Citrus Sinensis ID: 011700


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
MGRAFVYVIVGGGVAAGYAALEFTKRGVPPGELCIISEEPVAPYERPALSKGYLLPEAPARLPSFHTCVGANEERLTPKWYNEHGIELVLGTRVKSADVRRKTLVTATGETISYKILIIATGARALKLEEFGLSGSDAENVCYLRDLADANRLVNVMKSCSGGNAVVIGGGYIGMECAASLVINKINVTMVFPEAHCMARLFTPKIASYYEEYYKSKGVKFVKGTVLSSFDVDSNGKVVAVNLRDGNRLPTDMVVVGIGIRPNTSLFEGQLTLEKGGIKVTGRLQSSNSSVYAVGDVAAFPLKLLGETRRLEHVDSARKSAKHAVAAIMEPDKTDKFDYLPFFYSRVFTLSWQFYGDNVGEVVHYGNFSGTTFGAYWVNKGRLVGSFLEGGTKEEYEAIAKATRLQPVVEDLAELETQGLGFALAVSQKPLPSTPVDGKTVPGLVLGKSLYPLHATAGVILAASIAAFAYWYGRRRRRW
ccccccEEEEcccHHHHHHHHHHHHcccccccEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHcccEEEccccEEEECccccEEEcccccEEcccEEEEcccccccccccccccccccccEEEEccHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHHHcccEEEcccEEEEEEEcccccEEEEEcccccEECccEEEEccccccccHHHHcccccccccEECccccccccccCECccccccccccccccccECccHHHHHHHHHHHHHHHcccccccccccccEEEEccccccEEEEccccccEEEEccccccCEEEEEEEccEEEEEEEccccHHHHHHHHHHHccccccccHHHHHcccccHHHHHccccccccccccccccccccccccccccccccEEEHHHHHHHHHHHHcccccc
***AFVYVIVGGGVAAGYAALEFTKRGVPPGELCIISEEPVAPYERPALSKGYLLPEAPARLPSFHTCVGANEERLTPKWYNEHGIELVLGTRVKSADVRRKTLVTATGETISYKILIIATGARALKLEEFGLSGSDAENVCYLRDLADANRLVNVMKSCSGGNAVVIGGGYIGMECAASLVINKINVTMVFPEAHCMARLFTPKIASYYEEYYKSKGVKFVKGTVLSSFDVDSNGKVVAVNLRDGNRLPTDMVVVGIGIRPNTSLFEGQLTLEKGGIKVTGRLQSSNSSVYAVGDVAAFPLKLLGETRRLEHVDSARKSAKHAVAAIMEPDKTDKFDYLPFFYSRVFTLSWQFYGDNVGEVVHYGNFSGTTFGAYWVNKGRLVGSFLEGGTKEEYEAIAKATRLQPVVEDLAELETQGLGFALAVSQK*****PVDGKTVPGLVLGKSLYPLHATAGVILAASIAAFAYWYGRRRRR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRAFVYVIVGGGVAAGYAALEFTKRGVPPGELCIISEEPVAPYERPALSKGYLLPEAPARLPSFHTCVGANEERLTPKWYNEHGIELVLGTRVKSADVRRKTLVTATGETISYKILIIATGARALKLEEFGLSGSDAENVCYLRDLADANRLVNVMKSCSGGNAVVIGGGYIGMECAASLVINKINVTMVFPEAHCMARLFTPKIASYYEEYYKSKGVKFVKGTVLSSFDVDSNGKVVAVNLRDGNRLPTDMVVVGIGIRPNTSLFEGQLTLEKGGIKVTGRLQSSNSSVYAVGDVAAFPLKLLGETRRLEHVDSARKSAKHAVAAIMEPDKTDKFDYLPFFYSRVFTLSWQFYGDNVGEVVHYGNFSGTTFGAYWVNKGRLVGSFLEGGTKEEYEAIAKATRLQPVVEDLAELETQGLGFALAVSQKPLPSTPVDGKTVPGLVLGKSLYPLHATAGVILAASIAAFAYWYGRRRRRW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable monodehydroascorbate reductase, cytoplasmic isoform 2 Catalyzes the conversion of monodehydroascorbate to ascorbate, oxidizing NADH in the process.confidentQ9LK94
Monodehydroascorbate reductase Catalyzes the conversion of monodehydroascorbate to ascorbate, oxidizing NADH in the process.probableQ43497
Monodehydroascorbate reductase, seedling isozyme Catalyzes the conversion of monodehydroascorbate to ascorbate, oxidizing NADH in the process.probableQ42711

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.6.-.-Acting on NADH or NADPH.probable
1.6.5.-With a quinone or similar compound as acceptor.probable
1.6.5.4Monodehydroascorbate reductase (NADH).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IWA, chain A
Confidence level:very confident
Coverage over the Query: 5-39,86-421
View the alignment between query and template
View the model in PyMOL
Template: 3DGZ, chain A
Confidence level:very confident
Coverage over the Query: 4-440
View the alignment between query and template
View the model in PyMOL