar | 97.68 | |
| PRK10724 | 158 | hypothetical protein; Provisional | 97.68 | |
| cd08860 | 146 | TcmN_ARO-CYC_like N-terminal aromatase/cyclase dom | 97.62 | |
| cd07821 | 140 | PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), | 97.53 | |
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 97.51 | |
| PF10604 | 139 | Polyketide_cyc2: Polyketide cyclase / dehydrase an | 97.37 | |
| PF12814 | 123 | Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin | 97.19 | |
| cd07823 | 146 | SRPBCC_5 Ligand-binding SRPBCC domain of an unchar | 96.92 | |
| cd07824 | 146 | SRPBCC_6 Ligand-binding SRPBCC domain of an unchar | 96.8 | |
| cd08865 | 140 | SRPBCC_10 Ligand-binding SRPBCC domain of an uncha | 96.68 | |
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 96.57 | |
| KOG2200 | 674 | consensus Tumour suppressor protein p122-RhoGAP/DL | 96.4 | |
| cd07812 | 141 | SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SR | 96.38 | |
| cd01224 | 109 | PH_Collybistin Collybistin pleckstrin homology (PH | 96.2 | |
| cd01239 | 117 | PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom | 96.02 | |
| PF06240 | 140 | COXG: Carbon monoxide dehydrogenase subunit G (Cox | 95.91 | |
| cd08862 | 138 | SRPBCC_Smu440-like Ligand-binding SRPBCC domain of | 95.71 | |
| cd07818 | 150 | SRPBCC_1 Ligand-binding SRPBCC domain of an unchar | 95.57 | |
| cd07822 | 141 | SRPBCC_4 Ligand-binding SRPBCC domain of an unchar | 95.55 | |
| KOG3845 | 241 | consensus MLN, STAR and related lipid-binding prot | 94.73 | |
| cd01234 | 117 | PH_CADPS CADPS (Ca2+-dependent activator protein) | 94.54 | |
| cd01218 | 104 | PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | 94.22 | |
| cd01223 | 116 | PH_Vav Vav pleckstrin homology (PH) domain. Vav pl | 93.62 | |
| COG2867 | 146 | Oligoketide cyclase/lipid transport protein [Lipid | 93.08 | |
| PF15408 | 104 | PH_7: Pleckstrin homology domain | 92.52 | |
| cd01221 | 125 | PH_ephexin Ephexin Pleckstrin homology (PH) domain | 92.42 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 92.29 | |
| cd01261 | 112 | PH_SOS Son of Sevenless (SOS) Pleckstrin homology | 92.03 | |
| cd01222 | 97 | PH_clg Clg (common-site lymphoma/leukemia guanine | 91.61 | |
| cd07814 | 139 | SRPBCC_CalC_Aha1-like Putative hydrophobic ligand- | 91.18 | |
| cd07816 | 148 | Bet_v1-like Ligand-binding bet_v_1 domain of major | 90.74 | |
| COG3427 | 146 | Carbon monoxide dehydrogenase subunit G, CoxG [Ene | 90.68 | |
| cd07825 | 144 | SRPBCC_7 Ligand-binding SRPBCC domain of an unchar | 90.6 | |
| cd01259 | 114 | PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr | 90.28 | |
| KOG0690 | 516 | consensus Serine/threonine protein kinase [Signal | 90.08 | |
| cd07820 | 137 | SRPBCC_3 Ligand-binding SRPBCC domain of an unchar | 89.27 | |
| cd01225 | 111 | PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- | 87.62 | |
| cd01243 | 122 | PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin | 86.93 | |
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 85.91 | |
| KOG3640 | 1116 | consensus Actin binding protein Anillin [Cell cycl | 85.69 | |
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 85.38 | |
| KOG1090 | 1732 | consensus Predicted dual-specificity phosphatase [ | 84.27 | |
| COG5637 | 217 | Predicted integral membrane protein [Function unkn | 84.04 | |
| KOG2059 | 800 | consensus Ras GTPase-activating protein [Signal tr | 83.4 |
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.6e-118 Score=962.99 Aligned_cols=464 Identities=90% Similarity=1.421 Sum_probs=435.0
Q ss_pred CCCceeeeeEEEeeecceeeeeeeeeeEEEecceehhhccCCCCCCccceeeeecCceeEeecCcceeeCeEEEEEEEee
Q 011686 2 SSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKKKPQDNQVPIKTLLIDGNCRVEDRGLKTHHGHMVYVLSVYN 81 (479)
Q Consensus 2 ~~~~~~~gw~~~~~~~~~g~~~~~~ry~vl~~~~~~~yk~~p~~~~~pi~~~~i~~~~~v~d~g~~~~~~~~~yv~~~yn 81 (479)
++.+.|||||||||+||||++|||+|||||+|++|+|||++|.++++|||||+||+||||||+|||+|||++||||+|||
T Consensus 1 ~~~~~~eGW~y~~g~~kig~~~~~~Ry~vl~~~~~~~yK~~P~~~~~pirs~~id~~~rVed~Gr~~~~g~~~yvl~~Yn 80 (719)
T PLN00188 1 ASKVVYEGWMVRYGRRKIGRSYIHMRYFVLESRLLAYYKKKPQDNQVPIKTLLIDGNCRVEDRGLKTHHGHMVYVLSVYN 80 (719)
T ss_pred CCcceEeeEEEEEcccccccccceeEEEEEecchhhhcccCCccccccceeeccCCCceEeecCceEEcCceEEEEEEec
Confidence 46778999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccccceeeecccCHHHHHHHHHHHHHHHhhhccccccCCCcccccccccccCCCCCCCCCccccccccccccccccccc
Q 011686 82 KKEKYHRITMAAFNIQEALIWKEKIELVIDQHQESQVSNGNKYVSFEYKSGMDNGRNGSSSDHESQFSAQEDEDDGHLNL 161 (479)
Q Consensus 82 ~~~~~~~~~~~~~~~~ea~~w~~a~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 161 (479)
+++|++|++|||+|+|||++||+||++||+|++++...++++|++|++...+.+|++.++++++++++.++..++.++.+
T Consensus 81 ~~~~~~~~~~~a~~~eea~~W~~a~~~a~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~ 160 (719)
T PLN00188 81 KKEKYHRITMAAFNIQEALIWKEKIESVIDQHQDSQVPNGNKYASFEYKSGMDNGRTASSSDHESQFSAQEDEEDTHRDL 160 (719)
T ss_pred CCCccccEEEecCCHHHHHHHHHHHHHHHhhhccccccccccccceeeccccccccccccccccccccccccccccCccc
Confidence 99999999999999999999999999999999999888888999999999999999999999999888877777888899
Q ss_pred eeeeecCCCCCCccccCCccccccccccccccccccCCCcEEEEeeCCeEEEEEecccCCCCccccceEEEEEEecccHH
Q 011686 162 MRRTTIGNGPPDLVHDWTRELDSDLSNQNINNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEASCE 241 (479)
Q Consensus 162 ~~~~~~g~~~~~~~~~w~~~~~~~~~~~~~~~~~~a~~~Wkl~~~~nGV~Vy~r~~~~~~~~~~~~~~~KavgvV~a~pe 241 (479)
.|++|||+|||.+.++||.....+++|+++.+|+++...|+++.|+||++||++..+.++.++++.++||++|||+|+|+
T Consensus 161 ~r~~tig~gp~~s~~~~t~~~~~~~~~~~~~~d~~~~~~Wr~~~c~NGlRiF~e~~~~~~~~~~~~~~mKavGVV~aspE 240 (719)
T PLN00188 161 LRRTTIGNGPPDSVLDWTKEFDSELSNQNSNNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEATCE 240 (719)
T ss_pred ceeeeccCCCcchhcccccccCccccccCCCccccccCCeEEEEeeccceeehhhhccccccccCCceeEEEEEecCCHH
Confidence 99999999999999999999988888999999999999999999999999999988877776777899999999999999
Q ss_pred HHHHHHhcCCCCccchhhccceeEEEEEecCceeEEEEEEecccCCCccCCceEEEEEEEEEcCCCcEEEEEEeccCCCC
Q 011686 242 EIFELVMSMDGTRYEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYWRRNDDGSYVVLFRSREHENC 321 (479)
Q Consensus 242 ~Vf~lL~dld~~R~eWD~~~~~~evVe~iDd~tdIVY~~~~~~~~p~~vs~RDFV~lr~~r~~edGsyvI~~~SV~hp~~ 321 (479)
+||++||++++.|.+||.++.++++||+||+|++|+|+++++.|+|+.++|||||++|+|++.+||+|+|+++||+||+|
T Consensus 241 ~Ifd~Vm~~~~~R~eWD~~~~~~~vIE~ID~htdI~Y~~~~~~~~~~~ispRDFV~~Rywrr~eDGsYvil~~Sv~Hp~c 320 (719)
T PLN00188 241 EIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYWRRNDDGSYVVLFRSREHENC 320 (719)
T ss_pred HHHHHHhccCcccccchhcccceEEEEEecCCeEEEEEEeccccccCccCcceeEEEEEEEEcCCCcEEEeeeeeecCCC
Confidence 99999999988999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCeEEEEEcceEEEEEeCCCCCCCCeeEEEEEEeeecCCCccccchhhhhHHHHHHHHHHHHHHHHHhhcCCCCccC
Q 011686 322 GPQPGYVRAHVESGGFNISPLKPRNGRPRTQVQHLMQIDLKGWGVGYLSMFQQHCLFQMLNSVAGLREWFAQTDERSAHP 401 (479)
Q Consensus 322 Pp~~G~VRa~i~~gGwvI~Pl~~~~g~~~t~Vt~i~~vD~kGwips~v~~~~~s~~~~~l~~va~LRe~~~~~~~~~~~~ 401 (479)
||++|||||++++|||+|.|++..+|.++|+|++++++||+||++.+.+++.++++++||+++||||||++++++.++.+
T Consensus 321 PP~kG~VRg~~~pGGwiIsPL~~~~g~~r~lv~~~lqtDlkGW~~~y~~s~~~~~~l~mL~~VAgLrE~~~~~~~~~~~~ 400 (719)
T PLN00188 321 GPQPGFVRAHLESGGFNISPLKPRNGRPRTQVQHLMQIDLKGWGVGYIPSFQQHCLLQMLNSVAGLREWFSQTDERGAPP 400 (719)
T ss_pred CCCCCeEEEEEeCCEEEEEECCCCCCCCceEEEEEEEEccCccccccCccccccchHHHHHHHHHHHHHHhcCcccCccc
Confidence 99999999999999999999987766679999999999999999999999999999999999999999999999999999
Q ss_pred CcccccccccccccccccccccCCCCCCCCcccccCcCCCccccccCCCCCCcccCCCCCchhhhhhc
Q 011686 402 RIPVMVNMASASVSSKKNQNLQDSLIHPSSSLDQLNAGSRHSVMMDEYSDEDEEFQLAESEQEANEKK 469 (479)
Q Consensus 402 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~de~f~vpe~~~~~~~~~ 469 (479)
|+|.+.+|+.....+++++..++.+ ...+..+..+++++|++++||+||||||||++++.++.|
T Consensus 401 ~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~dE~~~~~e~~~~~~~~k 464 (719)
T PLN00188 401 RIPVMVNMASASVSSKKNQKPQESS----PSLDQTNAASRNSVMMDEDSDDDEEFQIPESEQEPETTK 464 (719)
T ss_pred cceeecccccccccccccccccccc----cccccccccchhhhhhccccccchhccCCCccccccccc
Confidence 9999999999887777775555332 223455566677779999999999999999998766555
|
|
| >cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins | Back alignment and domain information |
|---|
| >cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins | Back alignment and domain information |
|---|
| >cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins | Back alignment and domain information |
|---|
| >cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins | Back alignment and domain information |
|---|
| >cd08913 START_STARD14-like Lipid-binding START domain of mammalian STARDT14 and related proteins | Back alignment and domain information |
|---|
| >cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins | Back alignment and domain information |
|---|
| >cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins | Back alignment and domain information |
|---|
| >cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins | Back alignment and domain information |
|---|
| >cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding | Back alignment and domain information |
|---|
| >cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins | Back alignment and domain information |
|---|
| >cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins | Back alignment and domain information |
|---|
| >cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08902 START_STARD4-like Lipid-binding START domain of mammalian STARD4 and related proteins | Back alignment and domain information |
|---|
| >smart00234 START in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins | Back alignment and domain information |
|---|
| >cd08872 START_STARD11-like Ceramide-binding START domain of mammalian STARD11 and related domains | Back alignment and domain information |
|---|
| >PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] | Back alignment and domain information |
|---|
| >cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins | Back alignment and domain information |
|---|
| >cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins | Back alignment and domain information |
|---|
| >cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins | Back alignment and domain information |
|---|
| >cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >KOG2761 consensus START domain-containing proteins involved in steroidogenesis/phosphatidylcholine transfer [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd08875 START_ArGLABRA2_like C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins | Back alignment and domain information |
|---|
| >cd08864 SRPBCC_DUF3074 DUF3074, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily | Back alignment and domain information |
|---|
| >KOG1739 consensus Serine/threonine protein kinase GPBP [Signal transduction mechanisms; Defense mechanisms] | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd07813 COQ10p_like Coenzyme Q-binding protein COQ10p and similar proteins | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd08866 SRPBCC_11 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF11274 DUF3074: Protein of unknown function (DUF3074) | Back alignment and domain information |
|---|
| >cd07819 SRPBCC_2 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15409 PH_8: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd05018 CoxG Carbon monoxide dehydrogenase subunit G (CoxG) | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF03364 Polyketide_cyc: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR005031 Members of this family of enzymes from Streptomyces spp | Back alignment and domain information |
|---|
| >cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd08861 OtcD1_ARO-CYC_like N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains | Back alignment and domain information |
|---|
| >KOG0930 consensus Guanine nucleotide exchange factor Cytohesin, contains PH and Sec7 domains [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd07817 SRPBCC_8 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >PRK10724 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd08860 TcmN_ARO-CYC_like N-terminal aromatase/cyclase domain of the multifunctional protein tetracenomycin (TcmN) and related domains | Back alignment and domain information |
|---|
| >cd07821 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins | Back alignment and domain information |
|---|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >PF10604 Polyketide_cyc2: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR019587 This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis | Back alignment and domain information |
|---|
| >PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis | Back alignment and domain information |
|---|
| >cd07823 SRPBCC_5 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd07824 SRPBCC_6 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08865 SRPBCC_10 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
| >KOG2200 consensus Tumour suppressor protein p122-RhoGAP/DLC1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07812 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily | Back alignment and domain information |
|---|
| >cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF06240 COXG: Carbon monoxide dehydrogenase subunit G (CoxG); InterPro: IPR010419 The CO dehydrogenase structural genes coxMSL are flanked by nine accessory genes arranged as the cox gene cluster | Back alignment and domain information |
|---|
| >cd08862 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of Streptococcus mutans Smu | Back alignment and domain information |
|---|
| >cd07818 SRPBCC_1 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd07822 SRPBCC_4 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >KOG3845 consensus MLN, STAR and related lipid-binding proteins [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01223 PH_Vav Vav pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >COG2867 Oligoketide cyclase/lipid transport protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF15408 PH_7: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd07814 SRPBCC_CalC_Aha1-like Putative hydrophobic ligand-binding SRPBCC domain of Micromonospora echinospora CalC, human Aha1, and related proteins | Back alignment and domain information |
|---|
| >cd07816 Bet_v1-like Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins | Back alignment and domain information |
|---|
| >COG3427 Carbon monoxide dehydrogenase subunit G, CoxG [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd07825 SRPBCC_7 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07820 SRPBCC_3 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3640 consensus Actin binding protein Anillin [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >KOG1090 consensus Predicted dual-specificity phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >COG5637 Predicted integral membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 479 | ||||
| 3p0l_A | 221 | Human Steroidogenic Acute Regulatory Protein Length | 7e-05 | ||
| 2r55_A | 231 | Human Star-Related Lipid Transfer Protein 5 Length | 3e-04 |
| >pdb|3P0L|A Chain A, Human Steroidogenic Acute Regulatory Protein Length = 221 | Back alignment and structure |
|
| >pdb|2R55|A Chain A, Human Star-Related Lipid Transfer Protein 5 Length = 231 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 479 | |||
| 3fo5_A | 258 | Thioesterase, adipose associated, isoform BFIT2; o | 1e-44 | |
| 1em2_A | 229 | MLN64 protein; beta barrel, lipid binding protein; | 9e-37 | |
| 3p0l_A | 221 | Steroidogenic acute regulatory protein, mitochond; | 3e-35 | |
| 2pso_A | 237 | STAR-related lipid transfer protein 13; alpha and | 7e-35 | |
| 2r55_A | 231 | STAR-related lipid transfer protein 5; alpha and b | 2e-34 | |
| 2e3n_A | 255 | Lipid-transfer protein CERT; ceramide transfer, li | 2e-32 | |
| 1jss_A | 224 | Stard4, cholesterol-regulated start protein 4; sta | 3e-32 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 4e-28 | |
| 1ln1_A | 214 | PC-TP, phosphatidylcholine transfer protein; start | 7e-28 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 4e-07 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 3e-06 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 3e-06 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 3e-06 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 5e-06 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 1e-05 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 1e-05 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 2e-05 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 2e-05 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 2e-05 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 3e-05 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 7e-05 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 7e-05 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 1e-04 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 1e-04 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 1e-04 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 1e-04 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 1e-04 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 2e-04 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 2e-04 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 2e-04 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 2e-04 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 5e-04 |
| >3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Length = 258 | Back alignment and structure |
|---|
Score = 156 bits (395), Expect = 1e-44
Identities = 45/240 (18%), Positives = 80/240 (33%), Gaps = 31/240 (12%)
Query: 162 MRRTTIGNGPPDLVHDWTRELDSDLSNQNINN--QAFSRKHWRLLQCQNGLRIFEELLEV 219
+ P W LS N+++ ++ +W L + +R++
Sbjct: 29 IVSCKQTEVPLS--VPWDPSNQVYLSYNNVSSLKMLVAKDNWVLSSEISQVRLY------ 80
Query: 220 DYLPRSCSRAMKAVGVVEASCEEIFELVMSMDGTRYEWDCSFQYGSLVEEVDGHTAILYH 279
L + VV + F L+ + R EWD ++ LV++VD AI +
Sbjct: 81 -TLEDDKFLSFHMEMVVHVDAAQAFLLLSDLR-QRPEWDKHYRSVELVQQVDEDDAIYHV 138
Query: 280 RLQLDWFPMFVWPRDLCYVRYWRRNDD--GSYVVLFRSREHENCGPQPGYVRAHVESGGF 337
P+D + R+ D YV+ RS P Y R GF
Sbjct: 139 TSP--ALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGETLCSGF 196
Query: 338 NISPLKPRNGRPRTQVQHLMQI----------DLKGWGVGYLSMFQQHCLFQMLNSVAGL 387
+ G T+V + Q ++ G + + F+ C +L++ L
Sbjct: 197 CLWRE----GDQLTKVSYYNQATPGVLNYVTTNVAGLSSEFYTTFKA-CEQFLLDNRNDL 251
|
| >1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Length = 229 | Back alignment and structure |
|---|
| >3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Length = 237 | Back alignment and structure |
|---|
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Length = 231 | Back alignment and structure |
|---|
| >2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* Length = 255 | Back alignment and structure |
|---|
| >1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Length = 224 | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Length = 189 | Back alignment and structure |
|---|
| >1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Length = 214 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 479 | |||
| 3fo5_A | 258 | Thioesterase, adipose associated, isoform BFIT2; o | 100.0 | |
| 2r55_A | 231 | STAR-related lipid transfer protein 5; alpha and b | 100.0 | |
| 3p0l_A | 221 | Steroidogenic acute regulatory protein, mitochond; | 100.0 | |
| 1em2_A | 229 | MLN64 protein; beta barrel, lipid binding protein; | 100.0 | |
| 1jss_A | 224 | Stard4, cholesterol-regulated start protein 4; sta | 100.0 | |
| 2pso_A | 237 | STAR-related lipid transfer protein 13; alpha and | 100.0 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 100.0 | |
| 1ln1_A | 214 | PC-TP, phosphatidylcholine transfer protein; start | 99.98 | |
| 2e3n_A | 255 | Lipid-transfer protein CERT; ceramide transfer, li | 99.97 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.37 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 99.19 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 99.18 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 99.18 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 99.17 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 99.17 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 99.17 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 99.16 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 99.16 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 99.16 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 99.16 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 99.15 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 99.15 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 99.13 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 99.13 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 99.13 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 99.13 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 99.12 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 99.12 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 99.11 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 99.11 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 99.1 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 99.09 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 99.09 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 99.07 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 99.07 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 99.05 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 99.02 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 99.01 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 99.0 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 99.0 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 98.98 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 98.97 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 98.94 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 98.93 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 98.93 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 98.92 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 98.92 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 98.92 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 98.91 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 98.86 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 98.82 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 98.82 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 98.82 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 98.79 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 98.72 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 98.71 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 98.7 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 98.67 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 98.63 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 98.61 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 98.61 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 98.56 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 98.56 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 98.54 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 98.45 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 98.44 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 98.44 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 98.29 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 98.23 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 98.15 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 98.02 | |
| 1t17_A | 148 | Conserved hypothetical protein; beta-alpha-beta-BE | 97.98 | |
| 2d4r_A | 147 | Hypothetical protein TTHA0849; start domain, struc | 97.88 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 97.87 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 97.85 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 97.83 | |
| 3tl1_A | 159 | WHIE ORF VI, polyketide cyclase; helix-GRIP fold, | 97.76 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 97.68 | |
| 3tfz_A | 172 | Cyclase; helix-GRIP, BET V1-like superfamily, bios | 97.63 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 97.59 | |
| 2pcs_A | 162 | Conserved protein; structural genomics, unknown fu | 97.59 | |
| 3tvq_A | 169 | Multifunctional cyclase-dehydratase-3-O-methyl TR | 97.58 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 97.58 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 97.54 | |
| 4bbk_A | 165 | Kindlin-1, fermitin family homolog 1; PH domain, c | 97.51 | |
| 3ggn_A | 155 | Uncharacterized protein DR_A0006; structural genom | 97.34 | |
| 2ns9_A | 157 | Hypothetical protein APE2225; uncharacterized cons | 97.21 | |
| 3p9v_A | 161 | Uncharacterized protein; structural genomics, PSI- | 97.08 | |
| 3f08_A | 146 | Uncharacterized protein Q6HG14; NESG Q6HG14_bachk | 96.99 | |
| 2le1_A | 151 | Uncharacterized protein; structural genomics, nort | 96.21 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 95.97 | |
| 3qwm_A | 140 | Iqsec1, IQ motif and SEC7 domain-containing protei | 95.83 | |
| 2qpv_A | 156 | Uncharacterized protein ATU1531; structural genomi | 95.48 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 95.33 | |
| 3p51_A | 160 | Uncharacterized protein; structural genomics, PSI- | 95.33 | |
| 3ijt_A | 155 | SMU.440, putative uncharacterized protein; hypothe | 95.29 | |
| 1tw0_A | 157 | Pathogenesis-related class 10 protein SPE-16; seve | 94.16 | |
| 1e09_A | 159 | PRU AV 1; allergen, major cherry allergen, pathoge | 94.09 | |
| 2qim_A | 158 | PR10.2B; trans-zeatin, cytokinin, plant hormones, | 93.26 | |
| 1mai_A | 131 | Phospholipase C delta-1; pleckstrin, inositol tris | 93.0 | |
| 1icx_A | 155 | Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, | 92.48 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 92.03 | |
| 2flh_A | 155 | Cytokinin-specific binding protein; zeatin, pathog | 91.89 | |
| 2dfk_A | 402 | Collybistin II; DH domain, PH domain, cell cycle; | 91.57 | |
| 1xcg_A | 368 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 91.52 | |
| 3rt2_A | 183 | Abscisic acid receptor PYL10; ABA-independent PP2C | 91.44 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 91.05 | |
| 1kz7_A | 353 | Guanine nucleotide exchange factor DBS; guanine nu | 90.61 | |
| 1txd_A | 385 | RHO guanine nucleotide exchange factor 12; helical | 90.6 | |
| 3oqu_A | 205 | Abscisic acid receptor PYL9; RCAR1, hormone recept | 90.57 | |
| 3p6a_A | 377 | RHO guanine nucleotide exchange factor 1; regulati | 90.43 | |
| 1nty_A | 311 | Triple functional domain protein; DBL, pleckstrin, | 89.88 | |
| 3odw_A | 536 | RHO guanine nucleotide exchange factor 1; regulati | 89.82 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 87.6 | |
| 4a8u_A | 159 | Major pollen allergen BET V 1-J; PR-10 protein; 1. | 87.0 | |
| 3jrs_A | 208 | PYL1, putative uncharacterized protein AT5G46790; | 86.69 | |
| 3kl1_A | 190 | PYL2, putative uncharacterized protein AT2G26040; | 86.27 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 85.3 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 84.48 | |
| 3t06_A | 418 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 84.15 | |
| 3rws_A | 168 | MTN13 protein; zeatin, cytokinin, hormone, lucerne | 83.35 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 83.29 | |
| 2rgn_B | 354 | RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p | 83.11 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 82.64 | |
| 2lg1_A | 185 | A-kinase anchor protein 13; metal binding protein; | 81.11 |
| >3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=3.4e-39 Score=318.79 Aligned_cols=210 Identities=19% Similarity=0.250 Sum_probs=181.2
Q ss_pred CCCccccCCcccccccccccc--ccccccCCCcEEEEeeCCeEEEEEecccCCCCccccceEEEEEEecccHHHHHHHHh
Q 011686 171 PPDLVHDWTRELDSDLSNQNI--NNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEASCEEIFELVM 248 (479)
Q Consensus 171 ~~~~~~~w~~~~~~~~~~~~~--~~~~~a~~~Wkl~~~~nGV~Vy~r~~~~~~~~~~~~~~~KavgvV~a~pe~Vf~lL~ 248 (479)
-.+++++|+++||++|+|+|+ ++++.+.++|++..+++||+||+++.. + ...||++++|++||++||++|+
T Consensus 36 ~~p~~~~w~~~~~~~l~~~n~~al~~l~~~~gW~~~~~~~gv~Vy~~~~~-~------~l~~k~~~~v~~~~~~v~~~L~ 108 (258)
T 3fo5_A 36 EVPLSVPWDPSNQVYLSYNNVSSLKMLVAKDNWVLSSEISQVRLYTLEDD-K------FLSFHMEMVVHVDAAQAFLLLS 108 (258)
T ss_dssp TSCSEEECCGGGHHHHHHHHHHHHHHHHTCSCCEEEEEETTEEEEEEECS-S------CEEEEEEEEESSCHHHHHHHHH
T ss_pred CCCcccccCcccceecccCCHHHHHhhhccCCCEEEecCCCeEEEEEECC-C------ceEEEEEEEEeCCHHHHHHHHh
Confidence 468999999999999999998 999999999999999999999998654 2 4589999999999999999999
Q ss_pred cCCCCccchhhccceeEEEEEecCceeEEEEEEecccCCCccCCceEEEEEEEEEc-CCC-cEEEEEEeccCCCCCCCCC
Q 011686 249 SMDGTRYEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYWRRN-DDG-SYVVLFRSREHENCGPQPG 326 (479)
Q Consensus 249 dld~~R~eWD~~~~~~evVe~iDd~tdIVY~~~~~~~~p~~vs~RDFV~lr~~r~~-edG-syvI~~~SV~hp~~Pp~~G 326 (479)
|+. .|++||+++.++++|+++|++ ++||+... +++++++++||||++|+||+. .+| .|+|+.+||.||.+||++|
T Consensus 109 D~~-~R~~WD~~~~~~~vle~id~~-~ivY~~~~-p~~~~~v~~RDFV~lr~~r~~~~~G~~yvi~~~SV~hp~~Pp~~g 185 (258)
T 3fo5_A 109 DLR-QRPEWDKHYRSVELVQQVDED-DAIYHVTS-PALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPE 185 (258)
T ss_dssp CGG-GGGGTCTTCCEEEEEEEEETT-EEEEEEEE-CCCTTCSSCEEEEEEEEEECCSSTTCCEEEEEEEEECTTSCCCTT
T ss_pred Cch-hHhHhhhhccEEEEEEEcCCC-eEEEEEec-CCccCCCCCCEEEEEEEEEeccCCCCEEEEEEEeccCCCCCCCCC
Confidence 875 699999999999999999999 67787654 333478999999999999875 356 5999999999999999999
Q ss_pred eEEEEEcceEEEEEeCCCCCCCCeeEEEEEEeeecCCCccccchhhhhHHHHHHHHHHHHHHHHHhhcCC
Q 011686 327 YVRAHVESGGFNISPLKPRNGRPRTQVQHLMQIDLKGWGVGYLSMFQQHCLFQMLNSVAGLREWFAQTDE 396 (479)
Q Consensus 327 ~VRa~i~~gGwvI~Pl~~~~g~~~t~Vt~i~~vD~kGwips~v~~~~~s~~~~~l~~va~LRe~~~~~~~ 396 (479)
||||+++++||+|+|+++ + .|+|+|+.|+|| |.+|.|+..... ....+.+++++|++|+.....
T Consensus 186 ~VR~~~~~sg~~I~P~~~--~--~t~VtY~~q~dp-G~lP~~~~n~~g-~s~~~~~t~~~~~~fl~~~~~ 249 (258)
T 3fo5_A 186 YRRGETLCSGFCLWREGD--Q--LTKVSYYNQATP-GVLNYVTTNVAG-LSSEFYTTFKACEQFLLDNRN 249 (258)
T ss_dssp SEECCCSSEEEEEEEEET--T--EEEEEEEESCCG-GGHHHHHHHHHT-SCCHHHHHHHHHHHHHHHTC-
T ss_pred CEEEEEcCcEEEEEECCC--C--CEEEEEEEeeCC-CCCCceEEeccc-cchHHHHHHHHHHHHHHhccc
Confidence 999999999999999974 3 799999999999 559988644322 122357888999999998764
|
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} | Back alignment and structure |
|---|
| >1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* | Back alignment and structure |
|---|
| >2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural G protein structure initiative, PSI, NESG; NMR {Caulobacter crescentus} SCOP: d.129.3.6 | Back alignment and structure |
|---|
| >2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* | Back alignment and structure |
|---|
| >3tfz_A Cyclase; helix-GRIP, BET V1-like superfamily, biosynthetic protein; HET: CXS; 2.39A {Streptomyces SP} | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >2pcs_A Conserved protein; structural genomics, unknown function, ligand binding, PSI-2 structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus} SCOP: d.129.3.10 | Back alignment and structure |
|---|
| >3tvq_A Multifunctional cyclase-dehydratase-3-O-methyl TR TCMN; tetracenomycin, aromatase, taxifolin, dihyroquercet helix-GRIP fold; HET: DQH; 1.67A {Streptomyces glaucescens} PDB: 2rer_A 2res_A 2rez_A | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >3ggn_A Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_A | Back alignment and structure |
|---|
| >2ns9_A Hypothetical protein APE2225; uncharacterized conserved protein, structural genomics, PSI, structure initiative; 1.80A {Aeropyrum pernix} SCOP: d.129.3.10 | Back alignment and structure |
|---|
| >3p9v_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.78A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3f08_A Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovar konkukiorganism_taxid} SCOP: d.129.3.8 PDB: 3cnw_A | Back alignment and structure |
|---|
| >2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca} | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} | Back alignment and structure |
|---|
| >2qpv_A Uncharacterized protein ATU1531; structural genomics, PSI protein structure initiative, midwest center for structural genomics; 2.35A {Agrobacterium tumefaciens str} SCOP: d.129.3.8 | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >3p51_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis} | Back alignment and structure |
|---|
| >3ijt_A SMU.440, putative uncharacterized protein; hypothetical protein, unknown function; 2.38A {Streptococcus mutans} SCOP: d.129.3.9 PDB: 2b79_A | Back alignment and structure |
|---|
| >1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* | Back alignment and structure |
|---|
| >1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A | Back alignment and structure |
|---|
| >2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A | Back alignment and structure |
|---|
| >1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* | Back alignment and structure |
|---|
| >3rt2_A Abscisic acid receptor PYL10; ABA-independent PP2C inhibitor, PP2CS, hydrolase inhibitor; 1.50A {Arabidopsis thaliana} PDB: 3r6p_A* 3qtj_A* 3uqh_A 3rt0_C | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A | Back alignment and structure |
|---|
| >3oqu_A Abscisic acid receptor PYL9; RCAR1, hormone receptor; HET: A8S; 2.68A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A | Back alignment and structure |
|---|
| >1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >4a8u_A Major pollen allergen BET V 1-J; PR-10 protein; 1.16A {Betula pendula} PDB: 4a8v_A* 4a87_A* 4a81_A* 4a80_A* 4a83_A* 4a86_A* 4a85_A* 4a88_A 4a8g_A* 1b6f_A 1btv_A 1bv1_A 1fsk_A 4a84_A* 1llt_A 1fm4_A* 3k78_A 1qmr_A | Back alignment and structure |
|---|
| >3jrs_A PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid, hormone recepto; HET: A8S; 2.05A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A* | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A | Back alignment and structure |
|---|
| >2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 479 | ||||
| d2psoa1 | 197 | d.129.3.2 (A:908-1104) Star-related lipid transfer | 4e-29 | |
| d1em2a_ | 214 | d.129.3.2 (A:) Lipid transport domain of Mln64 {Hu | 1e-23 | |
| d1ln1a_ | 203 | d.129.3.2 (A:) Phosphatidylcholine transfer protei | 2e-22 | |
| d1jssa_ | 199 | d.129.3.2 (A:) Cholesterol-regulated Start protein | 4e-19 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 2e-07 | |
| d1plsa_ | 113 | b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta | 4e-07 | |
| d1unqa_ | 118 | b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H | 1e-05 | |
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 1e-05 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 2e-05 | |
| d1droa_ | 122 | b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila | 2e-05 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 8e-05 | |
| d1wi1a_ | 126 | b.55.1.1 (A:) Calcium-dependent activator protein | 9e-05 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 2e-04 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 2e-04 | |
| d1v89a_ | 118 | b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI | 2e-04 | |
| d1u5fa1 | 111 | b.55.1.1 (A:109-219) Src-associated adaptor protei | 4e-04 | |
| d2coda1 | 102 | b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo | 7e-04 | |
| d1v88a_ | 130 | b.55.1.1 (A:) Oxysterol binding protein-related pr | 0.001 |
| >d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Length = 197 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: TBP-like superfamily: Bet v1-like family: STAR domain domain: Star-related lipid transfer protein 13 species: Human (Homo sapiens) [TaxId: 9606]
Score = 111 bits (278), Expect = 4e-29
Identities = 45/195 (23%), Positives = 72/195 (36%), Gaps = 21/195 (10%)
Query: 199 KHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEASCEEIFELVMSMDGTRYEWD 258
K W + + + + + KA VEA + V+ R+ WD
Sbjct: 19 KGWVTCSSTDNTDLAFK----KVGDGNPLKLWKASVEVEAPPSVVLNRVLR---ERHLWD 71
Query: 259 CSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYWRRN-DDGSYVVLFRSRE 317
F +VE +D T I + L RD +R W+ + G ++ S E
Sbjct: 72 EDFVQWKVVETLDRQTEIYQYVL---NSMAPHPSRDFVVLRTWKTDLPKGMCTLVSLSVE 128
Query: 318 HENCGPQPGYVRAHVESGGFNISPLKPRNGRPRTQVQHLMQIDLKGWGVGYL-SMFQQHC 376
HE G VRA V + I P G ++++ H+ +IDLKG + F C
Sbjct: 129 HEEA-QLLGGVRAVVMDSQYLIEPC----GSGKSRLTHICRIDLKGHSPEWYSKGFGHLC 183
Query: 377 LFQMLNSVAGLREWF 391
++ +R F
Sbjct: 184 AAEVAR----IRNSF 194
|
| >d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Length = 203 | Back information, alignment and structure |
|---|
| >d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} Length = 199 | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 479 | |||
| d2psoa1 | 197 | Star-related lipid transfer protein 13 {Human (Hom | 100.0 | |
| d1jssa_ | 199 | Cholesterol-regulated Start protein 4 (Stard4). {M | 99.97 | |
| d1em2a_ | 214 | Lipid transport domain of Mln64 {Human (Homo sapie | 99.97 | |
| d1ln1a_ | 203 | Phosphatidylcholine transfer protein {Human (Homo | 99.97 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 99.29 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 99.21 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 99.19 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.17 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 99.14 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 99.13 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 99.1 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 99.09 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.08 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 99.08 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 99.07 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 99.07 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.04 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 99.04 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 99.04 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 99.04 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 99.04 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.02 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 98.95 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 98.86 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 98.85 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 98.85 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 98.82 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 98.82 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.81 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 98.81 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 98.79 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 98.77 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 98.77 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 98.77 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 98.76 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 98.7 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 98.66 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 98.55 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 98.54 | |
| d2d4ra1 | 146 | Hypothetical protein TTHA0849 {Thermus thermophilu | 98.19 | |
| d2rera1 | 155 | Multifunctional enzyme TcmN, cyclase/aromatase dom | 97.92 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 97.84 | |
| d1t17a_ | 148 | Hypothetical protein CC1736 {Caulobacter crescentu | 97.73 | |
| d2ns9a1 | 147 | Hypothetical protein APE2225 {Aeropyrum pernix [Ta | 97.71 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 97.61 | |
| d2pcsa1 | 147 | Hypothetical protein GKP20 {Geobacillus kaustophil | 97.26 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 97.03 | |
| d2b79a1 | 137 | Hypothetical protein SMU440 {Streptococcus mutans | 97.03 | |
| d3cnwa1 | 138 | Uncharacterized protein XoxI {Bacillus cereus [Tax | 97.0 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 96.91 | |
| d1kz7a2 | 147 | Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId | 96.25 | |
| d1zc3b1 | 109 | Exocyst complex protein EXO84 {Rat (Rattus norvegi | 96.2 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 96.12 | |
| d1ki1b2 | 142 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 95.44 | |
| d1xcga2 | 140 | Rho guanine nucleotide exchange factor 11, PDZ-Rho | 95.27 | |
| d1fhoa_ | 119 | UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: | 92.57 | |
| d1txda2 | 114 | Rho guanine nucleotide exchange factor 12 {Human ( | 88.41 | |
| d2qpva1 | 133 | Uncharacterized protein Atu1531 {Agrobacterium tum | 84.25 |
| >d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: TBP-like superfamily: Bet v1-like family: STAR domain domain: Star-related lipid transfer protein 13 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=6.9e-32 Score=252.11 Aligned_cols=177 Identities=27% Similarity=0.318 Sum_probs=151.0
Q ss_pred CCCcEEEEeeCCeEEEEEec-ccCCCCccccceEEEEEEecccHHHHHHHHhcCCCCccchhhccceeEEEEEecCceeE
Q 011686 198 RKHWRLLQCQNGLRIFEELL-EVDYLPRSCSRAMKAVGVVEASCEEIFELVMSMDGTRYEWDCSFQYGSLVEEVDGHTAI 276 (479)
Q Consensus 198 ~~~Wkl~~~~nGV~Vy~r~~-~~~~~~~~~~~~~KavgvV~a~pe~Vf~lL~dld~~R~eWD~~~~~~evVe~iDd~tdI 276 (479)
..||++..+++||+||.+.. + + +.++++|+++.|+++|++|+..+++ .|++||+.+.++++||++++++.|
T Consensus 18 ~~GW~~~~~~~gi~V~~kk~~~-g----s~~~~~k~~~~i~a~~~~vl~~~l~---~r~~Wd~~~~~~~~le~~~~~~~i 89 (197)
T d2psoa1 18 FKGWVTCSSTDNTDLAFKKVGD-G----NPLKLWKASVEVEAPPSVVLNRVLR---ERHLWDEDFVQWKVVETLDRQTEI 89 (197)
T ss_dssp CCSCEEECCSSSCEEEEECCCS-S----CCCCEEEEEEEESSCHHHHHHHHHH---CGGGTCTTBCCCEEEEEEETTEEE
T ss_pred CCCceEEecCCCeEEEEEecCC-C----CCeEEEEEEEEEcCCHHHHHHHHHH---hHHHHhhhhheEEEEEEcCCCCEE
Confidence 35899999999999976654 4 2 2478999999999999999977764 389999999999999999999999
Q ss_pred EEEEEecccCCCccCCceEEEEEEEEEc-CCCcEEEEEEeccCCCCCCCCCeEEEEEcceEEEEEeCCCCCCCCeeEEEE
Q 011686 277 LYHRLQLDWFPMFVWPRDLCYVRYWRRN-DDGSYVVLFRSREHENCGPQPGYVRAHVESGGFNISPLKPRNGRPRTQVQH 355 (479)
Q Consensus 277 VY~~~~~~~~p~~vs~RDFV~lr~~r~~-edGsyvI~~~SV~hp~~Pp~~G~VRa~i~~gGwvI~Pl~~~~g~~~t~Vt~ 355 (479)
+|..++ +|||+++||||+++.+++. ++|.++|...|++|+.+|+ +++|||.+..+||+|+|++ +| +|.|||
T Consensus 90 ~y~~~~---~p~pvs~RD~v~~~~~~~~~~~~~~~i~~~Sv~~~~~p~-~~~VR~~~~~~~~~i~p~~--~~--~t~vt~ 161 (197)
T d2psoa1 90 YQYVLN---SMAPHPSRDFVVLRTWKTDLPKGMCTLVSLSVEHEEAQL-LGGVRAVVMDSQYLIEPCG--SG--KSRLTH 161 (197)
T ss_dssp EEEEEC---CSSSCCCEEEEEEEEEESCCGGGCEEEEEEECCCTTCCC-CSSEECCEEEEEEEEEECS--TT--CEEEEE
T ss_pred EEEEcc---CCCcccceeEEEEEEEEEeCCCCEEEEEEEeccccCCCC-CCcEEEEEEeccEEEEECC--CC--cEEEEE
Confidence 998886 6789999999999999886 6889999999999998765 5789999999999999996 34 799999
Q ss_pred EEeeecCCCccccchhhhhHHHHHHHHHHHHHHHHHhh
Q 011686 356 LMQIDLKGWGVGYLSMFQQHCLFQMLNSVAGLREWFAQ 393 (479)
Q Consensus 356 i~~vD~kGwips~v~~~~~s~~~~~l~~va~LRe~~~~ 393 (479)
++++||+|++|.|+.....+.+ ...+..||+.|+.
T Consensus 162 ~~~~Dp~G~iP~W~~n~~~~~~---~~~~~~lr~~f~~ 196 (197)
T d2psoa1 162 ICRIDLKGHSPEWYSKGFGHLC---AAEVARIRNSFQP 196 (197)
T ss_dssp EEEECCSSSCTTTTTTHHHHHH---HHHHHHHHHTTSC
T ss_pred EEEECCCCcCchhHHhhhHHHH---HHHHHHHHHhhhC
Confidence 9999999999998754445543 3456778887753
|
| >d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d2ns9a1 d.129.3.10 (A:10-156) Hypothetical protein APE2225 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2pcsa1 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobacillus kaustophilus [TaxId: 1462]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b79a1 d.129.3.9 (A:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|