Citrus Sinensis ID: 011758

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48

MVAKGRQNSTDSPRAEVGEIDTSAPFQSVKDAVTLFGEGAFSGEKPSIRKPKPHSAERVLAKETQLHLAQRELNKLKDQLKNAEDTKAQAFVELEKAKRTVEDLSHKLKVVIESKESAIKVTEAAKIQAKQIEESNCSNPSGSDGARNQDLETEREKYTSVFSELAAAKQELRKIHQDCNSTLEAKVTAFNLAAAAENSAKANMERVSELSKEISTVQESIGQVKLATMQAQQEQAKVFAEKDLQRQSYKATLEESAKKLLALRNQFDPQLTQNLETQLTETMSEIAALQKQLENAKASDLDSVRIVTSELDDAKGSLQKVAEEESSLRNLVESLKVELENVKKEHSELKEKEAETESIAGNLHVLLQKTKSELEACVVEEAKIRGASEEMISSLHQLSLETENARQEAEEMKNKAMELKEEAGATKIALEEAEKKLRAALEEAEEAKGAETRALDRLRRCLRELVLHVHLLLNLVPI

ccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc

************************PFQSVKDA***************************************************************************LKVVI**************************************************************IHQDCNSTLEAKVTAFNLA************************************************************************************************************************************************************************NLHVLLQKTKSELEACVVE**************************************************************************LDRLRRCLRELVLHVHLLLNLVPI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVAKGRQNSTDSPRAEVGEIDTSAPFQSVKDAVTLFGEGAFSGEKPSIRKPKPHSAERxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKESAIKVTEAAKIQAKQIEESNCSNPSGSDGARNQDLETEREKYTSVFSELAAAKQELRKIHQDCNSTLEAKVTAFNLxxxxxxxxxxxxxxxxxxxxxISTVQESIGQVKLATMQAQQEQAKVFAEKDLQxxxxxxxxxxxxxxxxxxxxxFDPQLxxxxxxxxxxxxxxxxxxxxxxxxxxxxDLDSVRIVTSELDDAKGSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAGNLHVLLQKTKSELEACVVEEAKIRGASEEMISSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLRELVLHVHLLLNLVPI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
WEB family protein At5g55860		probable	Q9LVQ4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1C1G, chain A
Confidence level:confident
Coverage over the Query: 150-162
View the alignment between query and template
View the model in PyMOL

Template: 3O0Z, chain A
Confidence level:probable
Coverage over the Query: 307-434
View the alignment between query and template
View the model in PyMOL

Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 245-291,303-378
View the alignment between query and template
View the model in PyMOL

Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 147-183,194-227
View the alignment between query and template
View the model in PyMOL

Template: 1G8X, chain A
Confidence level:probable
Coverage over the Query: 242-446
View the alignment between query and template
View the model in PyMOL

Template: 2XS1, chain A
Confidence level:probable
Coverage over the Query: 54-448
View the alignment between query and template
View the model in PyMOL