Citrus Sinensis ID: 011764

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
MGRWCFGGFLNISLVVLLLLVSRSNVVYVAAFPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPGCSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD
cccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEccccccEEEEEEEEEEccccccccEEEEEcccccHHHHHHHHHHHccccEEccccccccccccccccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHHHcccccccccEEEEEEEcccccccccccHHHHHHHHcccccHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccccccccccccccHHHHHccHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHccccEEEcccccEEccEEccEEEEEcccEEEEEEccccccccccccHHHHHHHHHHHccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHEcccccccccccccEEEEEEEEEccccEEEEEEEEcccHHHccccEEEEEcccccEcccccHHHHccccEEEcHHHccEEEccccHHHccEEEEEcccccccccEEccHHHHcccHHHHHHHHHHHHHHHHHHcHHHcccEEEEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccccccccccHHHHHHHHHHHcHHHHHHHHHHccccccEccccccccHHHHHHHHHHHHHHccccccEEEEcccccccHHHHHHcccccccccccccccccHHHHHHHHccHHHHHHHcccccccccccccccccccccccccccEcHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHccHHHcccccEcccEEEEEcccEEEEEEEEcccEEEEEEccccccHHHHcHHHHHHHHHHHHHcccccccccccccc
mgrwcfggfLNISLVVLLLLVSRsnvvyvaafpaedlvvslpgqpkvafrqyagyvdvdvkngRSLFYYFVEaevephekpltlwlnggpgcssvgggaftelgpfyprgdgrglrrnsmswnkasnllfvespagvgwsysnttsdyncgdastaRDMHVFMMNWYekfpefksrelfltgesyaghyipQLADVLLdhnahskgfkfnikgvaignpllrldqdvpaIYEFFWshgmisdeigltimsdcdfddyvsgtshnmTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHAnrtnlpygwsmcsgvlnysdtdsniniLPVLKRIIQngipvwvfsgdqdsvvpllgsRTLIRELARDLNfevtvpygawfhkqqvggwgteygNLLTFVTVRGaahmvpyaqpsralhlfssfvhgrrlpnntrpaiqd
MGRWCFGGFLNISLVVLLLLVSRSNVVYVAAFPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPGCSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSfvhgrrlpnntrpaiqd
MGRWCFGGFlnislvvllllvsrsnvvyvAAFPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNggpgcssvgggAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD
**RWCFGGFLNISLVVLLLLVSRSNVVYVAAFPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPGCSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHG*************
******GGFLNISLVVLLLLVSRSNVVYVAAFPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPGCSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIV*************SVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHG*************
MGRWCFGGFLNISLVVLLLLVSRSNVVYVAAFPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPGCSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD
*GRWCFGGFLNISLVVLLLLVSRSNVVYVAAFPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPGCSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRR***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRWCFGGFLNISLVVLLLLVSRSNVVYVAAFPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPGCSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query478 2.2.26 [Sep-21-2011]
Q9FH05473 Serine carboxypeptidase-l yes no 0.943 0.953 0.769 0.0
Q9MAR8479 Serine carboxypeptidase-l no no 0.991 0.989 0.711 0.0
Q9FH06469 Serine carboxypeptidase-l no no 0.945 0.963 0.714 0.0
Q84W27442 Serine carboxypeptidase-l no no 0.889 0.961 0.678 0.0
Q8VY01465 Serine carboxypeptidase-l no no 0.901 0.926 0.479 1e-120
Q93Y09461 Serine carboxypeptidase-l no no 0.889 0.921 0.484 1e-118
Q0WRX3502 Serine carboxypeptidase-l no no 0.876 0.834 0.433 3e-99
Q8L9Y0473 Serine carboxypeptidase-l no no 0.884 0.894 0.432 5e-98
P52711516 Serine carboxypeptidase I N/A no 0.874 0.810 0.453 1e-96
Q0WPR4499 Serine carboxypeptidase-l no no 0.893 0.855 0.408 2e-95
>sp|Q9FH05|SCP42_ARATH Serine carboxypeptidase-like 42 OS=Arabidopsis thaliana GN=SCPL42 PE=2 SV=1 Back     alignment and function desciption
 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/451 (76%), Positives = 390/451 (86%)

Query: 28  YVAAFPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLN 87
           +   +P EDLVV LPGQP V F+QYAGYVDVDVK GRSLFYY+VEA  +P  KPLTLWLN
Sbjct: 23  FAKGYPEEDLVVRLPGQPTVGFKQYAGYVDVDVKAGRSLFYYYVEAVKQPDSKPLTLWLN 82

Query: 88  GGPGCSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSD 147
           GGPGCSS+GGGAFTELGPFYP GDGRGLR NSMSWNKAS+LLFVESPAGVGWSYSN +SD
Sbjct: 83  GGPGCSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASHLLFVESPAGVGWSYSNKSSD 142

Query: 148 YNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGF 207
           YN GD STA DM VF++ W+EKFP+ KSR+LFLTGESYAGHYIPQLAD +L +N+HS GF
Sbjct: 143 YNTGDKSTANDMLVFLLRWFEKFPKLKSRDLFLTGESYAGHYIPQLADAILSYNSHSSGF 202

Query: 208 KFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTN 267
           KFNIKGVAIGNPLL+LD+D PA YEFFWSHGMISDE+ LTI S CDFDDY   + HN++ 
Sbjct: 203 KFNIKGVAIGNPLLKLDRDSPATYEFFWSHGMISDELKLTITSQCDFDDYTFASPHNVST 262

Query: 268 SCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFY 327
           +C EAI+E   I+ +Y+NNYDV+LDVCYP+IV+QELRL+KMATKMS+GVDVCMT ER FY
Sbjct: 263 ACNEAISETENIITEYVNNYDVLLDVCYPSIVQQELRLKKMATKMSMGVDVCMTYERRFY 322

Query: 328 LNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQ 387
            NLPEVQKALHANRT+LPY WSMCSGVLNYSD D NI++LP+LKRII N  P+W+FSGDQ
Sbjct: 323 FNLPEVQKALHANRTHLPYSWSMCSGVLNYSDIDGNIDMLPILKRIILNKTPIWIFSGDQ 382

Query: 388 DSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMV 447
           DSVVP  GSRTL+RELA+DLNF+ TVPYGAWFHK QVGGW  EYG LLTF TVRGAAHMV
Sbjct: 383 DSVVPFGGSRTLVRELAQDLNFKTTVPYGAWFHKSQVGGWAIEYGKLLTFATVRGAAHMV 442

Query: 448 PYAQPSRALHLFSSFVHGRRLPNNTRPAIQD 478
           PYAQPSRALHLFSSFV GRRLPNNT  +  +
Sbjct: 443 PYAQPSRALHLFSSFVSGRRLPNNTHSSTDE 473
Probable carboxypeptidase.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: -
>sp|Q9MAR8|SCP44_ARATH Serine carboxypeptidase-like 44 OS=Arabidopsis thaliana GN=SCPL44 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH06|SCP41_ARATH Serine carboxypeptidase-like 41 OS=Arabidopsis thaliana GN=SCPL41 PE=2 SV=1 Back     alignment and function description
>sp|Q84W27|SCP43_ARATH Serine carboxypeptidase-like 43 OS=Arabidopsis thaliana GN=SCPL43 PE=2 SV=1 Back     alignment and function description
>sp|Q8VY01|SCP46_ARATH Serine carboxypeptidase-like 46 OS=Arabidopsis thaliana GN=SCPL46 PE=2 SV=1 Back     alignment and function description
>sp|Q93Y09|SCP45_ARATH Serine carboxypeptidase-like 45 OS=Arabidopsis thaliana GN=SCPL45 PE=2 SV=1 Back     alignment and function description
>sp|Q0WRX3|SCP40_ARATH Serine carboxypeptidase-like 40 OS=Arabidopsis thaliana GN=SCPL40 PE=2 SV=2 Back     alignment and function description
>sp|Q8L9Y0|SCP25_ARATH Serine carboxypeptidase-like 25 OS=Arabidopsis thaliana GN=SCPL25 PE=2 SV=2 Back     alignment and function description
>sp|P52711|CBP23_HORVU Serine carboxypeptidase II-3 OS=Hordeum vulgare GN=CXP;2-3 PE=2 SV=1 Back     alignment and function description
>sp|Q0WPR4|SCP34_ARATH Serine carboxypeptidase-like 34 OS=Arabidopsis thaliana GN=SCPL34 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query478
356552779474 PREDICTED: serine carboxypeptidase-like 0.989 0.997 0.797 0.0
356518599456 PREDICTED: serine carboxypeptidase-like 0.947 0.993 0.823 0.0
356507606455 PREDICTED: serine carboxypeptidase-like 0.947 0.995 0.825 0.0
224062940480 predicted protein [Populus trichocarpa] 0.979 0.975 0.801 0.0
255570400476 serine carboxypeptidase, putative [Ricin 0.991 0.995 0.779 0.0
225457767467 PREDICTED: serine carboxypeptidase-like 0.976 1.0 0.788 0.0
357491047470 Serine carboxypeptidase-like protein [Me 0.970 0.987 0.788 0.0
297795323473 hypothetical protein ARALYDRAFT_494806 [ 0.943 0.953 0.773 0.0
15238328473 serine carboxypeptidase-like 42 [Arabido 0.943 0.953 0.769 0.0
449462196480 PREDICTED: serine carboxypeptidase-like 0.947 0.943 0.772 0.0
>gi|356552779|ref|XP_003544740.1| PREDICTED: serine carboxypeptidase-like 42-like isoform 1 [Glycine max] Back     alignment and taxonomy information
 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/479 (79%), Positives = 416/479 (86%), Gaps = 6/479 (1%)

Query: 1   MGR-WCFGGFLNISLVVLLLLVSRSNVVYVAAFPAEDLVVSLPGQPKVAFRQYAGYVDVD 59
           MGR W  G  + +     L       V  V  +PAEDLVV LPGQPKV F+Q+AGYVDVD
Sbjct: 1   MGRCWLVGVIIVVGCASFL-----GTVGVVEGYPAEDLVVKLPGQPKVGFKQFAGYVDVD 55

Query: 60  VKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPGCSSVGGGAFTELGPFYPRGDGRGLRRNS 119
            K+GRSLFYYFVEAE +PH+KPLTLWLNGGPGCSS+GGGAFTELGPFYP+GDGRGLRRNS
Sbjct: 56  AKHGRSLFYYFVEAEQDPHKKPLTLWLNGGPGCSSIGGGAFTELGPFYPKGDGRGLRRNS 115

Query: 120 MSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELF 179
           MSWNKASNLLFVESPAGVGWSYSNTTSDYN GDASTA DM++FM+ WYEKFP + +RELF
Sbjct: 116 MSWNKASNLLFVESPAGVGWSYSNTTSDYNSGDASTANDMYLFMLKWYEKFPSYITRELF 175

Query: 180 LTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGM 239
           LTGESYAGHYIPQL +VLLDHNA S G KFNIKGVAIGNPLLRLD+D PAIYE+FWSHGM
Sbjct: 176 LTGESYAGHYIPQLTNVLLDHNARSTGSKFNIKGVAIGNPLLRLDRDAPAIYEYFWSHGM 235

Query: 240 ISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIV 299
           ISDEIGL IM+DCDFDDYV  + HN++  C  AI EAN IVGDYINNYDVILDVCY +I+
Sbjct: 236 ISDEIGLAIMNDCDFDDYVYASPHNVSQLCNNAIYEANLIVGDYINNYDVILDVCYTSIM 295

Query: 300 EQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSD 359
           EQELRL++MATK+SV VDVCMTLER FY NLPEVQKALHANRTNLPY WSMCS VLNY D
Sbjct: 296 EQELRLKRMATKISVSVDVCMTLERRFYFNLPEVQKALHANRTNLPYSWSMCSHVLNYRD 355

Query: 360 TDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWF 419
           TD NINILP+LKRI+QN IPVWVFSGDQDSVVPLLGSRTLIRELA +L F++TVPYGAWF
Sbjct: 356 TDGNINILPILKRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHELQFKITVPYGAWF 415

Query: 420 HKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD 478
           HK QVGGW TEYGNLLTF TVRGAAHMVPYAQPSRALHLFSSFV GRRLPN TRP+I +
Sbjct: 416 HKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNTTRPSIDE 474

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356518599|ref|XP_003527966.1| PREDICTED: serine carboxypeptidase-like 42-like [Glycine max] Back     alignment and taxonomy information
>gi|356507606|ref|XP_003522555.1| PREDICTED: serine carboxypeptidase-like 42-like [Glycine max] Back     alignment and taxonomy information
>gi|224062940|ref|XP_002300939.1| predicted protein [Populus trichocarpa] gi|222842665|gb|EEE80212.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255570400|ref|XP_002526159.1| serine carboxypeptidase, putative [Ricinus communis] gi|223534536|gb|EEF36235.1| serine carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225457767|ref|XP_002278193.1| PREDICTED: serine carboxypeptidase-like 42 [Vitis vinifera] gi|302142765|emb|CBI19968.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357491047|ref|XP_003615811.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355517146|gb|AES98769.1| Serine carboxypeptidase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297795323|ref|XP_002865546.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. lyrata] gi|297311381|gb|EFH41805.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15238328|ref|NP_199039.1| serine carboxypeptidase-like 42 [Arabidopsis thaliana] gi|75170531|sp|Q9FH05.1|SCP42_ARATH RecName: Full=Serine carboxypeptidase-like 42; Flags: Precursor gi|13605557|gb|AAK32772.1|AF361604_1 AT5g42240/K5J14_4 [Arabidopsis thaliana] gi|10177009|dbj|BAB10197.1| serine carboxypeptidase II-like [Arabidopsis thaliana] gi|23505957|gb|AAN28838.1| At5g42240/K5J14_4 [Arabidopsis thaliana] gi|332007403|gb|AED94786.1| serine carboxypeptidase-like 42 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449462196|ref|XP_004148827.1| PREDICTED: serine carboxypeptidase-like 42-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query478
TAIR|locus:2157622473 scpl42 "serine carboxypeptidas 0.935 0.945 0.753 1.1e-190
TAIR|locus:2029127479 scpl44 "serine carboxypeptidas 0.935 0.933 0.718 4.1e-184
TAIR|locus:2157612469 scpl41 "serine carboxypeptidas 0.935 0.953 0.695 2e-175
TAIR|locus:2051149465 scpl46 "serine carboxypeptidas 0.897 0.922 0.458 3.6e-105
TAIR|locus:2060774443 SCPL43 "serine carboxypeptidas 0.566 0.611 0.689 1.6e-104
TAIR|locus:2010454461 SCPL45 "serine carboxypeptidas 0.889 0.921 0.463 6.7e-104
TAIR|locus:2087368502 scpl40 "serine carboxypeptidas 0.880 0.838 0.416 4.1e-88
TAIR|locus:2078598473 scpl25 "serine carboxypeptidas 0.876 0.885 0.423 5.4e-86
TAIR|locus:2181504480 scpl35 "serine carboxypeptidas 0.889 0.885 0.391 2.1e-84
TAIR|locus:2008480463 SCPL32 "serine carboxypeptidas 0.876 0.904 0.399 3.4e-84
TAIR|locus:2157622 scpl42 "serine carboxypeptidase-like 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1848 (655.6 bits), Expect = 1.1e-190, P = 1.1e-190
 Identities = 337/447 (75%), Positives = 378/447 (84%)

Query:    32 FPAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNXXXX 91
             +P EDLVV LPGQP V F+QYAGYVDVDVK GRSLFYY+VEA  +P  KPLTLWLN    
Sbjct:    27 YPEEDLVVRLPGQPTVGFKQYAGYVDVDVKAGRSLFYYYVEAVKQPDSKPLTLWLNGGPG 86

Query:    92 XXXXXXXAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG 151
                    AFTELGPFYP GDGRGLR NSMSWNKAS+LLFVESPAGVGWSYSN +SDYN G
Sbjct:    87 CSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASHLLFVESPAGVGWSYSNKSSDYNTG 146

Query:   152 DASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNI 211
             D STA DM VF++ W+EKFP+ KSR+LFLTGESYAGHYIPQLAD +L +N+HS GFKFNI
Sbjct:   147 DKSTANDMLVFLLRWFEKFPKLKSRDLFLTGESYAGHYIPQLADAILSYNSHSSGFKFNI 206

Query:   212 KGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIE 271
             KGVAIGNPLL+LD+D PA YEFFWSHGMISDE+ LTI S CDFDDY   + HN++ +C E
Sbjct:   207 KGVAIGNPLLKLDRDSPATYEFFWSHGMISDELKLTITSQCDFDDYTFASPHNVSTACNE 266

Query:   272 AITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLP 331
             AI+E   I+ +Y+NNYDV+LDVCYP+IV+QELRL+KMATKMS+GVDVCMT ER FY NLP
Sbjct:   267 AISETENIITEYVNNYDVLLDVCYPSIVQQELRLKKMATKMSMGVDVCMTYERRFYFNLP 326

Query:   332 EVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVV 391
             EVQKALHANRT+LPY WSMCSGVLNYSD D NI++LP+LKRII N  P+W+FSGDQDSVV
Sbjct:   327 EVQKALHANRTHLPYSWSMCSGVLNYSDIDGNIDMLPILKRIILNKTPIWIFSGDQDSVV 386

Query:   392 PLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQ 451
             P  GSRTL+RELA+DLNF+ TVPYGAWFHK QVGGW  EYG LLTF TVRGAAHMVPYAQ
Sbjct:   387 PFGGSRTLVRELAQDLNFKTTVPYGAWFHKSQVGGWAIEYGKLLTFATVRGAAHMVPYAQ 446

Query:   452 PSRALHLFSSFVHGRRLPNNTRPAIQD 478
             PSRALHLFSSFV GRRLPNNT  +  +
Sbjct:   447 PSRALHLFSSFVSGRRLPNNTHSSTDE 473
GO:0004185 "serine-type carboxypeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0005618 "cell wall" evidence=IDA
TAIR|locus:2029127 scpl44 "serine carboxypeptidase-like 44" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157612 scpl41 "serine carboxypeptidase-like 41" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051149 scpl46 "serine carboxypeptidase-like 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060774 SCPL43 "serine carboxypeptidase-like 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010454 SCPL45 "serine carboxypeptidase-like 45" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087368 scpl40 "serine carboxypeptidase-like 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078598 scpl25 "serine carboxypeptidase-like 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181504 scpl35 "serine carboxypeptidase-like 35" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008480 SCPL32 "serine carboxypeptidase-like 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P10619PPGB_HUMAN3, ., 4, ., 1, 6, ., 50.31440.85770.8541yesno
P16675PPGB_MOUSE3, ., 4, ., 1, 6, ., 50.31390.87230.8797yesno
Q3MI05PPGB_BOVIN3, ., 4, ., 1, 6, ., 50.31230.86610.8643yesno
Q9FH06SCP41_ARATH3, ., 4, ., 1, 6, ., -0.71460.94560.9637nono
Q9MAR8SCP44_ARATH3, ., 4, ., 1, 6, ., -0.71180.99160.9895nono
Q9FH05SCP42_ARATH3, ., 4, ., 1, 6, ., -0.76940.94350.9534yesno
Q09991YSS2_CAEEL3, ., 4, ., 1, 6, ., -0.31850.90370.9191yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.16.6LOW CONFIDENCE prediction!
3rd Layer3.4.160.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
pfam00450415 pfam00450, Peptidase_S10, Serine carboxypeptidase 1e-170
PLN03016433 PLN03016, PLN03016, sinapoylglucose-malate O-sinap 5e-46
PLN02209437 PLN02209, PLN02209, serine carboxypeptidase 2e-45
COG2939498 COG2939, COG2939, Carboxypeptidase C (cathepsin A) 7e-44
PTZ00472462 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) 2e-43
PLN02213319 PLN02213, PLN02213, sinapoylglucose-malate O-sinap 1e-26
>gnl|CDD|215926 pfam00450, Peptidase_S10, Serine carboxypeptidase Back     alignment and domain information 
 Score =  484 bits (1249), Expect = e-170
 Identities = 172/422 (40%), Positives = 233/422 (55%), Gaps = 20/422 (4%)

Query: 49  FRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPGCSSVGGGAFTELGPFYP 108
           F+QY+GY+ VD   GRSLFY+F E+E  P   PL LWLNGGPGCSS+GG  F ELGPF  
Sbjct: 9   FKQYSGYLTVDESAGRSLFYWFFESENNPENDPLVLWLNGGPGCSSLGG-LFEELGPFRV 67

Query: 109 RGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYE 168
              G  L  N  SWNK +N+LF++ P GVG+SYSNTTSDY   D  TA+D + F+  ++E
Sbjct: 68  -NSGPTLYLNPYSWNKVANVLFLDQPVGVGFSYSNTTSDYKTDDEETAKDNYEFLQKFFE 126

Query: 169 KFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVP 228
           KFPE+K+   ++ GESYAGHY+P LA  +LD N    G   N+KGV IGN L        
Sbjct: 127 KFPEYKNNPFYIAGESYAGHYVPALAQEILDGNKKGTGPNINLKGVLIGNGLTDPAIQYN 186

Query: 229 AIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDY--INN 286
           +   F + HG+ISDE+  ++   C                C+  + EA+        IN 
Sbjct: 187 SYIPFAYYHGLISDELYESLKKACCGKYP---DCDPANTKCLNLVEEASGCNAYNGGINP 243

Query: 287 YDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPY 346
           Y++    CY +     L L   +T    G D         YLN P+V+KALHAN      
Sbjct: 244 YNIYTPCCYNSS----LSLNPSSTDSCGGYDCYDESYVEKYLNRPDVRKALHAN-KGSVG 298

Query: 347 GWSMCSG-VLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELAR 405
            WS C+  V N+   D + ++LP+L ++++ G+ V ++SGD D +   LG++  I     
Sbjct: 299 EWSRCNDEVFNWYGDDISKSMLPILPKLLEGGLRVLIYSGDHDLICNFLGTQAWIDA--- 355

Query: 406 DLNFEVTVPYGAWFHK--QQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFV 463
            LN+     +  W+     QV G+   YGN LTF TV+GA HMVP  QP  AL +F  F+
Sbjct: 356 -LNWSGKDGFRPWYVSVDGQVAGYVKSYGN-LTFATVKGAGHMVPEDQPEAALQMFKRFL 413

Query: 464 HG 465
            G
Sbjct: 414 SG 415

Length = 415
>gnl|CDD|178590 PLN03016, PLN03016, sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>gnl|CDD|177859 PLN02209, PLN02209, serine carboxypeptidase Back     alignment and domain information
>gnl|CDD|225490 COG2939, COG2939, Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>gnl|CDD|165857 PLN02213, PLN02213, sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 478
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 100.0
PLN02209437 serine carboxypeptidase 100.0
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 100.0
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 100.0
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 100.0
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 100.0
COG2939498 Carboxypeptidase C (cathepsin A) [Amino acid trans 100.0
KOG1283414 consensus Serine carboxypeptidases [Posttranslatio 100.0
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.24
PRK00870302 haloalkane dehalogenase; Provisional 99.16
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.13
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.11
PLN02824294 hydrolase, alpha/beta fold family protein 99.08
PRK03204286 haloalkane dehalogenase; Provisional 99.07
PHA02857276 monoglyceride lipase; Provisional 99.04
PRK10673255 acyl-CoA esterase; Provisional 98.99
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 98.92
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 98.88
PLN02298330 hydrolase, alpha/beta fold family protein 98.86
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 98.85
PLN02679360 hydrolase, alpha/beta fold family protein 98.84
PRK03592295 haloalkane dehalogenase; Provisional 98.84
PLN02385349 hydrolase; alpha/beta fold family protein 98.84
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 98.82
PLN02578354 hydrolase 98.77
PRK10349256 carboxylesterase BioH; Provisional 98.75
PRK06489360 hypothetical protein; Provisional 98.75
PLN03084383 alpha/beta hydrolase fold protein; Provisional 98.74
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 98.72
PLN02894402 hydrolase, alpha/beta fold family protein 98.71
PLN02652395 hydrolase; alpha/beta fold family protein 98.65
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 98.64
PRK10749330 lysophospholipase L2; Provisional 98.6
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 98.59
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 98.58
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 98.57
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 98.54
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 98.52
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 98.44
PLN02965255 Probable pheophorbidase 98.42
PRK08775343 homoserine O-acetyltransferase; Provisional 98.41
PRK07581339 hypothetical protein; Validated 98.37
PLN02511388 hydrolase 98.37
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 98.27
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 98.12
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 98.11
PRK00175379 metX homoserine O-acetyltransferase; Provisional 98.07
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 97.98
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 97.89
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 97.88
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 97.88
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 97.8
COG2267298 PldB Lysophospholipase [Lipid metabolism] 97.66
PLN02872395 triacylglycerol lipase 97.56
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 97.45
PRK05077414 frsA fermentation/respiration switch protein; Revi 97.32
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 97.3
KOG1455313 consensus Lysophospholipase [Lipid transport and m 97.19
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 97.18
PLN02211273 methyl indole-3-acetate methyltransferase 97.1
PRK05855 582 short chain dehydrogenase; Validated 96.76
PRK10566249 esterase; Provisional 96.61
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 96.6
KOG2564343 consensus Predicted acetyltransferases and hydrola 96.56
PRK10985324 putative hydrolase; Provisional 96.52
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 96.49
PLN02442283 S-formylglutathione hydrolase 96.29
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 96.08
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 96.03
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 96.0
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 95.89
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 95.75
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 95.72
PRK10115686 protease 2; Provisional 95.16
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 95.02
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 94.98
PRK10162318 acetyl esterase; Provisional 94.86
PLN00021313 chlorophyllase 94.83
PRK06765389 homoserine O-acetyltransferase; Provisional 94.68
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 94.61
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 94.05
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 93.92
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 93.61
KOG1838409 consensus Alpha/beta hydrolase [General function p 93.13
COG3208244 GrsT Predicted thioesterase involved in non-riboso 93.02
PF10503220 Esterase_phd: Esterase PHB depolymerase 92.9
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 92.87
PRK11460232 putative hydrolase; Provisional 92.35
cd00312493 Esterase_lipase Esterases and lipases (includes fu 91.83
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 91.13
PRK11071190 esterase YqiA; Provisional 91.12
PRK11460232 putative hydrolase; Provisional 89.93
KOG2382315 consensus Predicted alpha/beta hydrolase [General 89.91
PRK05855 582 short chain dehydrogenase; Validated 88.76
PLN02454414 triacylglycerol lipase 88.72
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 88.19
PLN02211273 methyl indole-3-acetate methyltransferase 87.55
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 87.41
PF05577434 Peptidase_S28: Serine carboxypeptidase S28; InterP 87.38
PRK10566249 esterase; Provisional 87.15
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 86.32
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 86.22
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 85.78
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 85.04
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 84.67
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 84.28
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 83.48
COG4099387 Predicted peptidase [General function prediction o 83.41
PRK102521296 entF enterobactin synthase subunit F; Provisional 83.35
KOG3975301 consensus Uncharacterized conserved protein [Funct 82.99
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 82.96
COG0400207 Predicted esterase [General function prediction on 82.91
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 82.34
KOG2183492 consensus Prolylcarboxypeptidase (angiotensinase C 82.04
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 81.97
COG0657312 Aes Esterase/lipase [Lipid metabolism] 81.59
PLN02571413 triacylglycerol lipase 81.57
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 80.96
PRK06765389 homoserine O-acetyltransferase; Provisional 80.61
KOG1552258 consensus Predicted alpha/beta hydrolase [General 80.58
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 80.44
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 80.3
COG0400207 Predicted esterase [General function prediction on 80.27
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.3e-117  Score=893.38  Aligned_cols=438  Identities=44%  Similarity=0.819  Sum_probs=388.9

Q ss_pred             HHHHhhhhc-ccCCCCCccccCCCCCC-CCceeEEeeEEeeCCCCeeEEEEEEEeccCCCCCCeeEEecCCCChhhhhhh
Q 011764           21 VSRSNVVYV-AAFPAEDLVVSLPGQPK-VAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPGCSSVGGG   98 (478)
Q Consensus        21 ~~~~~~~~~-~~~~~~~~~~~lpg~~~-~~~~~~sGyl~v~~~~~~~lfywf~es~~~~~~~PlilWlnGGPG~ss~~~g   98 (478)
                      +++.+..|. ...++.++|+.|||++. +++++|||||+|++..+++||||||||+++|+++||||||||||||||+. |
T Consensus        12 ~l~~~~~~~~~~~~~~~~I~~LPG~~~~~~f~~ysGYv~v~~~~~~~LFYwf~eS~~~P~~dPlvLWLnGGPGCSSl~-G   90 (454)
T KOG1282|consen   12 LLVFLIHCRSHHVDEADLIKSLPGQPGPLPFKQYSGYVTVNESEGRQLFYWFFESENNPETDPLVLWLNGGPGCSSLG-G   90 (454)
T ss_pred             HHHHHHhhhccccchhhhhhcCCCCCCCCCcccccceEECCCCCCceEEEEEEEccCCCCCCCEEEEeCCCCCccchh-h
Confidence            333455554 37778899999999985 78999999999999889999999999999999999999999999999995 9


Q ss_pred             hhhccCCceecCCCCcccccCCCcccccceEEeeCCCCcccccCCCCCCCccCchhcHHHHHHHHHHHHHHCCCCCCCCe
Q 011764           99 AFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSREL  178 (478)
Q Consensus        99 ~f~E~GP~~~~~~~~~l~~n~~sw~~~~~~l~iDqPvG~GfSy~~~~~~~~~~~~~~A~d~~~fL~~F~~~fP~~~~~~~  178 (478)
                      +|.|+|||+++.+|.+|..|+||||+.||||||||||||||||+++..++..+|+.+|+|+++||+.||++||||++|||
T Consensus        91 ~~~E~GPf~v~~~G~tL~~N~ySWnk~aNiLfLd~PvGvGFSYs~~~~~~~~~D~~~A~d~~~FL~~wf~kfPey~~~~f  170 (454)
T KOG1282|consen   91 LFEENGPFRVKYNGKTLYLNPYSWNKEANILFLDQPVGVGFSYSNTSSDYKTGDDGTAKDNYEFLQKWFEKFPEYKSNDF  170 (454)
T ss_pred             hhhhcCCeEEcCCCCcceeCCccccccccEEEEecCCcCCccccCCCCcCcCCcHHHHHHHHHHHHHHHHhChhhcCCCe
Confidence            99999999999988999999999999999999999999999999998877789999999999999999999999999999


Q ss_pred             EEEcccccccchHHHHHHHHHhhcccCCceeeeecceeeccccccCCCccchhhhhhccCCCCHHHHHHHHhcccccccc
Q 011764          179 FLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYV  258 (478)
Q Consensus       179 yi~GESYgG~yvP~lA~~i~~~n~~~~~~~inLkGi~IGNg~idp~~q~~~~~~~~~~~gli~~~~~~~~~~~c~~~~~~  258 (478)
                      ||+||||||||||+||.+|++.|+....+.|||||++||||++|+..|..++.+|++.||+|+++.++.+.+.|......
T Consensus       171 yI~GESYAG~YVP~La~~I~~~N~~~~~~~iNLkG~~IGNg~td~~~~~~~~~~~a~~h~liSde~~~~l~~~C~~~~~~  250 (454)
T KOG1282|consen  171 YIAGESYAGHYVPALAQEILKGNKKCCKPNINLKGYAIGNGLTDPEIDYNGRIPFAWGHGLISDELYESLKRACDFSSDN  250 (454)
T ss_pred             EEecccccceehHHHHHHHHhccccccCCcccceEEEecCcccCccccccchhhhhhhcccCCHHHHHHHHHHhccCccc
Confidence            99999999999999999999999754456899999999999999999999999999999999999999999999875321


Q ss_pred             cCCCCCCchHHHHHHHHHHHHhcccccccccccccCCChhhHHHHHHhhhhcccccCcCcccchhhhhhcCcHHHHhhcc
Q 011764          259 SGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALH  338 (478)
Q Consensus       259 ~~~~~~~~~~C~~~~~~~~~~~~~~in~ydi~~~~c~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~yLN~~~Vr~aLh  338 (478)
                      .......+..|.++++.......+.++.|++..+.|......  .    .........++|.+....+|||+++||+|||
T Consensus       251 ~~~~~~~~~~C~~~~~~~~~~~~~~i~~y~i~~~~C~~~~~~--~----~~~~~~~~~~~c~~~~~~~ylN~~~VrkALh  324 (454)
T KOG1282|consen  251 YANVDPSNTKCNKAVEEFDSKTTGDIDNYYILTPDCYPTSYE--L----KKPTDCYGYDPCLSDYAEKYLNRPEVRKALH  324 (454)
T ss_pred             ccccCCchhHHHHHHHHHHHHHhccCchhhhcchhhcccccc--c----cccccccccCCchhhhHHHhcCCHHHHHHhC
Confidence            111223367999999998656667899999998889641100  0    0011234568898766689999999999999


Q ss_pred             cCCcCCcccccccccccccccCCCCCChHHHHHHHHhCC-CcEEEEecCCcccCCchhHHHHHHHHHhccCCccccCCcc
Q 011764          339 ANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNG-IPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGA  417 (478)
Q Consensus       339 v~~~~~~~~w~~cs~~v~~~~~d~~~~~~~~l~~LL~~g-irVLiY~Gd~D~i~n~~Gt~~~i~~l~~~~~~~~~~~~~~  417 (478)
                      |+....| +|+.||..+...+.+...++++.+..++.++ +|||||+||.|++||+.||++||++    ++++.+++|+|
T Consensus       325 ~~~~~~~-~W~~Cn~~v~~~~~~~~~sm~p~~~~~~~~~~~rvliysGD~D~~~p~~gt~~~i~~----L~~~~~~~~~p  399 (454)
T KOG1282|consen  325 ANKTSIG-KWERCNDEVNYNYNDDIKSMLPIHKKLIASGGYRVLIYSGDHDLVVPFLGTQAWIKS----LNLSITDEWRP  399 (454)
T ss_pred             CCCCCCC-cccccChhhhcccccCccchHHHHHHHhhcCceEEEEEeCCcceeCcchhhHHHHHh----ccCccccCccC
Confidence            9987544 8999999998778888899999999999865 9999999999999999999999999    77889999999


Q ss_pred             cccC-CeeeEEEEEECCeeEEEEEcCCcccccCCChHHHHHHHHHHHcCCCCCCC
Q 011764          418 WFHK-QQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNN  471 (478)
Q Consensus       418 w~~~-~~~~G~~k~~~n~Ltf~~V~~AGHmvP~dqP~~a~~m~~~fl~~~~~~~~  471 (478)
                      |+.+ +|+|||+++|++ |||++|+|||||||+|||++|+.||++||.|+++++.
T Consensus       400 W~~~~~qvaG~~~~Y~~-ltf~tVrGaGH~VP~~~p~~al~m~~~fl~g~~l~~~  453 (454)
T KOG1282|consen  400 WYHKGGQVAGYTKTYGG-LTFATVRGAGHMVPYDKPESALIMFQRFLNGQPLPST  453 (454)
T ss_pred             CccCCCceeeeEEEecC-EEEEEEeCCcccCCCCCcHHHHHHHHHHHcCCCCCCC
Confidence            9995 899999999999 9999999999999999999999999999999999764

>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
1bcr_A263 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 6e-49
3sc2_A259 Refined Atomic Model Of Wheat Serine Carboxypeptida 7e-49
1whs_A255 Structure Of The Complex Of L-Benzylsuccinate With 8e-49
1wht_A256 Structure Of The Complex Of L-Benzylsuccinate With 8e-49
1ivy_A452 Physiological Dimer Hpp Precursor Length = 452 2e-44
1gxs_A270 Crystal Structure Of Hydroxynitrile Lyase From Sorg 7e-43
4az0_A300 Crystal Structure Of Cathepsin A, Complexed With 8a 6e-34
1gxs_B158 Crystal Structure Of Hydroxynitrile Lyase From Sorg 1e-26
1wpx_A421 Crystal Structure Of Carboxypeptidase Y Inhibitor C 8e-26
1bcr_B160 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 9e-26
1wht_B153 Structure Of The Complex Of L-Benzylsuccinate With 9e-25
3sc2_B152 Refined Atomic Model Of Wheat Serine Carboxypeptida 1e-24
1whs_B153 Structure Of The Complex Of L-Benzylsuccinate With 1e-24
1cpy_A421 Site-Directed Mutagenesis On (Serine) Carboxypeptid 1e-24
1ac5_A483 Crystal Structure Of Kex1(delta)p, A Prohormone-pro 7e-23
4az0_B155 Crystal Structure Of Cathepsin A, Complexed With 8a 6e-08
>pdb|1BCR|A Chain A, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 263 Back     alignment and structure 
Iteration: 1

 Score =  191 bits (486), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 104/262 (39%), Positives = 147/262 (56%), Gaps = 11/262 (4%)
Query: 34  AEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNXXXXXX 93
           A D +  LPGQP V F  Y+GY+ VD   GRSLFY   EA  +    PL LWLN      
Sbjct: 7   AADRIARLPGQPAVDFDMYSGYITVDEGAGRSLFYLLQEAPEDAQPAPLVLWLNGGPGCS 66
Query: 94  XXXXXAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSD-YNCGD 152
                A  ELG F  +  G GL  N   WNK +N+LF++SPAGVG+SY+NT+SD Y  GD
Sbjct: 67  SVAYGASEELGAFRVKPRGAGLVLNEYRWNKVANVLFLDSPAGVGFSYTNTSSDIYTSGD 126
Query: 153 ASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNIK 212
             TA D + F+  W+E+FP +K R+ ++ GESYAGHY+P+L+ ++      SK    N+K
Sbjct: 127 NRTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVPELSQLV----HRSKNPVINLK 182
Query: 213 GVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEA 272
           G  +GN L+    D    +EF+W+HG++SD+    +   C  D ++     + + +C  A
Sbjct: 183 GFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHDSFI-----HPSPACDAA 237
Query: 273 ITEANKIVGDYINNYDVILDVC 294
              A    G+ I+ Y +   VC
Sbjct: 238 TDVATAEQGN-IDMYSLYTPVC 258
>pdb|3SC2|A Chain A, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|1WHS|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 255 Back     alignment and structure
>pdb|1WHT|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 256 Back     alignment and structure
>pdb|1IVY|A Chain A, Physiological Dimer Hpp Precursor Length = 452 Back     alignment and structure
>pdb|1GXS|A Chain A, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 270 Back     alignment and structure
>pdb|4AZ0|A Chain A, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 300 Back     alignment and structure
>pdb|1GXS|B Chain B, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 158 Back     alignment and structure
>pdb|1WPX|A Chain A, Crystal Structure Of Carboxypeptidase Y Inhibitor Complexed With The Cognate Proteinase Length = 421 Back     alignment and structure
>pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 160 Back     alignment and structure
>pdb|1WHT|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure
>pdb|3SC2|B Chain B, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 152 Back     alignment and structure
>pdb|1WHS|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure
>pdb|1CPY|A Chain A, Site-Directed Mutagenesis On (Serine) Carboxypeptidase Y From Yeast. The Significance Of Thr 60 And Met 398 In Hydrolysis And Aminolysis Reactions Length = 421 Back     alignment and structure
>pdb|1AC5|A Chain A, Crystal Structure Of Kex1(delta)p, A Prohormone-processing Carboxypeptidase From Saccharomyces Cerevisiae Length = 483 Back     alignment and structure
>pdb|4AZ0|B Chain B, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 155 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
1ivy_A452 Human protective protein; carboxypeptidase, serine 1e-169
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 1e-160
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 1e-151
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 1e-120
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 1e-117
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 1e-56
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 3e-56
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 Back     alignment and structure
 Score =  482 bits (1242), Expect = e-169
 Identities = 138/467 (29%), Positives = 227/467 (48%), Gaps = 51/467 (10%)

Query: 33  PAEDLVVSLPGQPK-VAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPG 91
           P +D +  LPG  K  +FRQY+GY+       + L Y+FVE++ +P   P+ LWLNGGPG
Sbjct: 2   PDQDEIQRLPGLAKQPSFRQYSGYLKSS--GSKHLHYWFVESQKDPENSPVVLWLNGGPG 59

Query: 92  CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG 151
           CSS+ G   TE GPF  + DG  L  N  SWN  +N+L++ESPAGVG+SYS+    Y   
Sbjct: 60  CSSLDG-LLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDD-KFYATN 117

Query: 152 DASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNI 211
           D   A+     + +++  FPE+K+ +LFLTGESYAG YIP LA +++           N+
Sbjct: 118 DTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDP------SMNL 171

Query: 212 KGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIE 271
           +G+A+GN L   +Q+  ++  F + HG++ + +  ++ + C   +  +   +     C+ 
Sbjct: 172 QGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDL-ECVT 230

Query: 272 AITEANKIVGDY-INNYDVILDVC-------------------------YPTIVEQELRL 305
            + E  +IVG+  +N Y++                               P        L
Sbjct: 231 NLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQAL 290

Query: 306 RKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNIN 365
            +   K+ +      T     YLN P V+KAL+         W MC+ ++N        +
Sbjct: 291 LRSGDKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQ--LPQWDMCNFLVNLQYRRLYRS 348

Query: 366 ILPV-LKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHK--- 421
           +    LK +      + +++GD D     +G    +      LN ++ V    W  K   
Sbjct: 349 MNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFV----DSLNQKMEVQRRPWLVKYGD 404

Query: 422 --QQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGR 466
             +Q+ G+  E+ + + F+T++GA HMVP  +P  A  +FS F++ +
Sbjct: 405 SGEQIAGFVKEFSH-IAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQ 450
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Length = 483 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Length = 421 Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Length = 255 Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 270 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Length = 153 Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 158 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query478
1ivy_A452 Human protective protein; carboxypeptidase, serine 100.0
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 100.0
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 100.0
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 100.0
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 100.0
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 100.0
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 100.0
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.29
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.23
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.19
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.17
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.16
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.14
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.12
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.12
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.11
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.1
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.1
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.09
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.08
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.07
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.07
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.06
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.04
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.03
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.03
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.03
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.03
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.03
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.02
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.02
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.02
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.01
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.01
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.01
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.0
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.0
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.0
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 98.99
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 98.99
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 98.99
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 98.97
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 98.97
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 98.97
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 98.96
3vdx_A456 Designed 16NM tetrahedral protein CAGE containing 98.94
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 98.93
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 98.93
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 98.92
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 98.91
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 98.91
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 98.91
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.91
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 98.9
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 98.9
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 98.89
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 98.89
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 98.89
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 98.89
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 98.88
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 98.87
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 98.86
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 98.86
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 98.86
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 98.86
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 98.85
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 98.84
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 98.83
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 98.83
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 98.83
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 98.82
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 98.81
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 98.81
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 98.8
3h04_A275 Uncharacterized protein; protein with unknown func 98.8
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 98.79
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 98.77
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 98.77
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.76
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 98.74
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 98.74
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 98.67
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 98.08
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 98.63
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 98.61
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 98.57
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 98.57
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 98.57
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 98.54
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 98.54
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.51
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 98.51
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 98.51
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 98.48
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 98.47
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 98.44
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 98.43
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.37
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 98.37
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 98.37
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 98.36
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 98.35
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 98.34
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 98.34
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 98.34
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.34
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.31
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 98.3
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 98.3
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 98.29
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 98.27
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.27
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 98.26
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 98.23
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 98.22
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.19
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 98.19
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 98.15
1vkh_A273 Putative serine hydrolase; structural genomics, jo 98.13
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 98.12
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.11
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 98.1
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.09
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 98.08
3bjr_A283 Putative carboxylesterase; structural genomics, jo 98.07
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 98.07
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 98.06
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 98.05
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 98.03
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 98.02
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 98.0
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 97.97
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.95
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 97.92
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 97.9
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 97.85
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 97.84
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 97.76
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 97.69
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 97.66
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 97.63
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 97.61
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 97.53
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 97.51
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 97.49
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 97.48
1r3d_A264 Conserved hypothetical protein VC1974; structural 97.48
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 97.47
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 97.44
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 97.43
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 97.39
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 97.35
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 97.33
3ain_A323 303AA long hypothetical esterase; carboxylesterase 97.32
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 97.25
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 97.21
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 97.21
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 97.19
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.17
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 97.17
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.15
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 97.14
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.12
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 97.1
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 97.08
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 97.08
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.02
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 97.0
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 96.99
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 96.96
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 96.96
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 96.93
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 96.92
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 96.88
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 96.87
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 96.81
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 96.8
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 96.75
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 96.71
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 96.67
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 96.65
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 96.64
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 96.63
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 96.57
3tej_A329 Enterobactin synthase component F; nonribosomal pe 96.56
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 96.55
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 96.42
1kez_A300 Erythronolide synthase; polyketide synthase, modul 96.39
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 96.35
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 96.33
3nuz_A398 Putative acetyl xylan esterase; structural genomic 96.22
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 96.2
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 96.17
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 96.08
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 95.99
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 95.95
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 95.93
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 95.93
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 95.86
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 95.84
1qe3_A489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 95.7
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 95.53
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 95.53
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 95.48
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 95.48
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 95.36
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 95.19
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 95.18
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 95.17
2ogt_A498 Thermostable carboxylesterase EST50; alpha/beta hy 95.16
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 95.12
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 94.97
3d59_A383 Platelet-activating factor acetylhydrolase; secret 94.97
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 94.95
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 94.71
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 94.67
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 94.66
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 94.59
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 94.55
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 94.42
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 94.25
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 94.15
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 94.15
2zyr_A484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 94.1
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 94.07
2ha2_A543 ACHE, acetylcholinesterase; hydrolase fold, serine 93.98
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 93.92
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 93.89
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 93.8
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 93.76
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 93.73
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 93.69
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 93.62
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 93.44
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 93.41
2h7c_A542 Liver carboxylesterase 1; enzyme, cholesteryl este 93.28
1r3d_A264 Conserved hypothetical protein VC1974; structural 93.18
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 93.14
1p0i_A529 Cholinesterase; serine hydrolase, butyrate, hydrol 93.13
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 92.7
2fj0_A551 JuvenIle hormone esterase; manduca sexta, alpha-be 92.6
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 92.58
4fle_A202 Esterase; structural genomics, PSI-biology, northe 92.48
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 91.97
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 91.92
1ea5_A537 ACHE, acetylcholinesterase; hydrolase, serine hydr 91.71
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 91.44
4ebb_A472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 91.44
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 90.47
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 90.47
4fle_A202 Esterase; structural genomics, PSI-biology, northe 90.29
4f21_A246 Carboxylesterase/phospholipase family protein; str 90.17
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 90.15
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 90.07
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 89.99
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 89.72
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 89.49
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 89.06
1dx4_A585 ACHE, acetylcholinesterase; hydrolase, serine este 88.91
4f21_A246 Carboxylesterase/phospholipase family protein; str 88.9
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 88.24
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 88.16
1thg_A544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 87.75
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 87.07
1ukc_A522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 86.94
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 86.62
3lp5_A250 Putative cell surface hydrolase; structural genom 85.58
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 85.53
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 85.13
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 85.12
3bix_A574 Neuroligin-1, neuroligin I; esterase domain, alpha 84.73
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 83.14
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 82.9
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 82.76
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 82.44
1llf_A534 Lipase 3; candida cylindracea cholesterol esterase 82.32
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 82.28
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 81.88
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 81.32
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 81.02
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 80.65
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 80.17
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
Probab=100.00  E-value=1.7e-101  Score=795.93  Aligned_cols=417  Identities=32%  Similarity=0.626  Sum_probs=353.5

Q ss_pred             CCCCccccCCCCC-CCCceeEEeeEEeeCCCCeeEEEEEEEeccCCCCCCeeEEecCCCChhhhhhhhhhccCCceecCC
Q 011764           33 PAEDLVVSLPGQP-KVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEKPLTLWLNGGPGCSSVGGGAFTELGPFYPRGD  111 (478)
Q Consensus        33 ~~~~~~~~lpg~~-~~~~~~~sGyl~v~~~~~~~lfywf~es~~~~~~~PlilWlnGGPG~ss~~~g~f~E~GP~~~~~~  111 (478)
                      ++.++|+.|||++ .+++++|||||+|++  +++||||||||+++|+++||+|||||||||||+ .|+|.|+|||+++.+
T Consensus         2 ~~~d~V~~LPg~~~~~~~~~~sGyv~v~~--~~~lfy~f~~s~~~~~~~Pl~lwlnGGPG~Ss~-~g~~~e~GP~~~~~~   78 (452)
T 1ivy_A            2 PDQDEIQRLPGLAKQPSFRQYSGYLKSSG--SKHLHYWFVESQKDPENSPVVLWLNGGPGCSSL-DGLLTEHGPFLVQPD   78 (452)
T ss_dssp             CTTTBCSSCTTCSSCCSSCEEEEEEECST--TEEEEEEEECCSSCGGGSCEEEEECCTTTBCTH-HHHHTTTSSEEECTT
T ss_pred             CccCccccCCCCCCCCCceeeEEEEeeCC--CCeEEEEEEEcCCCCCCCCEEEEECCCCcHHHH-HHHHHhcCCcEEeCC
Confidence            3578999999997 478999999999964  689999999999999999999999999999999 699999999999988


Q ss_pred             CCcccccCCCcccccceEEeeCCCCcccccCCCCCCCccCchhcHHHHHHHHHHHHHHCCCCCCCCeEEEcccccccchH
Q 011764          112 GRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIP  191 (478)
Q Consensus       112 ~~~l~~n~~sw~~~~~~l~iDqPvG~GfSy~~~~~~~~~~~~~~A~d~~~fL~~F~~~fP~~~~~~~yi~GESYgG~yvP  191 (478)
                      +.+++.||+||++.+||||||||+||||||..+ ..+..+++++|+|+++||+.|+++||+|+++||||+||||||+|||
T Consensus        79 ~~~l~~n~~sw~~~~~~lfiDqP~GtGfS~~~~-~~~~~~~~~~a~~~~~~l~~f~~~~p~~~~~~~~i~GeSYgG~y~p  157 (452)
T 1ivy_A           79 GVTLEYNPYSWNLIANVLYLESPAGVGFSYSDD-KFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIP  157 (452)
T ss_dssp             SSCEEECTTCGGGSSEEEEECCSTTSTTCEESS-CCCCCBHHHHHHHHHHHHHHHHHHSGGGTTSCEEEEEETTHHHHHH
T ss_pred             CceeeeCCCcccccccEEEEecCCCCCcCCcCC-CCCcCCcHHHHHHHHHHHHHHHHhcHHhcCCCEEEEeeccceeehH
Confidence            888999999999999999999999999999654 3455677889999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhcccCCceeeeecceeeccccccCCCccchhhhhhccCCCCHHHHHHHHhcccccccccCCCCCCchHHHH
Q 011764          192 QLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIE  271 (478)
Q Consensus       192 ~lA~~i~~~n~~~~~~~inLkGi~IGNg~idp~~q~~~~~~~~~~~gli~~~~~~~~~~~c~~~~~~~~~~~~~~~~C~~  271 (478)
                      .+|.+|++.      .++|||||+||||++||..|..++++|+|+||+|++++++.+.+.|.... .+.........|..
T Consensus       158 ~la~~i~~~------~~~~l~g~~ign~~~d~~~~~~~~~~~~~~~glis~~~~~~~~~~c~~~~-~~~~~~~~~~~C~~  230 (452)
T 1ivy_A          158 TLAVLVMQD------PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQN-KCNFYDNKDLECVT  230 (452)
T ss_dssp             HHHHHHTTC------TTSCEEEEEEESCCSBHHHHHHHHHHHHHHTTSSCHHHHHHHHHHHEETT-EECCSSCCCHHHHH
T ss_pred             HHHHHHHhc------CccccceEEecCCccChhhhhhhHHHHHhhhhcCCHHHHHHHHHHhhhcc-cccccccchHHHHH
Confidence            999999853      26999999999999999999999999999999999999999999887531 11112234567999


Q ss_pred             HHHHHHHHh-cccccccccccccCCChhhHHH---------------HH-Hh-------hhhcc--cccCcCcccc-hhh
Q 011764          272 AITEANKIV-GDYINNYDVILDVCYPTIVEQE---------------LR-LR-------KMATK--MSVGVDVCMT-LER  324 (478)
Q Consensus       272 ~~~~~~~~~-~~~in~ydi~~~~c~~~~~~~~---------------~~-~~-------~~~~~--~~~~~~~c~~-~~~  324 (478)
                      +++.+.... ..++|+||++.+ |........               +. +.       .....  .....++|.+ ..+
T Consensus       231 ~~~~~~~~~~~~~in~Y~i~~~-C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pc~~~~~~  309 (452)
T 1ivy_A          231 NLQEVARIVGNSGLNIYNLYAP-CAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAA  309 (452)
T ss_dssp             HHHHHHHHHHSSSCCTTCTTSC-CTTCCSSSEEEETTEEEECCCSCSSTTSCCCCCCGGGHHHHTCEEEECCTTCCCHHH
T ss_pred             HHHHHHHHHhcCCCcccccccc-cccccccccchhcccccccccchhhhhhhhccccccccccccccccCCCCccchHHH
Confidence            988875543 578999999864 742100000               00 00       00000  0001137854 567


Q ss_pred             hhhcCcHHHHhhcccCCcCCcccccccccccccccCCCCCChHHHHHHHHhC-CCcEEEEecCCcccCCchhHHHHHHHH
Q 011764          325 FFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQN-GIPVWVFSGDQDSVVPLLGSRTLIREL  403 (478)
Q Consensus       325 ~~yLN~~~Vr~aLhv~~~~~~~~w~~cs~~v~~~~~d~~~~~~~~l~~LL~~-girVLiY~Gd~D~i~n~~Gt~~~i~~l  403 (478)
                      ..|||+++||+||||+.. . .+|+.||..|...+.|.+.++.+.+++||++ |+|||||+||+|++||+.||++||++ 
T Consensus       310 ~~ylN~~~Vq~ALhv~~~-~-~~W~~Cs~~V~~~~~~~~~s~~~~~~~LL~~~girVlIYsGD~D~icn~~Gt~~wi~~-  386 (452)
T 1ivy_A          310 STYLNNPYVRKALNIPEQ-L-PQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDS-  386 (452)
T ss_dssp             HHHHTSHHHHHHTTCCTT-S-CCCCSBCHHHHHHCBCCCSBSHHHHHHHHHHTCCEEEEEEETTCSSSCHHHHHHHHHH-
T ss_pred             HHHhCcHHHHHHcCCCCC-C-CccccCcHHHHhhhhcccccHHHHHHHHHhccCceEEEEeCCCCccCCcHHHHHHHHh-
Confidence            899999999999999854 2 3799999988666677888999999999998 99999999999999999999999999 


Q ss_pred             HhccCCccccCCcccccC-C----eeeEEEEEECCeeEEEEEcCCcccccCCChHHHHHHHHHHHcCCCC
Q 011764          404 ARDLNFEVTVPYGAWFHK-Q----QVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRL  468 (478)
Q Consensus       404 ~~~~~~~~~~~~~~w~~~-~----~~~G~~k~~~n~Ltf~~V~~AGHmvP~dqP~~a~~m~~~fl~~~~~  468 (478)
                         ++|+...+|++|+.+ +    +++||+|+|+| |||++|++||||||+|||++|++||+|||.|+++
T Consensus       387 ---L~~~~~~~~~pw~~~~~~~~~~vaG~~~~y~n-Ltf~tV~gAGHmVP~dqP~~al~m~~~fl~g~~l  452 (452)
T 1ivy_A          387 ---LNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSH-IAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY  452 (452)
T ss_dssp             ---TCCCEEEEEEEEEEECTTSCEEEEEEEEEESS-EEEEEETTCCSSHHHHCHHHHHHHHHHHHTTCCC
T ss_pred             ---cCCcccccceeeeeccCCCCcccceEEEEEcc-eEEEEECCCcccCcccChHHHHHHHHHHhcCCCC
Confidence               677777889999876 5    99999999999 9999999999999999999999999999999875
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 478
g1wht.1409 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat 1e-123
g1gxs.1425 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (So 1e-119
d1ivya_452 c.69.1.5 (A:) Human 'protective protein', HPP {Hum 1e-118
d1ac5a_483 c.69.1.5 (A:) Serine carboxypeptidase II {Baker's 1e-101
d1wpxa1421 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak 2e-98
d1thta_302 c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase 0.004
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Length = 452 Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Length = 483 Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Length = 302 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query478
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 100.0
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 100.0
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 100.0
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.47
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.39
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.38
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.38
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.31
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.28
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.28
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.28
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.27
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.26
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.24
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.16
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.15
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.15
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.08
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 98.99
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 98.98
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 98.93
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 98.92
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 98.91
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 98.89
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 98.81
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 98.72
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 98.64
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 98.58
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 98.53
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 98.38
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 98.19
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 98.19
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 98.17
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 98.1
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 97.97
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 97.9
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 97.56
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 97.36
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 96.92
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 96.91
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 96.86
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 96.75
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 96.55
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 96.4
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 96.16
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 96.06
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 96.02
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 95.91
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 95.69
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 95.67
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 95.61
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 95.28
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 95.24
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 95.14
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 94.96
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 94.71
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 94.42
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 94.41
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 94.12
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 93.95
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 93.68
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 93.61
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 93.56
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 93.11
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 92.98
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 92.12
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 91.76
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 91.72
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 91.43
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 91.29
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 91.03
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 90.97
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 90.61
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 89.36
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 87.98
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 87.34
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 86.54
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 86.19
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 85.89
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 85.77
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 85.65
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 85.21
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 85.19
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 83.87
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 83.52
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 83.4
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 83.07
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 82.46
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 81.75
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 81.63
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 81.61
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 81.59
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure