Citrus Sinensis ID: 011733


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
MSRRPVNPARRLADGGSIPFVGSAHSKSRSSPLLSVILLAVGAVLLIGYLYSGSGKTTIEKEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGVEPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPELARVSVDGVVIFAGYPGQHRAKVSELSKFGRPAKLRSSTWWIRYFLQNSLEENEVAAKKFDQASVKRSYKPASSALTAVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGNVLGNGDIACDEYHKYKEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIVVANPLVYGDYPKIMKQNAGSRLPAFTDHESQQIKGSADFIGVINYYTVYIKDNPSSLKQKHRDWSADTATKFFCTFSTYH
cccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHccccccccccccccccccccHHHHHHHHHcEEEEEEEccccccccccccEEEEccccccccHHHHHHHHHHHHHHHcccEEEccccccccccEEEEcccccccccccccHHHHHHHHHHccccccccccccccccccccccccccHHHHccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccc
cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHEEEcccccccHHHHHHHHHHHHHHHcccHHHEEEccccccHHHHHHcccccccccccccccHHHHHHHHHHHHHccEEEEEEccccccccccccEEEEEcccHHcccHHHHHHHHHHHHHHHccccEccccccHHHcccEEEEccccccccccccEEEEEEEcccccccccccHHHHHHHHHHcccccccccccHHHccHHHcccccEEEEEccHHHHcccccccccccEHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccEEEEEccHHHHcccccccccHHHHHHHHHHHHHHHHcccEEEEEEEccccEHHHHHccHHHccHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHccccccEEEEEEEEEEEEEcccccccccccHHHHHcEEHHHHccccc
msrrpvnparrladggsipfvgsahsksrsspLLSVILLAVGAVLLIGYLysgsgkttiEKEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLkeedteawgvepydlddadaNCRSLVRKGIVrvadikfplpyraksfSLVIVSDAvdylspkylnrtlpelarVSVDGVVIfagypgqhrakvselskfgrpaklrssTWWIRYFLQNSLEENEVAAkkfdqasvkrsykpassaltaveytkndfppgfifgsgtsayqvegaanedgrtpsiWDTFAhagnvlgngdiacdEYHKYKEDVKLMAKTGLDAYRFSISwsrlipngrgpvnpkglqYYNNLINELISygiqphvtlhhsdlpqaledEYGGWINRMIVVanplvygdypkimkqnagsrlpaftdhesqqikgsADFIGVINYYTVYikdnpsslkqkhrdwsadtatKFFCTFSTYH
msrrpvnparrladggsiPFVGSAHSKSRSSPLLSVILLAVGAVLLIGYLYSGSGKTTIEKEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWgvepydlddadANCRSLVRKGIVrvadikfplpyraksfsLVIVSDAVDYLSPKYLNRTLPELARVSVDGVVIFAGypgqhrakvselskfgrpaklrsstWWIRYFLQNSLEENEVAAkkfdqasvkrsykpassaltavEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGNVLGNGDIACDEYHKYKEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIVVANPLVYGDYPKIMKQNAGSRLPAFTDHESQQIKGSADFIGVINYYTVYIKDNPSSLKQKHRDWSADTATKFFCTFSTYH
MSRRPVNPARRLADGGSIPFVGSAHSKSRSSPllsvillavgavlligylYSGSGKTTIEKEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGVEPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPELARVSVDGVVIFAGYPGQHRAKVSELSKFGRPAKLRSSTWWIRYFLQNSLEENEVAAKKFDQASVKRSYKPASSALTAVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGNVLGNGDIACDEYHKYKEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIVVANPLVYGDYPKIMKQNAGSRLPAFTDHESQQIKGSADFIGVINYYTVYIKDNPSSLKQKHRDWSADTATKFFCTFSTYH
********************************LLSVILLAVGAVLLIGYLYSGSGKTTIEKEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGVEPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPELARVSVDGVVIFAGYPGQHRAKVSELSKFGRPAKLRSSTWWIRYFLQNSLE************************LTAVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGNVLGNGDIACDEYHKYKEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIVVANPLVYGDYPKIMKQNA******F*******IKGSADFIGVINYYTVYIKDN*********DWSADTATKFFCTFS***
*********************************LSVILLAVGAVLLIGYLYSGSGKTTI*KEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGVEPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPELARVSVDGVVIFAGYPGQHRAKVSELSKFG*****R**TWWIRYFLQN***********************ASS**TAVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGNVLGNGDIACDEYHKYKEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIVVANPLVYGDYPKIMKQNAGSRLPAFTDHESQQIKGSADFIGVINYYTVYIKDNPSSLKQKHRDWSADTATKFFCTFS*Y*
**********RLADGGSIPFVG********SPLLSVILLAVGAVLLIGYLYSGSGKTTIEKEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGVEPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPELARVSVDGVVIFAGYPGQHRAKVSELSKFGRPAKLRSSTWWIRYFLQNSLEENEVAAKKF************SSALTAVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGNVLGNGDIACDEYHKYKEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIVVANPLVYGDYPKIMKQNAGSRLPAFTDHESQQIKGSADFIGVINYYTVYIKDNPS*********SADTATKFFCTFSTYH
*****************************SSPLLSVILLAVGAVLLIGYLYSGSGKTTIEKEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGVEPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPELARVSVDGVVIFAGYPGQHRAKVSELSKFGRPAKLRSSTWWIRYFLQNSLEENEVAAKKFDQASVKRSYKPASSALTAVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGNVLGNGDIACDEYHKYKEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIVVANPLVYGDYPKIMKQNAGSRLPAFTDHESQQIKGSADFIGVINYYTVYIKDNPSSLKQKHRDWSADTATKFFCTFSTYH
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRRPVNPARRLADGGSIPFVGSAHSKSRSSPLLSVILLAVGAVLLIGYLYSGSGKTTIEKEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGVEPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPELARVSVDGVVIFAGYPGQHRAKVSELSKFGRPAKLRSSTWWIRYFLQNSLEENEVAAKKFDQASVKRSYKPASSALTAVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGNVLGNGDIACDEYHKYKEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIVVANPLVYGDYPKIMKQNAGSRLPAFTDHESQQIKGSADFIGVINYYTVYIKDNPSSLKQKHRDWSADTATKFFCTFSTYH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query478 2.2.26 [Sep-21-2011]
Q9M2Y6261 Uncharacterized protein A yes no 0.525 0.961 0.726 1e-103
B3H5Q1 521 Beta-glucosidase 11 OS=Ar no no 0.299 0.274 0.770 1e-66
Q8S3J3 560 Hydroxyisourate hydrolase no no 0.294 0.251 0.788 4e-62
O65458 507 Beta-glucosidase 3 OS=Ara no no 0.299 0.282 0.743 9e-59
Q67XN2 497 Beta-glucosidase 8 OS=Ara no no 0.330 0.317 0.670 4e-58
Q93ZI4 508 Beta-glucosidase 10 OS=Ar no no 0.288 0.271 0.721 2e-57
Q9ZUI3 512 Beta-glucosidase 4 OS=Ara no no 0.284 0.265 0.724 2e-56
Q8RXN9 500 Putative beta-glucosidase no no 0.286 0.274 0.702 2e-56
Q682B4 379 Putative beta-glucosidase no no 0.261 0.329 0.710 7e-56
Q3ECW8 517 Beta-glucosidase 1 OS=Ara no no 0.286 0.264 0.688 8e-56
>sp|Q9M2Y6|Y3972_ARATH Uncharacterized protein At3g49720 OS=Arabidopsis thaliana GN=At3g49720 PE=1 SV=1 Back     alignment and function desciption
 Score =  375 bits (962), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/252 (72%), Positives = 213/252 (84%), Gaps = 1/252 (0%)

Query: 1   MSRRPVNPARRLADGGSIPFVGSAHSKSRSSPLLSVILLAVGAVLLIGYLYSGSGKTTIE 60
           M+RR V   RR+ DGGS PF G+ HSKSRSSPLLS+ L+ VGA LLIGY YSG G     
Sbjct: 1   MARRQVGSTRRVGDGGSFPFAGALHSKSRSSPLLSICLVLVGACLLIGYAYSGPGIFKSI 60

Query: 61  KEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGV 120
           KE +SKV G  SCT EVQRA+PVLKKAYGD M KVLHVGP+TCSVVS LLKEE+TEAWGV
Sbjct: 61  KE-VSKVTGDYSCTAEVQRAIPVLKKAYGDGMRKVLHVGPDTCSVVSSLLKEEETEAWGV 119

Query: 121 EPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPE 180
           EPYD++DAD++C+S V KG+VRVADIKFPLPYRAKSFSLVIVSDA+DYLSPKYLN+T+PE
Sbjct: 120 EPYDIEDADSHCKSFVSKGLVRVADIKFPLPYRAKSFSLVIVSDALDYLSPKYLNKTVPE 179

Query: 181 LARVSVDGVVIFAGYPGQHRAKVSELSKFGRPAKLRSSTWWIRYFLQNSLEENEVAAKKF 240
           LARV+ DGVV+FAG PGQ RAKV+ELSKFGRPAK+RS++WW R+F+Q +LEEN+  +KKF
Sbjct: 180 LARVASDGVVLFAGLPGQQRAKVAELSKFGRPAKMRSASWWNRFFVQTNLEENDAPSKKF 239

Query: 241 DQASVKRSYKPA 252
           +QA  K  YKPA
Sbjct: 240 EQAVSKGLYKPA 251





Arabidopsis thaliana (taxid: 3702)
>sp|B3H5Q1|BGL11_ARATH Beta-glucosidase 11 OS=Arabidopsis thaliana GN=BGLU11 PE=2 SV=2 Back     alignment and function description
>sp|Q8S3J3|HIUH_SOYBN Hydroxyisourate hydrolase OS=Glycine max GN=HIUH PE=1 SV=1 Back     alignment and function description
>sp|O65458|BGL03_ARATH Beta-glucosidase 3 OS=Arabidopsis thaliana GN=BGLU3 PE=3 SV=2 Back     alignment and function description
>sp|Q67XN2|BGL08_ARATH Beta-glucosidase 8 OS=Arabidopsis thaliana GN=BGLU8 PE=2 SV=1 Back     alignment and function description
>sp|Q93ZI4|BGL10_ARATH Beta-glucosidase 10 OS=Arabidopsis thaliana GN=BGLU10 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZUI3|BGL04_ARATH Beta-glucosidase 4 OS=Arabidopsis thaliana GN=BGLU4 PE=2 SV=2 Back     alignment and function description
>sp|Q8RXN9|BGL05_ARATH Putative beta-glucosidase 5 OS=Arabidopsis thaliana GN=BGLU5 PE=5 SV=2 Back     alignment and function description
>sp|Q682B4|BGL06_ARATH Putative beta-glucosidase 6 OS=Arabidopsis thaliana GN=BGLU6 PE=5 SV=1 Back     alignment and function description
>sp|Q3ECW8|BGL01_ARATH Beta-glucosidase 1 OS=Arabidopsis thaliana GN=BGLU1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query478
255562096261 conserved hypothetical protein [Ricinus 0.543 0.996 0.804 1e-118
224105811262 predicted protein [Populus trichocarpa] 0.546 0.996 0.773 1e-115
224060959262 predicted protein [Populus trichocarpa] 0.527 0.961 0.793 1e-114
359475519262 PREDICTED: uncharacterized protein At3g4 0.527 0.961 0.829 1e-113
449438287261 PREDICTED: uncharacterized protein At3g4 0.546 1.0 0.751 1e-112
357446151262 hypothetical protein MTR_2g010540 [Medic 0.546 0.996 0.716 1e-106
147801370256 hypothetical protein VITISV_037838 [Viti 0.514 0.960 0.75 1e-106
358248664262 uncharacterized protein LOC100800870 [Gl 0.527 0.961 0.722 1e-103
297819624261 hypothetical protein ARALYDRAFT_485334 [ 0.525 0.961 0.734 1e-102
359493009263 PREDICTED: uncharacterized protein At3g4 0.527 0.958 0.735 1e-101
>gi|255562096|ref|XP_002522056.1| conserved hypothetical protein [Ricinus communis] gi|223538655|gb|EEF40256.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  431 bits (1109), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/261 (80%), Positives = 232/261 (88%), Gaps = 1/261 (0%)

Query: 1   MSRRPVNPARRLADGGSIPFVGSAHSKSRSSPLLSVILLAVGAVLLIGYLYSGSGKTTIE 60
           MSRRP NPARRL DGG IPFVGS HSKSRSSPLLS+ L+ VGA+LLI Y YSGSG    E
Sbjct: 1   MSRRPGNPARRLGDGGGIPFVGS-HSKSRSSPLLSICLVVVGAILLIIYCYSGSGGHISE 59

Query: 61  KEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGV 120
           +EA SK+EG  SCTLEVQRA+P+LKKAYGDSM KVLH+GP+TCSVVSKLLKEE+TEAWGV
Sbjct: 60  REAFSKIEGGGSCTLEVQRAIPLLKKAYGDSMHKVLHLGPDTCSVVSKLLKEEETEAWGV 119

Query: 121 EPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPE 180
           EPYDLDD DA+C+SLVRKG+VRVADIKFPLPYRAKSFSLVIVSDA+DYLSP+YLN+TLPE
Sbjct: 120 EPYDLDDVDASCKSLVRKGLVRVADIKFPLPYRAKSFSLVIVSDALDYLSPRYLNKTLPE 179

Query: 181 LARVSVDGVVIFAGYPGQHRAKVSELSKFGRPAKLRSSTWWIRYFLQNSLEENEVAAKKF 240
           LARVS DGV+IF+GYPGQH+AKV+ELSKFGRPAK RSSTWWIRYFLQNSLEENE A+KKF
Sbjct: 180 LARVSADGVIIFSGYPGQHKAKVAELSKFGRPAKFRSSTWWIRYFLQNSLEENEAASKKF 239

Query: 241 DQASVKRSYKPASSALTAVEY 261
           +QASVKRSYKP         Y
Sbjct: 240 EQASVKRSYKPGCQVFHLKSY 260




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224105811|ref|XP_002313939.1| predicted protein [Populus trichocarpa] gi|118483865|gb|ABK93823.1| unknown [Populus trichocarpa] gi|222850347|gb|EEE87894.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224060959|ref|XP_002300295.1| predicted protein [Populus trichocarpa] gi|118484269|gb|ABK94014.1| unknown [Populus trichocarpa] gi|222847553|gb|EEE85100.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359475519|ref|XP_002269364.2| PREDICTED: uncharacterized protein At3g49720-like [Vitis vinifera] gi|297736364|emb|CBI25087.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449438287|ref|XP_004136920.1| PREDICTED: uncharacterized protein At3g49720-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357446151|ref|XP_003593353.1| hypothetical protein MTR_2g010540 [Medicago truncatula] gi|355482401|gb|AES63604.1| hypothetical protein MTR_2g010540 [Medicago truncatula] Back     alignment and taxonomy information
>gi|147801370|emb|CAN74732.1| hypothetical protein VITISV_037838 [Vitis vinifera] Back     alignment and taxonomy information
>gi|358248664|ref|NP_001240175.1| uncharacterized protein LOC100800870 [Glycine max] gi|255641603|gb|ACU21074.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297819624|ref|XP_002877695.1| hypothetical protein ARALYDRAFT_485334 [Arabidopsis lyrata subsp. lyrata] gi|297323533|gb|EFH53954.1| hypothetical protein ARALYDRAFT_485334 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359493009|ref|XP_002285500.2| PREDICTED: uncharacterized protein At3g49720-like [Vitis vinifera] gi|302142150|emb|CBI19353.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query478
TAIR|locus:2097380261 AT3G49720 "AT3G49720" [Arabido 0.525 0.961 0.678 8.6e-88
TAIR|locus:2156208258 CGR3 "AT5G65810" [Arabidopsis 0.518 0.961 0.674 9.9e-87
TAIR|locus:2202710 512 BGLU4 "beta glucosidase 4" [Ar 0.284 0.265 0.724 2.3e-70
TAIR|locus:2024685 521 BGLU11 "beta glucosidase 11" [ 0.307 0.282 0.763 4.2e-63
TAIR|locus:2197960 510 BGLU40 "beta glucosidase 40" [ 0.328 0.307 0.493 1.8e-56
UNIPROTKB|Q8L7J2 521 BGLU6 "Beta-glucosidase 6" [Or 0.286 0.262 0.578 3.8e-56
UNIPROTKB|Q9ZT64 513 Q9ZT64 "Beta-glucosidase" [Pin 0.299 0.278 0.561 4.8e-56
TAIR|locus:2120653 507 BGLU3 "beta glucosidase 2" [Ar 0.282 0.266 0.772 1.4e-55
TAIR|locus:2081680 497 BGLU8 "beta glucosidase 8" [Ar 0.330 0.317 0.670 1.8e-55
UNIPROTKB|Q9SPP9 540 Q9SPP9 "Raucaffricine-O-beta-D 0.294 0.261 0.578 2e-55
TAIR|locus:2097380 AT3G49720 "AT3G49720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 877 (313.8 bits), Expect = 8.6e-88, P = 8.6e-88
 Identities = 171/252 (67%), Positives = 199/252 (78%)

Query:     1 MSRRPVNPARRLADGGSIPFVGSAHSKSRSSPXXXXXXXXXXXXXXXXXXYSGSGKTTIE 60
             M+RR V   RR+ DGGS PF G+ HSKSRSSP                  YSG G     
Sbjct:     1 MARRQVGSTRRVGDGGSFPFAGALHSKSRSSPLLSICLVLVGACLLIGYAYSGPGIFKSI 60

Query:    61 KEALSKVEGVVSCTLEVQRALPVLKKAYGDSMLKVLHVGPETCSVVSKLLKEEDTEAWGV 120
             KE +SKV G  SCT EVQRA+PVLKKAYGD M KVLHVGP+TCSVVS LLKEE+TEAWGV
Sbjct:    61 KE-VSKVTGDYSCTAEVQRAIPVLKKAYGDGMRKVLHVGPDTCSVVSSLLKEEETEAWGV 119

Query:   121 EPYDLDDADANCRSLVRKGIVRVADIKFPLPYRAKSFSLVIVSDAVDYLSPKYLNRTLPE 180
             EPYD++DAD++C+S V KG+VRVADIKFPLPYRAKSFSLVIVSDA+DYLSPKYLN+T+PE
Sbjct:   120 EPYDIEDADSHCKSFVSKGLVRVADIKFPLPYRAKSFSLVIVSDALDYLSPKYLNKTVPE 179

Query:   181 LARVSVDGVVIFAGYPGQHRAKVSELSKFGRPAKLRSSTWWIRYFLQNSLEENEVAAKKF 240
             LARV+ DGVV+FAG PGQ RAKV+ELSKFGRPAK+RS++WW R+F+Q +LEEN+  +KKF
Sbjct:   180 LARVASDGVVLFAGLPGQQRAKVAELSKFGRPAKMRSASWWNRFFVQTNLEENDAPSKKF 239

Query:   241 DQASVKRSYKPA 252
             +QA  K  YKPA
Sbjct:   240 EQAVSKGLYKPA 251




GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2156208 CGR3 "AT5G65810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202710 BGLU4 "beta glucosidase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024685 BGLU11 "beta glucosidase 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197960 BGLU40 "beta glucosidase 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8L7J2 BGLU6 "Beta-glucosidase 6" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ZT64 Q9ZT64 "Beta-glucosidase" [Pinus contorta (taxid:3339)] Back     alignment and assigned GO terms
TAIR|locus:2120653 BGLU3 "beta glucosidase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081680 BGLU8 "beta glucosidase 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SPP9 Q9SPP9 "Raucaffricine-O-beta-D-glucosidase" [Rauvolfia serpentina (taxid:4060)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M2Y6Y3972_ARATHNo assigned EC number0.72610.52510.9616yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pg.C_LG_IX0791
SubName- Full=Putative uncharacterized protein; (262 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
PLN02998 497 PLN02998, PLN02998, beta-glucosidase 8e-80
PLN02814 504 PLN02814, PLN02814, beta-glucosidase 3e-76
PLN02849 503 PLN02849, PLN02849, beta-glucosidase 5e-75
TIGR03356 426 TIGR03356, BGL, beta-galactosidase 4e-72
pfam00232 454 pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil 3e-69
COG2723 460 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu 5e-61
PRK13511 469 PRK13511, PRK13511, 6-phospho-beta-galactosidase; 4e-45
PRK09852 474 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosi 5e-29
PRK09589 476 PRK09589, celA, 6-phospho-beta-glucosidase; Review 3e-28
PRK09593 478 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewe 1e-27
PRK15014 477 PRK15014, PRK15014, 6-phospho-beta-glucosidase Bgl 2e-27
TIGR01233 467 TIGR01233, lacG, 6-phospho-beta-galactosidase 5e-27
PLN02998 497 PLN02998, PLN02998, beta-glucosidase 9e-22
PLN02814 504 PLN02814, PLN02814, beta-glucosidase 7e-17
PLN02849 503 PLN02849, PLN02849, beta-glucosidase 7e-16
pfam00232 454 pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil 3e-09
TIGR03356 426 TIGR03356, BGL, beta-galactosidase 0.004
>gnl|CDD|215539 PLN02998, PLN02998, beta-glucosidase Back     alignment and domain information
 Score =  256 bits (655), Expect = 8e-80
 Identities = 113/148 (76%), Positives = 138/148 (93%), Gaps = 1/148 (0%)

Query: 252 ASSALTAVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGNV-LGNGDI 310
           A +A+++++Y++NDFPPGF+FGSGTSAYQVEGAA+EDGRTPSIWD FAHAG+  +  G++
Sbjct: 17  ALTAVSSLKYSRNDFPPGFVFGSGTSAYQVEGAADEDGRTPSIWDVFAHAGHSGVAAGNV 76

Query: 311 ACDEYHKYKEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISYGI 370
           ACD+YHKYKEDVKLMA  GL+AYRFSISWSRL+P+GRGP+NPKGLQYYNNLI+ELI++GI
Sbjct: 77  ACDQYHKYKEDVKLMADMGLEAYRFSISWSRLLPSGRGPINPKGLQYYNNLIDELITHGI 136

Query: 371 QPHVTLHHSDLPQALEDEYGGWINRMIV 398
           QPHVTLHH DLPQALEDEYGGW+++ IV
Sbjct: 137 QPHVTLHHFDLPQALEDEYGGWLSQEIV 164


Length = 497

>gnl|CDD|215435 PLN02814, PLN02814, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215455 PLN02849, PLN02849, beta-glucosidase Back     alignment and domain information
>gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase Back     alignment and domain information
>gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 Back     alignment and domain information
>gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184102 PRK13511, PRK13511, 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>gnl|CDD|182112 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>gnl|CDD|181973 PRK09589, celA, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>gnl|CDD|236580 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>gnl|CDD|184975 PRK15014, PRK15014, 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>gnl|CDD|130300 TIGR01233, lacG, 6-phospho-beta-galactosidase Back     alignment and domain information
>gnl|CDD|215539 PLN02998, PLN02998, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215435 PLN02814, PLN02814, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215455 PLN02849, PLN02849, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 Back     alignment and domain information
>gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 478
KOG0626 524 consensus Beta-glucosidase, lactase phlorizinhydro 100.0
PLN02998 497 beta-glucosidase 100.0
PLN02814 504 beta-glucosidase 100.0
PLN02849 503 beta-glucosidase 100.0
PRK09593 478 arb 6-phospho-beta-glucosidase; Reviewed 100.0
PF00232 455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 100.0
PRK13511 469 6-phospho-beta-galactosidase; Provisional 100.0
TIGR01233 467 lacG 6-phospho-beta-galactosidase. This enzyme is 100.0
PRK15014 477 6-phospho-beta-glucosidase BglA; Provisional 100.0
PRK09852 474 cryptic 6-phospho-beta-glucosidase; Provisional 100.0
PRK09589 476 celA 6-phospho-beta-glucosidase; Reviewed 100.0
COG2723 460 BglB Beta-glucosidase/6-phospho-beta-glucosidase/b 100.0
TIGR03356 427 BGL beta-galactosidase. 100.0
PF00232455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 99.77
KOG0626524 consensus Beta-glucosidase, lactase phlorizinhydro 99.76
PLN02849503 beta-glucosidase 99.76
TIGR01233467 lacG 6-phospho-beta-galactosidase. This enzyme is 99.75
PLN02814504 beta-glucosidase 99.75
PLN02998497 beta-glucosidase 99.75
PRK09852474 cryptic 6-phospho-beta-glucosidase; Provisional 99.73
PRK13511469 6-phospho-beta-galactosidase; Provisional 99.73
PRK09589476 celA 6-phospho-beta-glucosidase; Reviewed 99.72
PRK15014477 6-phospho-beta-glucosidase BglA; Provisional 99.71
PRK09593478 arb 6-phospho-beta-glucosidase; Reviewed 99.71
COG2723460 BglB Beta-glucosidase/6-phospho-beta-glucosidase/b 99.64
TIGR03356427 BGL beta-galactosidase. 99.6
PF02449 374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 98.47
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 97.64
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 97.57
COG1874 673 LacA Beta-galactosidase [Carbohydrate transport an 97.57
smart00633 254 Glyco_10 Glycosyl hydrolase family 10. 94.61
PLN02161 531 beta-amylase 93.27
PLN02803 548 beta-amylase 92.79
PLN02801 517 beta-amylase 92.58
PLN00197 573 beta-amylase; Provisional 92.34
PLN02705 681 beta-amylase 92.24
PLN02905 702 beta-amylase 91.35
PF01373 402 Glyco_hydro_14: Glycosyl hydrolase family 14; Inte 90.97
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 90.89
PF01301 319 Glyco_hydro_35: Glycosyl hydrolases family 35; Int 88.26
COG2730 407 BglC Endoglucanase [Carbohydrate transport and met 88.11
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 86.65
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 83.37
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 82.1
>KOG0626 consensus Beta-glucosidase, lactase phlorizinhydrolase, and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=1.4e-67  Score=555.88  Aligned_cols=211  Identities=58%  Similarity=1.061  Sum_probs=193.7

Q ss_pred             cccCCCCCCCceehhhhhhhhhcCccCCCCCCCceeeecccCCc--c--cCCCCccccccccChHHHHHHHHcCCCeeee
Q 011733          260 EYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHAGN--V--LGNGDIACDEYHKYKEDVKLMAKTGLDAYRF  335 (478)
Q Consensus       260 s~~~~~FP~~FlwG~AtSA~QvEGa~~~~Grg~SiWD~~~~~~~--~--~~~gdvA~D~Y~rykeDi~Lmk~lGvnayRF  335 (478)
                      ++.+..||++|+||+||||||+|||++++||++|+||.|+|..+  +  .+++|+|||+||||+|||+|||+||+++|||
T Consensus        31 ~~~r~~FP~~F~FGtAtSAyQ~EGA~~e~gRg~svWD~f~~~~p~~~~~~~ngdva~D~Yh~ykeDv~Lmk~lgv~afRF  110 (524)
T KOG0626|consen   31 KFSRADFPKGFLFGTATSAYQVEGAANEDGRGPSVWDTFTHKYPGKICDGSNGDVAVDFYHRYKEDVKLMKELGVDAFRF  110 (524)
T ss_pred             cccccCCCCCceeeccchHHHhhhhhccCCCCCchhhhhhccCCcccccCCCCCeechhhhhhHHHHHHHHHcCCCeEEE
Confidence            67899999999999999999999999999999999999998632  2  2468999999999999999999999999999


Q ss_pred             ccccceeecCCC--CCCChhHHHHHHHHHHHHHHCCCcceEeeccCCCCcccccccCCCccceee---------------
Q 011733          336 SISWSRLIPNGR--GPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIV---------------  398 (478)
Q Consensus       336 SIsWsRI~P~G~--G~vN~egv~~Y~~lId~L~~~GIeP~VTL~H~dlP~wL~d~yGGW~n~~iv---------------  398 (478)
                      |||||||+|.|+  +.||++|++||+++|++|+++||+|+|||+|||+||+|+|+||||+|++||               
T Consensus       111 SIsWSRIlP~G~~~~gVN~~Gi~fY~~LI~eL~~nGI~P~VTLfHwDlPq~LeDeYgGwLn~~ivedF~~yA~~CF~~fG  190 (524)
T KOG0626|consen  111 SISWSRILPNGRLTGGVNEAGIQFYNNLIDELLANGIEPFVTLFHWDLPQALEDEYGGWLNPEIVEDFRDYADLCFQEFG  190 (524)
T ss_pred             EeehHhhCCCCCcCCCcCHHHHHHHHHHHHHHHHcCCeEEEEEecCCCCHHHHHHhccccCHHHHHHHHHHHHHHHHHhc
Confidence            999999999997  689999999999999999999999999999999999999999999999885               


Q ss_pred             --------------------------------------------------------------------------------
Q 011733          399 --------------------------------------------------------------------------------  398 (478)
Q Consensus       399 --------------------------------------------------------------------------------  398 (478)
                                                                                                      
T Consensus       191 DrVK~WiT~NEP~v~s~~gY~~G~~aPGrCs~~~~~c~~g~s~~epYiv~HNllLAHA~Av~~yr~kyk~~Q~G~IGi~~  270 (524)
T KOG0626|consen  191 DRVKHWITFNEPNVFSIGGYDTGTKAPGRCSKYVGNCSAGNSGTEPYIVAHNLLLAHAAAVDLYRKKYKKKQGGKIGIAL  270 (524)
T ss_pred             ccceeeEEecccceeeeehhccCCCCCCCCCcccccCCCCCCCCCcchHHHHHHHHHHHHHHHHHHhhhhhcCCeEeEEE
Confidence                                                                                            


Q ss_pred             ----------------------------ecCCcccCCchHHhhhhhCCCCCccchhhhhhhcccccceeeccceeeeeec
Q 011733          399 ----------------------------VANPLVYGDYPKIMKQNAGSRLPAFTDHESQQIKGSADFIGVINYYTVYIKD  450 (478)
Q Consensus       399 ----------------------------~~~P~~fgdYp~~m~~~~GdRLP~FT~eE~~~lkGS~DF~gln~Y~t~y~~~  450 (478)
                                                  +++|+.+||||+.|++.+|+|||.||++|+++||||+||+|||||||+|+++
T Consensus       271 ~~~w~eP~~~s~~D~~Aa~Ra~~F~~gw~l~p~~~GdYP~~Mk~~vg~rLP~FT~ee~~~lKGS~DFvGiNyYts~~~~~  350 (524)
T KOG0626|consen  271 SARWFEPYDDSKEDKEAAERALDFFLGWFLEPLTFGDYPDEMKERVGSRLPKFTEEESKLLKGSYDFVGINYYTSRYVKH  350 (524)
T ss_pred             eeeeeccCCCChHHHHHHHHHHHhhhhhhhcccccCCcHHHHHHHhcccCCCCCHHHHHHhcCchhhceeehhhhhhhhc
Confidence                                        1688899999999999999999999999999999999999999999999999


Q ss_pred             CCCccccCCCCcccCcceeE
Q 011733          451 NPSSLKQKHRDWSADTATKF  470 (478)
Q Consensus       451 ~~~~~~~~~~~~~~D~~~~~  470 (478)
                      .+.+.+.....+..|..+.+
T Consensus       351 ~~~~~~~~~~~~~~d~~~~~  370 (524)
T KOG0626|consen  351 LKPPPDPSQPGWSTDSGVDW  370 (524)
T ss_pred             cCCCCCCCCcccccccceee
Confidence            77555444455777776665



>PLN02998 beta-glucosidase Back     alignment and domain information
>PLN02814 beta-glucosidase Back     alignment and domain information
>PLN02849 beta-glucosidase Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG0626 consensus Beta-glucosidase, lactase phlorizinhydrolase, and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02849 beta-glucosidase Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>PLN02814 beta-glucosidase Back     alignment and domain information
>PLN02998 beta-glucosidase Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>COG1874 LacA Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>PLN02161 beta-amylase Back     alignment and domain information
>PLN02803 beta-amylase Back     alignment and domain information
>PLN02801 beta-amylase Back     alignment and domain information
>PLN00197 beta-amylase; Provisional Back     alignment and domain information
>PLN02705 beta-amylase Back     alignment and domain information
>PLN02905 beta-amylase Back     alignment and domain information
>PF01373 Glyco_hydro_14: Glycosyl hydrolase family 14; InterPro: IPR001554 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
3gno_A 488 Crystal Structure Of A Rice Os3bglu6 Beta-glucosida 2e-46
3gno_A 488 Crystal Structure Of A Rice Os3bglu6 Beta-glucosida 2e-08
3scn_A 481 Crystal Structure Of Rice Bglu1 E386g Mutant Length 2e-44
3scn_A 481 Crystal Structure Of Rice Bglu1 E386g Mutant Length 5e-07
3f4v_A 481 Semi-Active E176q Mutant Of Rice Bglu1, A Plant Exo 2e-44
3f4v_A 481 Semi-Active E176q Mutant Of Rice Bglu1, A Plant Exo 5e-07
3scr_A 481 Crystal Structure Of Rice Bglu1 E386s Mutant Length 2e-44
3scr_A 481 Crystal Structure Of Rice Bglu1 E386s Mutant Length 5e-07
3scp_A 481 Crystal Structure Of Rice Bglu1 E386a Mutant Length 2e-44
3scp_A 481 Crystal Structure Of Rice Bglu1 E386a Mutant Length 5e-07
3scv_A 481 Crystal Structure Of Rice Bglu1 E386gS334A MUTANT C 2e-44
3scv_A 481 Crystal Structure Of Rice Bglu1 E386gS334A MUTANT C 1e-06
2rgl_A 481 Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBE 2e-44
2rgl_A 481 Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBE 5e-07
3scw_A 481 Crystal Structure Of Rice Bglu1 E386gY341A MUTANT C 2e-44
3scw_A 481 Crystal Structure Of Rice Bglu1 E386gY341A MUTANT C 5e-07
1cbg_A 490 The Crystal Structure Of A Cyanogenic Beta-Glucosid 2e-43
1cbg_A 490 The Crystal Structure Of A Cyanogenic Beta-Glucosid 1e-04
4a3y_A 540 Crystal Structure Of Raucaffricine Glucosidase From 2e-43
4a3y_A 540 Crystal Structure Of Raucaffricine Glucosidase From 3e-08
4atd_A 513 Crystal Structure Of Native Raucaffricine Glucosida 3e-43
4atd_A 513 Crystal Structure Of Native Raucaffricine Glucosida 3e-08
3u57_A 513 Structures Of Alkaloid Biosynthetic Glucosidases De 4e-43
3u57_A 513 Structures Of Alkaloid Biosynthetic Glucosidases De 3e-08
3ahx_A 453 Crystal Structure Of Beta-Glucosidase A From Bacter 1e-41
3ptk_A 505 The Crystal Structure Of Rice (Oryza Sativa L.) Os4 7e-41
3ptk_A 505 The Crystal Structure Of Rice (Oryza Sativa L.) Os4 1e-07
3ais_A 565 Crystal Structure Of A Mutant Beta-Glucosidase In W 8e-41
3ais_A 565 Crystal Structure Of A Mutant Beta-Glucosidase In W 7e-05
2dga_A 565 Crystal Structure Of Hexameric Beta-Glucosidase In 8e-41
2dga_A 565 Crystal Structure Of Hexameric Beta-Glucosidase In 7e-05
3aiu_A 564 Crystal Structure Of Beta-Glucosidase In Rye Length 9e-41
3aiu_A 564 Crystal Structure Of Beta-Glucosidase In Rye Length 6e-05
2jf6_A 532 Structure Of Inactive Mutant Of Strictosidine Gluco 4e-40
2jf6_A 532 Structure Of Inactive Mutant Of Strictosidine Gluco 5e-07
1qox_A 449 Beta-Glucosidase From Bacillus Circulans Sp. Alkalo 4e-40
1gnx_A 479 B-Glucosidase From Streptomyces Sp Length = 479 1e-39
1e4i_A 447 2-Deoxy-2-Fluoro-Beta-D-GlucosylENZYME INTERMEDIATE 1e-39
1tr1_A 447 Crystal Structure Of E96k Mutated Beta-glucosidase 1e-39
1v03_A 565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 3e-39
1v03_A 565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 1e-04
1bgg_A 448 Glucosidase A From Bacillus Polymyxa Complexed With 3e-39
3ta9_A 458 Beta-Glucosidase A From The Halothermophile H. Oren 3e-39
1bga_A 447 Beta-Glucosidase A From Bacillus Polymyxa Length = 3e-39
1v02_E 565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 3e-39
1v02_E 565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 1e-04
1uyq_A 447 Mutated B-Glucosidase A From Paenibacillus Polymyxa 4e-39
1v02_A 565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 7e-39
1v02_A 565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 1e-04
1np2_A 436 Crystal Structure Of Thermostable Beta-Glycosidase 2e-38
2e3z_A 465 Crystal Structure Of Intracellular Family 1 Beta- G 1e-37
2e3z_A 465 Crystal Structure Of Intracellular Family 1 Beta- G 1e-06
1e1e_A 512 Crystal Structure Of A Monocot (Maize Zmglu1) Beta- 6e-37
1e1e_A 512 Crystal Structure Of A Monocot (Maize Zmglu1) Beta- 4e-04
1e4l_A 512 Crystal Structure Of The Inactive Mutant Monocot (M 7e-37
1e4l_A 512 Crystal Structure Of The Inactive Mutant Monocot (M 4e-04
1h49_A 512 Crystal Structure Of The Inactive Double Mutant Of 7e-37
1h49_A 512 Crystal Structure Of The Inactive Double Mutant Of 4e-04
1hxj_A 507 Crystal Structure Of The Maize Zm-P60.1 Beta-Glucos 7e-37
1hxj_A 507 Crystal Structure Of The Maize Zm-P60.1 Beta-Glucos 4e-04
1od0_A 468 Family 1 B-Glucosidase From Thermotoga Maritima Len 2e-36
1ug6_A 431 Structure Of Beta-Glucosidase At Atomic Resolution 2e-36
3zjk_A 431 Crystal Structure Of Ttb-gly F401s Mutant Length = 2e-36
1wcg_A 464 Aphid Myrosinase Length = 464 5e-36
3ahz_A 487 Crystal Structure Of Beta-Glucosidase From Termite 1e-35
3vij_A 487 Crystal Structure Of Beta-Glucosidase From Termite 1e-35
3vik_A 487 Crystal Structure Of Beta-Glucosidase From Termite 1e-35
3ai0_A 487 Crystal Structure Of Beta-Glucosidase From Termite 1e-35
2jfe_X 469 The Crystal Structure Of Human Cytosolic Beta-Gluco 4e-35
2jfe_X 469 The Crystal Structure Of Human Cytosolic Beta-Gluco 3e-04
2zox_A 469 Crystal Structure Of The Covalent Intermediate Of H 4e-35
2zox_A 469 Crystal Structure Of The Covalent Intermediate Of H 3e-04
2e9l_A 469 Crystal Structure Of Human Cytosolic Neutral Beta-G 4e-35
2e9l_A 469 Crystal Structure Of Human Cytosolic Neutral Beta-G 3e-04
4gxp_A 467 Chimeric Family 1 Beta-Glucosidase Made With Non-Co 5e-35
4gxp_A 467 Chimeric Family 1 Beta-Glucosidase Made With Non-Co 3e-06
2o9p_A 454 Beta-Glucosidase B From Paenibacillus Polymyxa Leng 2e-34
2o9r_A 452 Beta-Glucosidase B Complexed With Thiocellobiose Le 2e-34
2jie_A 454 Beta-Glucosidase B From Bacillus Polymyxa Complexed 2e-34
4hz6_A 444 Crystal Structure Of Bglb Length = 444 3e-34
3cmj_A 465 Crystal Structure Of Engineered Beta-Glucosidase Fr 4e-34
3ahy_A 473 Crystal Structure Of Beta-Glucosidase 2 From Fungus 4e-31
3ahy_A 473 Crystal Structure Of Beta-Glucosidase 2 From Fungus 3e-06
1myr_A 501 Myrosinase From Sinapis Alba Length = 501 2e-28
1myr_A 501 Myrosinase From Sinapis Alba Length = 501 2e-07
1dwa_M 499 Study On Radiation Damage On A Cryocooled Crystal. 4e-26
1dwa_M 499 Study On Radiation Damage On A Cryocooled Crystal. 8e-08
1e6q_M 501 Myrosinase From Sinapis Alba With The Bound Transit 4e-26
1e6q_M 501 Myrosinase From Sinapis Alba With The Bound Transit 8e-08
2pbg_A 468 6-Phospho-Beta-D-Galactosidase Form-B Length = 468 9e-25
1pbg_A 468 The Three-Dimensional Structure Of 6-Phospho-Beta G 1e-24
4pbg_A 468 6-Phospho-Beta-Galactosidase Form-Cst Length = 468 1e-24
4f66_A 480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 4e-23
4f79_A 480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 4e-23
2xhy_A 479 Crystal Structure Of E.Coli Bgla Length = 479 4e-23
3pn8_A 480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 8e-23
3qom_A 481 Crystal Structure Of 6-Phospho-Beta-Glucosidase Fro 2e-19
4b3k_A 479 Family 1 6-phospho-beta-d Glycosidase From Streptoc 4e-19
1vff_A 423 Beta-Glycosidase From Pyrococcus Horikoshii Length 6e-17
3apg_A 473 Crystal Structure Of Hyperthermophilic Beta-Glucosi 2e-04
>pdb|3GNO|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase Length = 488 Back     alignment and structure

Iteration: 1

Score = 183 bits (465), Expect = 2e-46, Method: Compositional matrix adjust. Identities = 81/140 (57%), Positives = 108/140 (77%), Gaps = 3/140 (2%) Query: 262 TKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHA-GNV--LGNGDIACDEYHKY 318 T+ FP GF+FG+ ++AYQ EGA EDGR +IWDTFAH G + N D+A D+YH++ Sbjct: 13 TRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDFSNADVAVDQYHRF 72 Query: 319 KEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISYGIQPHVTLHH 378 +ED++LMA G+DAYRFSI+WSR+ PNG G VN G+ +YN LI+ L++ GIQP+VTL+H Sbjct: 73 EEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPYVTLYH 132 Query: 379 SDLPQALEDEYGGWINRMIV 398 DLPQALED+Y GW++R IV Sbjct: 133 WDLPQALEDKYKGWLDRQIV 152
>pdb|3GNO|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase Length = 488 Back     alignment and structure
>pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Length = 481 Back     alignment and structure
>pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Length = 481 Back     alignment and structure
>pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- Glucosidase Length = 481 Back     alignment and structure
>pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- Glucosidase Length = 481 Back     alignment and structure
>pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Length = 481 Back     alignment and structure
>pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Length = 481 Back     alignment and structure
>pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Length = 481 Back     alignment and structure
>pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Length = 481 Back     alignment and structure
>pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase Length = 481 Back     alignment and structure
>pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase Length = 481 Back     alignment and structure
>pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|1CBG|A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase Length = 490 Back     alignment and structure
>pdb|1CBG|A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase Length = 490 Back     alignment and structure
>pdb|4A3Y|A Chain A, Crystal Structure Of Raucaffricine Glucosidase From Ajmaline Biosynthesis Pathway Length = 540 Back     alignment and structure
>pdb|4A3Y|A Chain A, Crystal Structure Of Raucaffricine Glucosidase From Ajmaline Biosynthesis Pathway Length = 540 Back     alignment and structure
>pdb|4ATD|A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase Length = 513 Back     alignment and structure
>pdb|4ATD|A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase Length = 513 Back     alignment and structure
>pdb|3U57|A Chain A, Structures Of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity Length = 513 Back     alignment and structure
>pdb|3U57|A Chain A, Structures Of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity Length = 513 Back     alignment and structure
>pdb|3AHX|A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans Length = 453 Back     alignment and structure
>pdb|3PTK|A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 Length = 505 Back     alignment and structure
>pdb|3PTK|A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 Length = 505 Back     alignment and structure
>pdb|3AIS|A Chain A, Crystal Structure Of A Mutant Beta-Glucosidase In Wheat Complexed With Dimboa-Glc Length = 565 Back     alignment and structure
>pdb|3AIS|A Chain A, Crystal Structure Of A Mutant Beta-Glucosidase In Wheat Complexed With Dimboa-Glc Length = 565 Back     alignment and structure
>pdb|2DGA|A Chain A, Crystal Structure Of Hexameric Beta-Glucosidase In Wheat Length = 565 Back     alignment and structure
>pdb|2DGA|A Chain A, Crystal Structure Of Hexameric Beta-Glucosidase In Wheat Length = 565 Back     alignment and structure
>pdb|3AIU|A Chain A, Crystal Structure Of Beta-Glucosidase In Rye Length = 564 Back     alignment and structure
>pdb|3AIU|A Chain A, Crystal Structure Of Beta-Glucosidase In Rye Length = 564 Back     alignment and structure
>pdb|2JF6|A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine Length = 532 Back     alignment and structure
>pdb|2JF6|A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine Length = 532 Back     alignment and structure
>pdb|1QOX|A Chain A, Beta-Glucosidase From Bacillus Circulans Sp. Alkalophilus Length = 449 Back     alignment and structure
>pdb|1GNX|A Chain A, B-Glucosidase From Streptomyces Sp Length = 479 Back     alignment and structure
>pdb|1E4I|A Chain A, 2-Deoxy-2-Fluoro-Beta-D-GlucosylENZYME INTERMEDIATE Complex Of The Beta-Glucosidase From Bacillus Polymyxa Length = 447 Back     alignment and structure
>pdb|1TR1|A Chain A, Crystal Structure Of E96k Mutated Beta-glucosidase A From Bacillus Polymyxa, An Enzyme With Increased Thermoresistance Length = 447 Back     alignment and structure
>pdb|1V03|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V03|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1BGG|A Chain A, Glucosidase A From Bacillus Polymyxa Complexed With Gluconate Length = 448 Back     alignment and structure
>pdb|3TA9|A Chain A, Beta-Glucosidase A From The Halothermophile H. Orenii Length = 458 Back     alignment and structure
>pdb|1BGA|A Chain A, Beta-Glucosidase A From Bacillus Polymyxa Length = 447 Back     alignment and structure
>pdb|1V02|E Chain E, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V02|E Chain E, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1UYQ|A Chain A, Mutated B-Glucosidase A From Paenibacillus Polymyxa Showing Increased Stability Length = 447 Back     alignment and structure
>pdb|1V02|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V02|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1NP2|A Chain A, Crystal Structure Of Thermostable Beta-Glycosidase From Thermophilic Eubacterium Thermus Nonproteolyticus Hg102 Length = 436 Back     alignment and structure
>pdb|2E3Z|A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form Length = 465 Back     alignment and structure
>pdb|2E3Z|A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form Length = 465 Back     alignment and structure
>pdb|1E1E|A Chain A, Crystal Structure Of A Monocot (Maize Zmglu1) Beta-Glucosidase Length = 512 Back     alignment and structure
>pdb|1E1E|A Chain A, Crystal Structure Of A Monocot (Maize Zmglu1) Beta-Glucosidase Length = 512 Back     alignment and structure
>pdb|1E4L|A Chain A, Crystal Structure Of The Inactive Mutant Monocot (Maize Zmglu1) Beta-Glucosidase Zm Glu191asp Length = 512 Back     alignment and structure
>pdb|1E4L|A Chain A, Crystal Structure Of The Inactive Mutant Monocot (Maize Zmglu1) Beta-Glucosidase Zm Glu191asp Length = 512 Back     alignment and structure
>pdb|1H49|A Chain A, Crystal Structure Of The Inactive Double Mutant Of The Maize Beta-Glucosidase Zmglu1-E191d-F198v In Complex With Dimboa-Glucoside Length = 512 Back     alignment and structure
>pdb|1H49|A Chain A, Crystal Structure Of The Inactive Double Mutant Of The Maize Beta-Glucosidase Zmglu1-E191d-F198v In Complex With Dimboa-Glucoside Length = 512 Back     alignment and structure
>pdb|1HXJ|A Chain A, Crystal Structure Of The Maize Zm-P60.1 Beta-Glucosidase Length = 507 Back     alignment and structure
>pdb|1HXJ|A Chain A, Crystal Structure Of The Maize Zm-P60.1 Beta-Glucosidase Length = 507 Back     alignment and structure
>pdb|1OD0|A Chain A, Family 1 B-Glucosidase From Thermotoga Maritima Length = 468 Back     alignment and structure
>pdb|1UG6|A Chain A, Structure Of Beta-Glucosidase At Atomic Resolution From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|3ZJK|A Chain A, Crystal Structure Of Ttb-gly F401s Mutant Length = 431 Back     alignment and structure
>pdb|1WCG|A Chain A, Aphid Myrosinase Length = 464 Back     alignment and structure
>pdb|3AHZ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Tris Length = 487 Back     alignment and structure
>pdb|3VIJ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Glucose Length = 487 Back     alignment and structure
>pdb|3VIK|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Cellobiose Length = 487 Back     alignment and structure
>pdb|3AI0|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Para-Nitrophenyl-Beta-D-Glucopyranoside Length = 487 Back     alignment and structure
>pdb|2JFE|X Chain X, The Crystal Structure Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2JFE|X Chain X, The Crystal Structure Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2ZOX|A Chain A, Crystal Structure Of The Covalent Intermediate Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2ZOX|A Chain A, Crystal Structure Of The Covalent Intermediate Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2E9L|A Chain A, Crystal Structure Of Human Cytosolic Neutral Beta-Glycosylceramidase (Klotho-Related Prote:klrp) Complex With Glucose And Fatty Acids Length = 469 Back     alignment and structure
>pdb|2E9L|A Chain A, Crystal Structure Of Human Cytosolic Neutral Beta-Glycosylceramidase (Klotho-Related Prote:klrp) Complex With Glucose And Fatty Acids Length = 469 Back     alignment and structure
>pdb|4GXP|A Chain A, Chimeric Family 1 Beta-Glucosidase Made With Non-Contiguous Schema Length = 467 Back     alignment and structure
>pdb|4GXP|A Chain A, Chimeric Family 1 Beta-Glucosidase Made With Non-Contiguous Schema Length = 467 Back     alignment and structure
>pdb|2O9P|A Chain A, Beta-Glucosidase B From Paenibacillus Polymyxa Length = 454 Back     alignment and structure
>pdb|2O9R|A Chain A, Beta-Glucosidase B Complexed With Thiocellobiose Length = 452 Back     alignment and structure
>pdb|2JIE|A Chain A, Beta-Glucosidase B From Bacillus Polymyxa Complexed With 2- F-Glucose Length = 454 Back     alignment and structure
>pdb|4HZ6|A Chain A, Crystal Structure Of Bglb Length = 444 Back     alignment and structure
>pdb|3CMJ|A Chain A, Crystal Structure Of Engineered Beta-Glucosidase From Soil Metagenome Length = 465 Back     alignment and structure
>pdb|3AHY|A Chain A, Crystal Structure Of Beta-Glucosidase 2 From Fungus Trichoderma Reesei In Complex With Tris Length = 473 Back     alignment and structure
>pdb|3AHY|A Chain A, Crystal Structure Of Beta-Glucosidase 2 From Fungus Trichoderma Reesei In Complex With Tris Length = 473 Back     alignment and structure
>pdb|1MYR|A Chain A, Myrosinase From Sinapis Alba Length = 501 Back     alignment and structure
>pdb|1MYR|A Chain A, Myrosinase From Sinapis Alba Length = 501 Back     alignment and structure
>pdb|1DWA|M Chain M, Study On Radiation Damage On A Cryocooled Crystal. Part 1: Structure Prior To Irradiation Length = 499 Back     alignment and structure
>pdb|1DWA|M Chain M, Study On Radiation Damage On A Cryocooled Crystal. Part 1: Structure Prior To Irradiation Length = 499 Back     alignment and structure
>pdb|1E6Q|M Chain M, Myrosinase From Sinapis Alba With The Bound Transition State Analogue Gluco-Tetrazole Length = 501 Back     alignment and structure
>pdb|1E6Q|M Chain M, Myrosinase From Sinapis Alba With The Bound Transition State Analogue Gluco-Tetrazole Length = 501 Back     alignment and structure
>pdb|2PBG|A Chain A, 6-Phospho-Beta-D-Galactosidase Form-B Length = 468 Back     alignment and structure
>pdb|1PBG|A Chain A, The Three-Dimensional Structure Of 6-Phospho-Beta Galactosidase From Lactococcus Lactis Length = 468 Back     alignment and structure
>pdb|4PBG|A Chain A, 6-Phospho-Beta-Galactosidase Form-Cst Length = 468 Back     alignment and structure
>pdb|4F66|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 In Complex With Beta-D-Glucose-6-Phosphate. Length = 480 Back     alignment and structure
>pdb|4F79|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase Mutant (E375q) In Complex With Salicin 6-Phosphate Length = 480 Back     alignment and structure
>pdb|2XHY|A Chain A, Crystal Structure Of E.Coli Bgla Length = 479 Back     alignment and structure
>pdb|3PN8|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 Length = 480 Back     alignment and structure
>pdb|3QOM|A Chain A, Crystal Structure Of 6-Phospho-Beta-Glucosidase From Lactobacillus Plantarum Length = 481 Back     alignment and structure
>pdb|4B3K|A Chain A, Family 1 6-phospho-beta-d Glycosidase From Streptococcus Pyogenes Length = 479 Back     alignment and structure
>pdb|1VFF|A Chain A, Beta-Glycosidase From Pyrococcus Horikoshii Length = 423 Back     alignment and structure
>pdb|3APG|A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus Length = 473 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
3gnp_A 488 OS03G0212800 protein; beta-alpha barrel, glycosida 8e-98
3gnp_A 488 OS03G0212800 protein; beta-alpha barrel, glycosida 7e-20
3f5l_A 481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 1e-97
3f5l_A 481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 7e-20
2dga_A 565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 4e-96
2dga_A 565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 8e-19
3ptm_A 505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 3e-95
3ptm_A 505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 1e-19
2jf7_A 532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 5e-95
2jf7_A 532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 7e-20
1cbg_A 490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 7e-95
1cbg_A 490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 4e-19
1v02_A 565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 4e-94
1v02_A 565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 7e-19
4a3y_A 540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 5e-94
4a3y_A 540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 4e-19
2e3z_A 465 Beta-glucosidase; TIM barrel, glycoside hydrolase 1e-93
2e3z_A 465 Beta-glucosidase; TIM barrel, glycoside hydrolase 1e-18
1v08_A 512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 1e-93
1v08_A 512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 4e-19
3vii_A 487 Beta-glucosidase; cellulases, glycosyl hydrolase, 7e-93
3vii_A 487 Beta-glucosidase; cellulases, glycosyl hydrolase, 2e-14
1gnx_A 479 Beta-glucosidase; hydrolase, glycosyltransferase, 1e-92
1gnx_A 479 Beta-glucosidase; hydrolase, glycosyltransferase, 3e-11
1wcg_A 464 Thioglucosidase, myrosinase; aphid, beta-glucosida 4e-92
1wcg_A 464 Thioglucosidase, myrosinase; aphid, beta-glucosida 2e-16
2e9l_A 469 Cytosolic beta-glucosidase; novel cytosolic neutra 2e-90
2e9l_A 469 Cytosolic beta-glucosidase; novel cytosolic neutra 7e-15
3ahx_A 453 Beta-glucosidase A; cellulases, glycosyl hydrolase 1e-89
3ahx_A 453 Beta-glucosidase A; cellulases, glycosyl hydrolase 2e-11
3ahy_A 473 Beta-glucosidase; cellulases, glycosyl hydrolase, 2e-89
3ahy_A 473 Beta-glucosidase; cellulases, glycosyl hydrolase, 7e-19
3ta9_A 458 Glycoside hydrolase family 1; TIM barrel, glucosid 5e-89
3ta9_A 458 Glycoside hydrolase family 1; TIM barrel, glucosid 1e-11
1qox_A 449 Beta-glucosidase; hydrolase, cellulose degradation 9e-89
1qox_A 449 Beta-glucosidase; hydrolase, cellulose degradation 2e-12
2j78_A 468 Beta-glucosidase A; family 1, hydrolase, inhibitor 1e-88
2j78_A 468 Beta-glucosidase A; family 1, hydrolase, inhibitor 2e-14
1e4i_A 447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 2e-88
1e4i_A 447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 4e-11
1e4m_M 501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 2e-88
1e4m_M 501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 5e-21
3fj0_A 465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 3e-88
3fj0_A 465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 4e-11
1ug6_A 431 Beta-glycosidase; glucosidase, atomic resolution, 3e-88
1ug6_A 431 Beta-glycosidase; glucosidase, atomic resolution, 4e-09
2o9p_A 454 Beta-glucosidase B; family 1 glycoside hydrolase; 2e-85
2o9p_A 454 Beta-glucosidase B; family 1 glycoside hydrolase; 4e-11
1pbg_A 468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 2e-82
1pbg_A 468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 2e-08
4eam_A 489 Lactase, beta-galactosidase; glycoside hydrolase, 1e-75
4eam_A 489 Lactase, beta-galactosidase; glycoside hydrolase, 1e-06
1qvb_A 481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 1e-74
1qvb_A 481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 3e-06
1vff_A 423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 1e-73
1vff_A 423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 3e-05
3apg_A 473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 7e-71
2xhy_A 479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 1e-57
4dde_A 480 6-phospho-beta-glucosidase; structural genomics, P 5e-57
3qom_A 481 6-phospho-beta-glucosidase; structural genomics, P 9e-57
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-16
3aof_A 317 Endoglucanase; glycosyl hydrolase family 5, cellul 1e-05
1edg_A 380 Endoglucanase A; family A, cellulases, xylanases, 4e-05
3n9k_A 399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 7e-05
1ceo_A 343 Cellulase CELC; glycosyl hydrolase, family A/5 of 9e-05
1vjz_A 341 Endoglucanase; TM1752, structural genomics, JCSG, 2e-04
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 3e-04
3nco_A 320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 4e-04
2jep_A 395 Xyloglucanase; family 5, plant cell WALL, hydrolas 5e-04
2osx_A 481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 6e-04
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
 Score =  302 bits (775), Expect = 8e-98
 Identities = 81/150 (54%), Positives = 110/150 (73%), Gaps = 3/150 (2%)

Query: 252 ASSALTAVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHA-GNVLG--NG 308
             +  +    T+  FP GF+FG+ ++AYQ EGA  EDGR  +IWDTFAH  G +    N 
Sbjct: 3   TMAQQSGGGLTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDFSNA 62

Query: 309 DIACDEYHKYKEDVKLMAKTGLDAYRFSISWSRLIPNGRGPVNPKGLQYYNNLINELISY 368
           D+A D+YH+++ED++LMA  G+DAYRFSI+WSR+ PNG G VN  G+ +YN LI+ L++ 
Sbjct: 63  DVAVDQYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAK 122

Query: 369 GIQPHVTLHHSDLPQALEDEYGGWINRMIV 398
           GIQP+VTL+H DLPQALED+Y GW++R IV
Sbjct: 123 GIQPYVTLYHWDLPQALEDKYKGWLDRQIV 152


>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 Back     alignment and structure
>4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 Back     alignment and structure
>4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Length = 473 Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Length = 479 Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} Length = 481 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Length = 317 Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Length = 380 Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Length = 399 Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Length = 343 Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Length = 341 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Length = 320 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Length = 395 Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Length = 481 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query478
4a3y_A 540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 100.0
3ptm_A 505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 100.0
3f5l_A 481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 100.0
4dde_A 480 6-phospho-beta-glucosidase; structural genomics, P 100.0
3gnp_A 488 OS03G0212800 protein; beta-alpha barrel, glycosida 100.0
4atd_A 513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 100.0
3vii_A 487 Beta-glucosidase; cellulases, glycosyl hydrolase, 100.0
3qom_A 481 6-phospho-beta-glucosidase; structural genomics, P 100.0
3ta9_A 458 Glycoside hydrolase family 1; TIM barrel, glucosid 100.0
2dga_A 565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 100.0
1uwi_A 489 Beta-galactosidase; hydrolase, beta-glycosidase, g 100.0
2e3z_A 465 Beta-glucosidase; TIM barrel, glycoside hydrolase 100.0
4hz8_A 444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 100.0
1cbg_A 490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 100.0
1gnx_A 479 Beta-glucosidase; hydrolase, glycosyltransferase, 100.0
4b3l_A 479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 100.0
2jf7_A 532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 100.0
4ha4_A 489 Beta-galactosidase; TIM barrel, beta-glycosidase, 100.0
1v02_A 565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 100.0
1v08_A 512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 100.0
1wcg_A 464 Thioglucosidase, myrosinase; aphid, beta-glucosida 100.0
1e4m_M 501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 100.0
2e9l_A 469 Cytosolic beta-glucosidase; novel cytosolic neutra 100.0
1qox_A 449 Beta-glucosidase; hydrolase, cellulose degradation 100.0
1e4i_A 447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 100.0
3ahy_A 473 Beta-glucosidase; cellulases, glycosyl hydrolase, 100.0
3fj0_A 465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 100.0
3ahx_A 453 Beta-glucosidase A; cellulases, glycosyl hydrolase 100.0
2o9p_A 454 Beta-glucosidase B; family 1 glycoside hydrolase; 100.0
1pbg_A 468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 100.0
1ug6_A 431 Beta-glycosidase; glucosidase, atomic resolution, 100.0
2j78_A 468 Beta-glucosidase A; family 1, hydrolase, inhibitor 100.0
2xhy_A 479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 100.0
3apg_A 473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 100.0
1qvb_A 481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 100.0
1vff_A 423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 100.0
4ha4_A489 Beta-galactosidase; TIM barrel, beta-glycosidase, 99.82
1uwi_A489 Beta-galactosidase; hydrolase, beta-glycosidase, g 99.79
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 99.78
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 99.78
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 99.78
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 99.76
4atd_A513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 99.76
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 99.75
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 99.75
4b3l_A479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 99.75
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 99.75
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 99.75
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 99.75
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 99.75
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 99.75
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 99.74
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 99.74
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 99.74
4dde_A480 6-phospho-beta-glucosidase; structural genomics, P 99.74
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 99.74
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 99.74
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 99.74
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 99.74
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 99.74
4hz8_A444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 99.74
3qom_A481 6-phospho-beta-glucosidase; structural genomics, P 99.74
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 99.74
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 99.73
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 99.73
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 99.73
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 99.73
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 99.72
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 99.72
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 99.71
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 99.71
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 99.71
1vem_A 516 Beta-amylase; beta-alpha-barrels, optimum PH, hydr 99.37
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 99.15
3l55_A 353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 99.09
1h1n_A 305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 99.02
2osx_A 481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 98.98
1uhv_A 500 Beta-xylosidase; family 39 glycoside hydrolase, xy 98.85
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 98.85
3ayr_A 376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 98.81
1vjz_A 341 Endoglucanase; TM1752, structural genomics, JCSG, 98.81
2jep_A 395 Xyloglucanase; family 5, plant cell WALL, hydrolas 98.8
3ndz_A 345 Endoglucanase D; cellotriose, xylanase, carbohydra 98.8
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 98.8
1ceo_A 343 Cellulase CELC; glycosyl hydrolase, family A/5 of 98.78
1edg_A 380 Endoglucanase A; family A, cellulases, xylanases, 98.73
3nco_A 320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 98.72
1w91_A 503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 98.71
3qr3_A 340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 98.66
1ece_A 358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 98.57
1rh9_A 373 Endo-beta-mannanase; endo-beta-mannase, retaining, 98.48
3aof_A 317 Endoglucanase; glycosyl hydrolase family 5, cellul 98.47
1fob_A 334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 98.43
3qho_A 458 Endoglucanase, 458AA long hypothetical endo-1,4-be 98.31
1h4p_A 408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 98.29
3n9k_A 399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 98.27
3d3a_A 612 Beta-galactosidase; protein structure initiative I 98.25
3niy_A 341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 97.81
1uuq_A 440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 97.77
1nq6_A 302 XYS1; glycoside hydrolase family 10, xylanase, xyl 97.69
3pzg_A 383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 97.63
1xyz_A 347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 97.53
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 97.43
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 97.31
2c0h_A 353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 97.24
1ur1_A 378 Endoxylanase; hydrolase, family 10, glycoside hydr 97.16
1qnr_A 344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 97.15
4e8d_A 595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 97.08
3thd_A 654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 97.08
4hty_A 359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 97.07
1g01_A 364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 97.0
1tg7_A 971 Beta-galactosidase; TIM barrel domain, glycoside h 96.97
3cui_A 315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 96.93
3u7v_A 552 Beta-galactosidase; structural genomics, PSI-biolo 96.91
1n82_A 331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 96.9
1r85_A 379 Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A 96.75
3emz_A 331 Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba 96.68
2cks_A 306 Endoglucanase E-5; carbohydrate metabolism, polysa 96.55
1hjs_A 332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 96.53
3og2_A 1003 Beta-galactosidase; TIM barrel domain, glycoside h 96.48
2whl_A 294 Beta-mannanase, baman5; glycoside hydrolase, hydro 96.39
3vup_A 351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 96.38
7a3h_A 303 Endoglucanase; hydrolase, cellulose degradation, g 96.21
1ta3_B 303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 96.1
2y8k_A 491 Arabinoxylanase, carbohydrate binding family 6; hy 96.05
2dep_A 356 Xylanase B, thermostable celloxylanase; glycosidas 95.94
2d1z_A 436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 95.87
1i1w_A 303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 95.79
1bqc_A 302 Protein (beta-mannanase); glycosyl hydrolase, fami 95.65
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 95.63
1wky_A 464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 95.32
3jug_A 345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 95.26
2uwf_A 356 Endoxylanase, alkaline active endoxylanase; hydrol 95.16
1v0l_A 313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 94.89
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 94.81
1us2_A 530 Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca 94.73
4f8x_A 335 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 94.61
1w32_A 348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 94.53
3u7b_A 327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 94.19
4ekj_A 500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 94.18
1wdp_A 495 Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.2 94.15
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 93.76
2xfr_A 535 Beta-amylase; hydrolase, carbohydrate metabolism, 93.69
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 93.66
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 92.61
3ro8_A 341 Endo-1,4-beta-xylanase; glycosyl hydrolase family 92.56
1fa2_A 498 Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.3 92.4
1ur4_A 399 Galactanase; hydrolase, beta-1, glycoside hydrolas 90.35
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 90.33
2w61_A 555 GAS2P, glycolipid-anchored surface protein 2; glyc 90.12
4awe_A 387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 89.58
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 89.52
3hnr_A220 Probable methyltransferase BT9727_4108; structural 87.44
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 86.33
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 86.3
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 85.97
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 85.79
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 82.57
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 82.02
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 81.84
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 81.79
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 81.32
3dtn_A234 Putative methyltransferase MM_2633; structural gen 80.49
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 80.29
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 80.24
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 80.17
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
Probab=100.00  E-value=3.3e-60  Score=506.50  Aligned_cols=195  Identities=54%  Similarity=1.008  Sum_probs=178.8

Q ss_pred             cccccCCCCCCCceehhhhhhhhhcCccCCCCCCCceeeecccC--Cccc--CCCCccccccccChHHHHHHHHcCCCee
Q 011733          258 AVEYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHA--GNVL--GNGDIACDEYHKYKEDVKLMAKTGLDAY  333 (478)
Q Consensus       258 Lss~~~~~FP~~FlwG~AtSA~QvEGa~~~~Grg~SiWD~~~~~--~~~~--~~gdvA~D~Y~rykeDi~Lmk~lGvnay  333 (478)
                      ...+++..||++|+||+||||||||||+++||||+|+||.|+|.  +.+.  .++++||||||||+|||+||++||+++|
T Consensus        14 ~~~~sr~~FP~~FlwG~AtaA~QiEGa~~~dGkg~SiwD~~~~~~p~~~~~~~~gdvA~D~Yhry~EDi~Lm~elG~~~y   93 (540)
T 4a3y_A           14 ATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAY   93 (540)
T ss_dssp             GGGCCGGGSCTTCEEEEECCHHHHCCCTTSTTCCCBHHHHHHHHCGGGSGGGCCTTTTTCHHHHHHHHHHHHHHHTCSEE
T ss_pred             cCccccccCCCCCeEeeechHhhhcCCcCCCCCcccHHHhhhccCCCcccCCCCCCcccchhHhhHHHHHHHHHcCCCEE
Confidence            34578889999999999999999999999999999999999974  3332  4789999999999999999999999999


Q ss_pred             eeccccceeecCC--CCCCChhHHHHHHHHHHHHHHCCCcceEeeccCCCCcccccccCCCccceee-------------
Q 011733          334 RFSISWSRLIPNG--RGPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIV-------------  398 (478)
Q Consensus       334 RFSIsWsRI~P~G--~G~vN~egv~~Y~~lId~L~~~GIeP~VTL~H~dlP~wL~d~yGGW~n~~iv-------------  398 (478)
                      ||||+||||+|+|  +|.+|++|++||+++||+|+++||+|+|||+|||+|+||+++||||+|++++             
T Consensus        94 RfSIsWsRI~P~G~~~g~~N~~Gl~fY~~lid~l~~~GIeP~VTL~H~dlP~~L~~~yGGW~nr~~v~~F~~Ya~~~f~~  173 (540)
T 4a3y_A           94 RFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWE  173 (540)
T ss_dssp             EEECCHHHHSTTSSGGGCCCHHHHHHHHHHHHHHHHTTCEEEEEEESSCCBHHHHHHHCGGGSTHHHHHHHHHHHHHHHH
T ss_pred             EeeccHhhcccCCCCCCCCCHHHHHHHHHHHHHHHHcCCccceeccCCCCcHHHHhccCCcCChHHHHHHHHHHHHHHHH
Confidence            9999999999998  4899999999999999999999999999999999999999999999999763             


Q ss_pred             --------------------------------------------------------------------------------
Q 011733          399 --------------------------------------------------------------------------------  398 (478)
Q Consensus       399 --------------------------------------------------------------------------------  398 (478)
                                                                                                      
T Consensus       174 fgdrVk~W~T~NEP~~~~~~gy~~G~~aPg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~a~hh~llAha~A  253 (540)
T 4a3y_A          174 FGDRVKHWMTLNEPWTFSVHGYATGLYAPGRGRTSPEHVNHPTVQHRCSTVAPQCICSTGNPGTEPYWVTHHLLLAHAAA  253 (540)
T ss_dssp             HTTTCCEEEEEECHHHHHHHHHTSCCSTTCCCCC-------------------------CCTTTHHHHHHHHHHHHHHHH
T ss_pred             hccccCEeeEccccHHhhhhhhhhcCCCCCccccchhhhcchhhhhhhhhhhhccccccccchHHHHHHHHHHHHHhHHH
Confidence                                                                                            


Q ss_pred             -------------------------------------------------ecCCcccCCchHHhhhhhCCCCCccchhhhh
Q 011733          399 -------------------------------------------------VANPLVYGDYPKIMKQNAGSRLPAFTDHESQ  429 (478)
Q Consensus       399 -------------------------------------------------~~~P~~fgdYp~~m~~~~GdRLP~FT~eE~~  429 (478)
                                                                       ++||+..|+||+.|++.+++++|.|+++|.+
T Consensus       254 v~~~r~~~~~~~~g~IGi~~~~~~~~P~~~~~~~~~~aa~~~~~~~~~~f~dp~~~G~YP~~~~~~~~~~l~~~~~~d~~  333 (540)
T 4a3y_A          254 VELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSK  333 (540)
T ss_dssp             HHHHHHHTHHHHCCEEEEEEEEEEEEESSTTCHHHHHHHHHHHHHHTHHHHHHHHHSSCCHHHHHHHGGGSCCCCHHHHH
T ss_pred             HHHHHHhccccccceEEEEecccccccCCCCcHhHHHHHHHHHHHHhcccchHHhcCCCcHHHHHHhhccCCcCCHHHHH
Confidence                                                             0245567999999999999999999999999


Q ss_pred             hhcccccceeeccceeeeeecCC
Q 011733          430 QIKGSADFIGVINYYTVYIKDNP  452 (478)
Q Consensus       430 ~lkGS~DF~gln~Y~t~y~~~~~  452 (478)
                      +++|++||+|||+|++.+++..+
T Consensus       334 li~~~~DFiGinyY~~~~v~~~~  356 (540)
T 4a3y_A          334 MLKGSYDFVGLNYYTASYVTNAS  356 (540)
T ss_dssp             HHTTCCSEEEEEEEEEEEEEECC
T ss_pred             hhcCCCCeeEEecccceEEecCc
Confidence            99999999999999999998644



>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Back     alignment and structure
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A Back     alignment and structure
>3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A Back     alignment and structure
>4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>1wdp_A Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.27A {Glycine max} SCOP: c.1.8.1 PDB: 1bfn_A* 1q6c_A 1wdr_A* 1v3i_A* 1v3h_A* 1q6d_A* 1q6g_A* 1wdq_A* 1wds_A* 1q6e_A* 1q6f_A* 2dqx_A 1byb_A* 1bya_A* 1byc_A* 1byd_A* 1uko_A 1ukp_A 1btc_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>2xfr_A Beta-amylase; hydrolase, carbohydrate metabolism, glycosyl hydrolase famil starch degradation, germination; 0.97A {Hordeum vulgare} PDB: 2xff_A 2xfy_A* 2xg9_A* 2xgb_A* 2xgi_A* 1b1y_A* Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3ro8_A Endo-1,4-beta-xylanase; glycosyl hydrolase family 10, GH10, (beta/alpha)8 fold, XYLA hydrolase; 1.34A {Paenibacillus SP} PDB: 3rdk_A 4e4p_A Back     alignment and structure
>1fa2_A Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.30A {Ipomoea batatas} SCOP: c.1.8.1 Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 478
d1cbga_ 490 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 6e-60
d1cbga_ 490 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 2e-05
d1v02a_ 484 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 1e-58
d1v02a_ 484 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 5e-04
d1qoxa_ 449 c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulan 2e-58
d1gnxa_ 464 c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. 4e-58
d1uwsa_ 489 c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus 1e-57
d1e4mm_ 499 c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { 3e-57
d1e4mm_ 499 c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { 1e-06
d2j78a1 443 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m 5e-57
d2j78a1 443 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m 3e-04
d1e4ia_ 447 c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa 7e-57
d1wcga1 462 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( 1e-56
d1pbga_ 468 c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL 9e-56
d1qvba_ 481 c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermospha 3e-55
d1ug6a_ 426 c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophi 1e-53
d1vffa1 423 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyr 2e-43
d1kwga2 393 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus t 2e-12
d1edga_ 380 c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellu 1e-08
d1ceoa_ 340 c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm 7e-08
d2pb1a1 394 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast 1e-07
d1vjza_ 325 c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm 4e-07
d1uuqa_ 410 c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [Ta 2e-06
d1h4pa_ 408 c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yea 2e-04
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Family 1 of glycosyl hydrolase
domain: Plant beta-glucosidase (myrosinase)
species: Creeping white clover (Trifolium repens) [TaxId: 3899]
 Score =  202 bits (514), Expect = 6e-60
 Identities = 86/171 (50%), Positives = 118/171 (69%), Gaps = 10/171 (5%)

Query: 260 EYTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHA--GNVLG--NGDIACDEY 315
           +  ++ F PGF+FG+ +SA+Q EGAA EDG+ PSIWDTF H     +    NGD+A DEY
Sbjct: 13  DLNRSCFAPGFVFGTASSAFQYEGAAFEDGKGPSIWDTFTHKYPEKIKDRTNGDVAIDEY 72

Query: 316 HKYKEDVKLMAKTGLDAYRFSISWSRLIPNGR--GPVNPKGLQYYNNLINELISYGIQPH 373
           H+YKED+ +M    LDAYRFSISW R++P G+  G VN +G+ YYNNLINE+++ G+QP+
Sbjct: 73  HRYKEDIGIMKDMNLDAYRFSISWPRVLPKGKLSGGVNREGINYYNNLINEVLANGMQPY 132

Query: 374 VTLHHSDLPQALEDEYGGWINRMIVVANPLVYGDYPKIMKQNAGSRLPAFT 424
           VTL H D+PQALEDEY G++ R IV      + DY ++  +  G R+  + 
Sbjct: 133 VTLFHWDVPQALEDEYRGFLGRNIVDD----FRDYAELCFKEFGDRVKHWI 179


>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 489 Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Length = 468 Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Length = 481 Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Length = 426 Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 423 Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Length = 393 Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Length = 394 Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Length = 410 Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 408 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query478
d1v02a_ 484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 100.0
d1qoxa_ 449 Beta-glucosidase A {Bacillus circulans, subsp. alk 100.0
d1pbga_ 468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 100.0
d1e4mm_ 499 Plant beta-glucosidase (myrosinase) {White mustard 100.0
d2j78a1 443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 100.0
d1wcga1 462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 100.0
d1e4ia_ 447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 100.0
d1gnxa_ 464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 100.0
d1cbga_ 490 Plant beta-glucosidase (myrosinase) {Creeping whit 100.0
d1ug6a_ 426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 100.0
d1qvba_ 481 beta-Glycosidase {Archaeon Thermosphaera aggregans 100.0
d1uwsa_ 489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 100.0
d1vffa1 423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 100.0
d1qvba_481 beta-Glycosidase {Archaeon Thermosphaera aggregans 99.8
d1wcga1462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 99.8
d1e4ia_447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 99.79
d1qoxa_449 Beta-glucosidase A {Bacillus circulans, subsp. alk 99.79
d1vffa1423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 99.78
d2j78a1443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 99.78
d1pbga_468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 99.78
d1gnxa_464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 99.77
d1uwsa_489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 99.77
d1kwga2 393 A4 beta-galactosidase {Thermus thermophilus [TaxId 99.75
d1ug6a_426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 99.73
d1v02a_484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 99.73
d1e4mm_499 Plant beta-glucosidase (myrosinase) {White mustard 99.72
d1cbga_490 Plant beta-glucosidase (myrosinase) {Creeping whit 99.72
d1uuqa_ 410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 98.85
d1edga_ 380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 98.67
d1vjza_ 325 Endoglucanase homologue TM1752 {Thermotoga maritim 98.5
d1ceoa_ 340 Endoglucanase CelC {Clostridium thermocellum [TaxI 98.49
d1tg7a5 354 Beta-galactosidase LacA, N-terminal domain {Penici 98.3
d1h1na_ 305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 97.8
d1rh9a1 370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 97.77
d2pb1a1 394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 97.57
d1vema2 417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 97.45
d1h4pa_ 408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 97.29
d1ecea_ 358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 97.1
d1wkya2 297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 96.93
d1n82a_ 330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 96.91
d1ur4a_ 387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 96.9
d2c0ha1 350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 96.75
d1hjsa_ 332 Beta-1,4-galactanase {Thielavia heterothallica, ak 96.63
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 96.26
d1bqca_ 302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 96.09
d1qnra_ 344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 95.78
d1foba_ 334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 95.36
d7a3ha_ 300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 94.97
d1nq6a_ 302 Xylanase A, catalytic core {Streptomyces halstedii 94.53
d1uhva2 346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 94.53
d1g01a_ 357 Alkaline cellulase K catalytic domain {Bacillus sp 94.4
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 94.3
d1xyza_ 320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 93.74
d1ur1a_ 350 Xylanase {Cellvibrio mixtus [TaxId: 39650]} 93.2
d1fa2a_ 498 beta-Amylase {Sweet potato (Ipomoea batatas) [TaxI 92.18
d1kwga2393 A4 beta-galactosidase {Thermus thermophilus [TaxId 92.02
d1r85a_ 371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 91.39
d1wdpa1 490 beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} 90.89
d1b1ya_ 500 beta-Amylase {Barley (Hordeum vulgare) [TaxId: 451 90.56
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 90.35
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 89.23
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 88.87
d1us3a2 364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 88.69
d2vzsa5 339 Exochitosanase CsxA {Amycolatopsis orientalis [Tax 88.54
d1ta3b_ 301 Xylanase A, catalytic core {Emericella nidulans (A 85.66
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 85.17
d1vbua1 324 Xylanase {Thermotoga maritima [TaxId: 2336]} 83.97
d1fh9a_ 312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 82.25
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Family 1 of glycosyl hydrolase
domain: Plant beta-glucosidase (myrosinase)
species: Sorghum bicolor [TaxId: 4558]
Probab=100.00  E-value=8.8e-58  Score=476.05  Aligned_cols=192  Identities=48%  Similarity=0.917  Sum_probs=176.4

Q ss_pred             ccCCCCCCCceehhhhhhhhhcCccCCCCCCCceeeecccC--Cccc--CCCCccccccccChHHHHHHHHcCCCeeeec
Q 011733          261 YTKNDFPPGFIFGSGTSAYQVEGAANEDGRTPSIWDTFAHA--GNVL--GNGDIACDEYHKYKEDVKLMAKTGLDAYRFS  336 (478)
Q Consensus       261 ~~~~~FP~~FlwG~AtSA~QvEGa~~~~Grg~SiWD~~~~~--~~~~--~~gdvA~D~Y~rykeDi~Lmk~lGvnayRFS  336 (478)
                      ..+..||++|+||+|||||||||++++|||++|+||.|+|.  +.+.  .++++||||||||+|||+||++||+|+||||
T Consensus         8 ~~~~~FP~~FlwG~Atsa~Q~EG~~~~~gkg~s~wd~~~~~~~~~~~~~~~~~~a~d~y~ry~eDi~l~~~lG~~~yRfS   87 (484)
T d1v02a_           8 PRRDWFPPSFLFGAATSAYQIEGAWNEDGKGPSTWDHFCHNFPEWIVDRSNGDVAADSYHMYAEDVRLLKEMGMDAYRFS   87 (484)
T ss_dssp             CCGGGSCTTCEEEEECCHHHHCCCTTSTTCCCBHHHHHHHHCGGGSTTSCCSSSTTCHHHHHHHHHHHHHHTTCSEEEEE
T ss_pred             CccccCCCCCeEeEEchHHHhCcCcCCCCCCccHHHHhhccCCCcccCCCCCCcccchhhhhHHHHHHHHHhCCCEEEcc
Confidence            34567999999999999999999999999999999999985  2222  4689999999999999999999999999999


Q ss_pred             cccceeecCCC--CCCChhHHHHHHHHHHHHHHCCCcceEeeccCCCCcccccccCCCccceee----------------
Q 011733          337 ISWSRLIPNGR--GPVNPKGLQYYNNLINELISYGIQPHVTLHHSDLPQALEDEYGGWINRMIV----------------  398 (478)
Q Consensus       337 IsWsRI~P~G~--G~vN~egv~~Y~~lId~L~~~GIeP~VTL~H~dlP~wL~d~yGGW~n~~iv----------------  398 (478)
                      ||||||+|+|+  |.+|++|++||+++|++|+++||+|+|||+|||+|+||++++|||+|++++                
T Consensus        88 isWsRI~P~g~~~g~~n~~gl~~Y~~~id~l~~~GI~P~vTL~Hfd~P~~l~~~~Ggw~n~~~~~~F~~Ya~~v~~~fgd  167 (484)
T d1v02a_          88 ISWPRILPKGTLAGGINEKRVEYYNKLIDLLLENGIEPYITIFHWDTPQALVDAYGGFLDERIIKDYTDFAKVCFEKFGK  167 (484)
T ss_dssp             CCHHHHSTTSSSTTCCCHHHHHHHHHHHHHHHHTTCEEEEEEESSCCBHHHHHHHCGGGSTHHHHHHHHHHHHHHHHHTT
T ss_pred             CCHHHcCCCCCCCCCCCHHHHHHHHHHHHHHHHcCCeEEEEecCCcccceeeeecCcccCHHHHHHHHHhhHHHHHHhcc
Confidence            99999999984  899999999999999999999999999999999999999999999999874                


Q ss_pred             --------------------------------------------------------------------------------
Q 011733          399 --------------------------------------------------------------------------------  398 (478)
Q Consensus       399 --------------------------------------------------------------------------------  398 (478)
                                                                                                      
T Consensus       168 ~V~~W~T~NEP~~~~~~~y~~g~~~pg~~~~~~~~~~~~~~~~~~~~~~~hn~l~AHa~a~~~~~~~~~~~~~~ig~~~~  247 (484)
T d1v02a_         168 TVKNWLTFNEPETFCSVSYGTGVLAPGRCSPGVSCAVPTGNSLSEPYIVAHNLLRAHAETVDIYNKYHKGADGRIGLALN  247 (484)
T ss_dssp             TCCEEEEEECHHHHHHHHHTSCCSTTCBCCTTSCSSBCSSCTTTHHHHHHHHHHHHHHHHHHHHHHHTCTTTCEEEEEEE
T ss_pred             hhhceEEecCcceecccccccceecccccCccccccCcccccHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCceeeEec
Confidence                                                                                            


Q ss_pred             ---------------------------ecCCcccCCchHHhhhhhCCCCCccchhhhhhhcccccceeeccceeeeeecC
Q 011733          399 ---------------------------VANPLVYGDYPKIMKQNAGSRLPAFTDHESQQIKGSADFIGVINYYTVYIKDN  451 (478)
Q Consensus       399 ---------------------------~~~P~~fgdYp~~m~~~~GdRLP~FT~eE~~~lkGS~DF~gln~Y~t~y~~~~  451 (478)
                                                 +++|+..|+||..|+..+++++|.|++++.+.++|++||+|||+|++.+++..
T Consensus       248 ~~~~~p~~~~~~d~~aa~~~~~~~~~~f~d~~~~G~YP~~~~~~~~~~~p~~~~~~~~~i~~~~DFlGiNyYt~~~v~~~  327 (484)
T d1v02a_         248 VFGRVPYTNTFLDQQAQERSMDKCLGWFLEPVVRGDYPFSMRVSARDRVPYFKEKEQEKLVGSYDMIGINYYTSTFSKHI  327 (484)
T ss_dssp             CCEEEESSSSHHHHHHHHHHHHHHHHHHHHHHHHSSCCHHHHHHHGGGSCCCCHHHHHHHTTCCSEEEEECCCEEEEEEC
T ss_pred             ccceecCCCchHHHHHHHHHHHHHhhhhhHHHhCCCCCHHHHhhhhhcCcccchhhHHHhhcCCCccccccceeEEEecc
Confidence                                       13566689999999999999999999999999999999999999999898864


Q ss_pred             C
Q 011733          452 P  452 (478)
Q Consensus       452 ~  452 (478)
                      +
T Consensus       328 ~  328 (484)
T d1v02a_         328 D  328 (484)
T ss_dssp             C
T ss_pred             C
Confidence            3



>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1fa2a_ c.1.8.1 (A:) beta-Amylase {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1wdpa1 c.1.8.1 (A:6-495) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1b1ya_ c.1.8.1 (A:) beta-Amylase {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure