Citrus Sinensis ID: 011737

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48

MNHEIESEICEISVDPVKVANGEVDDDGRSRRTGTVWTASAHIITAIVGSGVLSLAWGLAQLGWIIGIATLVIFSGISLYTSGLLAECYRAPNSVKRNYTYRDAVKNYLGGRKYKALGLVQYTLLCGAMVGYTITASISMVAISKSNCYHKEGHKAPCKYSYNPYMMALGIVEILLSQIPNFHKLSWLSTIAASMSFSYAGIGMGLSFAKIVSGHGEKTTLTGVEIGLDLTAADKTWRIFQAIGNMAFACSYAAILIEIQDTLKSSPPEQEVMKKANTIATFTATTLYLMCGCLGYAALGNHAQGNILTGFGFYEPFWLIDLANFFIVVHLLGAYQVLAQPVFGVVESWAGNRWPKSKFINDEHHLGIGKNNSKFSVNFFRLIWRTAFVAMATLISMAFPFFNEVLAFLGAIAYWPMTVYFPMEMYIVRKEIKRGTICWFGLHLVNLVCLLAALAAGCGSIQGVNQALHTYKLFKFTQ

cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHcccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHEEEEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHccccccccccccEEEEEHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc

********************************TGTVWTASAHIITAIVGSGVLSLAWGLAQLGWIIGIATLVIFSGISLYTSGLLAECYRAPNSVKRNYTYRDAVKNYLGGRKYKALGLVQYTLLCGAMVGYTITASISMVAISKSNCYHKEGHKAPCKYSYNPYMMALGIVEILLSQIPNFHKLSWLSTIAASMSFSYAGIGMGLSFAKIVSGHGEKTTLTGVEIGLDLTAADKTWRIFQAIGNMAFACSYAAILIEIQDTLKS*PP**EVMKKANTIATFTATTLYLMCGCLGYAALGNHAQGNILTGFGFYEPFWLIDLANFFIVVHLLGAYQVLAQPVFGVVESWAGNRWPKSKFINDEHHLGIGKNNSKFSVNFFRLIWRTAFVAMATLISMAFPFFNEVLAFLGAIAYWPMTVYFPMEMYIVRKEIKRGTICWFGLHLVNLVCLLAALAAGCGSIQGVNQALHTYKLFKFT*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Amino acid permease 8	Amino acid-proton symporter. Stereospecific transporter with a broad specificity for glutamate, aspartate and neutral and acidic amino acids.	probable	O80592

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:confident
Coverage over the Query: 31-222,238-434
View the alignment between query and template
View the model in PyMOL

Template: 2A65, chain A
Confidence level:probable
Coverage over the Query: 35-302
View the alignment between query and template
View the model in PyMOL