Citrus Sinensis ID: 011720

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48

MGFEGDEEAAAIQISPKYSLFRYNSPLVQVSLIGLVCFCCPGMFNALSGMGGGGQLDPTAANNANTALYTTFSVFGILGGGVYNIFGPRVTLAAGCSTYVLYAGSFLYYNHHHDQTFAVVAGAVLGIGAGLLWAGQGAIMTSYPTATRKGTYISLFWSIFNMGGVVGGLIPFIMNYHRTDAESVNDKTYIAFMCFMSAGAALSLAILPPSRVIRDDGTRCTNIKYSKVSTEAIEILKLFRNWKMLLLFPAAWASNFFYSYQFNNVNGLMFNLRTRGLNNVFYWGAQMLGSVGIGYVMDFSFQSLRTRGLVGIGIVALFGTAIWGGGLASQLNYSHDDPPKRLDFKTSGNDFAGPFVLYFSYGLLDAMFQSMVYWVIGALADDSETLSRYTGFYKGVQSAGAAVAWQVDTHKVSLLSQLIINWSLTTVSYPLLVVLVMLAVKDDDKSKEGTTNGSDLPSAPTIAGNIAKDYNEPVNSTAT

cccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccccccccccccccccccccccccccccccccccccc

***********IQISPKYSLFRYNSPLVQVSLIGLVCFCCPGMFNALSGMGGGGQLDPTAANNANTALYTTFSVFGILGGGVYNIFGPRVTLAAGCSTYVLYAGSFLYYNHHHDQTFAVVAGAVLGIGAGLLWAGQGAIMTSYPTATRKGTYISLFWSIFNMGGVVGGLIPFIMNYHRTDAESVNDKTYIAFMCFMSAGAALSLAILPPSRVIRDDGTRCTNIKYSKVSTEAIEILKLFRNWKMLLLFPAAWASNFFYSYQFNNVNGLMFNLRTRGLNNVFYWGAQMLGSVGIGYVMDFSFQSLRTRGLVGIGIVALFGTAIWGGGLASQLNYSHDDPPKRLDFKTSGNDFAGPFVLYFSYGLLDAMFQSMVYWVIGALADDSETLSRYTGFYKGVQSAGAAVAWQVDTHKVSLLSQLIINWSLTTVSYPLLVVLVMLAV***************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UNC93-like protein 2		confident	Q8LG53
UNC93-like protein 1		confident	Q56WD3
UNC93-like protein C922.05c		probable	Q9URX1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PW4, chain A
Confidence level:confident
Coverage over the Query: 56-334,345-408
View the alignment between query and template
View the model in PyMOL

Template: 4GC0, chain A
Confidence level:confident
Coverage over the Query: 61-334,345-445
View the alignment between query and template
View the model in PyMOL