Citrus Sinensis ID: 011828
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 476 | ||||||
| 224087896 | 477 | predicted protein [Populus trichocarpa] | 0.901 | 0.899 | 0.496 | 1e-107 | |
| 255575616 | 492 | conserved hypothetical protein [Ricinus | 0.901 | 0.871 | 0.491 | 1e-102 | |
| 224139390 | 456 | predicted protein [Populus trichocarpa] | 0.810 | 0.846 | 0.495 | 1e-96 | |
| 297741755 | 466 | unnamed protein product [Vitis vinifera] | 0.918 | 0.937 | 0.454 | 1e-84 | |
| 356566804 | 651 | PREDICTED: uncharacterized protein LOC10 | 0.842 | 0.615 | 0.436 | 6e-74 | |
| 359481328 | 511 | PREDICTED: uncharacterized protein LOC10 | 0.878 | 0.818 | 0.390 | 8e-61 | |
| 79570413 | 482 | ATP synthase D chain-related protein [Ar | 0.773 | 0.763 | 0.373 | 2e-51 | |
| 297823743 | 509 | hypothetical protein ARALYDRAFT_345641 [ | 0.758 | 0.709 | 0.388 | 4e-51 | |
| 356530165 | 639 | PREDICTED: uncharacterized protein LOC10 | 0.756 | 0.563 | 0.342 | 2e-46 | |
| 449439795 | 392 | PREDICTED: uncharacterized protein LOC10 | 0.674 | 0.818 | 0.389 | 5e-43 |
| >gi|224087896|ref|XP_002308260.1| predicted protein [Populus trichocarpa] gi|222854236|gb|EEE91783.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 394 bits (1011), Expect = e-107, Method: Compositional matrix adjust.
Identities = 237/477 (49%), Positives = 323/477 (67%), Gaps = 48/477 (10%)
Query: 20 KTTTDDVAVGADPNHLINGQK-----DDVRSQASEPADIQNVQVDADRH--QSNGAESAN 72
K + DDV+V A N+ NGQ D+ + S D+ + + D + H + NGA +
Sbjct: 25 KASEDDVSVAAATNNNSNGQNHGNVNDNQVIEVSSNGDVVDAE-DFNGHYDKPNGAAPHS 83
Query: 73 LAEAERQHLLQREAMAI------LEETVKHLRNERESHIQKEATLEGTVQQLQNECDLYK 126
A E LQ E ++ EET+K LR+E +SHIQKEATLE TV+QLQNE +
Sbjct: 84 AALQETIKHLQNETDSLTRTKDTFEETIKRLRDENDSHIQKEATLEETVKQLQNESASHT 143
Query: 127 EKVQATLEETIQQLQRQNDLRMQKEATLEETIKQLRNQNDLHIQREGGLEMNIANLQSEK 186
+K +A+LE+TI QL+ N+L +QKEAT E+TIKQL+ +ND H+Q+E LE I LQSEK
Sbjct: 144 QK-EASLEDTINQLRSVNNLCIQKEATFEDTIKQLKTENDSHLQKEADLEKRIVQLQSEK 202
Query: 187 EFWLQKEAALEQKISQLRDESAALNMKRASLEERLKLLEADKDSWTQMESVSKETIAGLS 246
+FWLQKEA +K++ L+DE AAL AS+ E+++LLE+DKDSWT E+ +KETIA ++
Sbjct: 203 DFWLQKEAGFGEKLNHLQDEKAAL----ASIGEKIRLLESDKDSWTISENTTKETIARMN 258
Query: 247 VDITQLRMQVVELEESRNNLLQENRQLKENVSSLRSQL-------SSDESKKLQHATSEQ 299
+D+T+LRMQVVELE+SRN+L++EN+QLKE++S+L+ QL S + +L +E+
Sbjct: 259 IDVTRLRMQVVELEDSRNSLVKENQQLKESISNLKLQLQNIDTSVSFANTSELGKLGAEK 318
Query: 300 KDFSTQIEAAGALIDKLITENIELVEKVNDLSVKLDRQSVAAGLSSAIGSDAV---TALT 356
++ ++QIEAA AL+DKLITEN +LVEKVN+L +KLD Q AA SSA G + + L
Sbjct: 319 EELNSQIEAACALVDKLITENADLVEKVNELYIKLDHQGTAASFSSATGRGVIVRNSELA 378
Query: 357 SDTEPMSESSDNMSSLNNRLETQGVVAVKEDRNGINGVHADPPPLVLSSSEAEYSGEIVQ 416
+ T PM++S+ N+++L ++LE+ + +P +V SSEA SGEIVQ
Sbjct: 379 NGTHPMADSNANLTALGHKLES---------------LEVEPAVVVQYSSEA-GSGEIVQ 422
Query: 417 IPLDDKEVQDLELQVVESYTD-KVAAVPLTDAPLIGAPFRLVSFVAKYVSGADLVNK 472
IPLDD EV DLE+Q E TD K AVPLTDAPLIGAPFRL+SFVAKYVSG DLVN+
Sbjct: 423 IPLDDNEVPDLEMQAAE--TDYKSGAVPLTDAPLIGAPFRLISFVAKYVSGGDLVNR 477
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255575616|ref|XP_002528708.1| conserved hypothetical protein [Ricinus communis] gi|223531880|gb|EEF33697.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224139390|ref|XP_002323089.1| predicted protein [Populus trichocarpa] gi|222867719|gb|EEF04850.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297741755|emb|CBI32887.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356566804|ref|XP_003551617.1| PREDICTED: uncharacterized protein LOC100796148 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359481328|ref|XP_002279159.2| PREDICTED: uncharacterized protein LOC100249907 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|79570413|ref|NP_181392.2| ATP synthase D chain-related protein [Arabidopsis thaliana] gi|51968994|dbj|BAD43189.1| hypothetical protein [Arabidopsis thaliana] gi|330254458|gb|AEC09552.1| ATP synthase D chain-related protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297823743|ref|XP_002879754.1| hypothetical protein ARALYDRAFT_345641 [Arabidopsis lyrata subsp. lyrata] gi|297325593|gb|EFH56013.1| hypothetical protein ARALYDRAFT_345641 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356530165|ref|XP_003533654.1| PREDICTED: uncharacterized protein LOC100811378 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449439795|ref|XP_004137671.1| PREDICTED: uncharacterized protein LOC101221440 [Cucumis sativus] gi|449497171|ref|XP_004160333.1| PREDICTED: uncharacterized LOC101221440 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 476 | ||||||
| TAIR|locus:2064168 | 482 | AT2G38580 "AT2G38580" [Arabido | 0.697 | 0.688 | 0.328 | 1.2e-42 | |
| MGI|MGI:3041210 | 718 | Ccdc157 "coiled-coil domain co | 0.777 | 0.515 | 0.227 | 3e-11 | |
| UNIPROTKB|F1PWZ2 | 1941 | MYH7B "Uncharacterized protein | 0.789 | 0.193 | 0.209 | 1e-09 | |
| UNIPROTKB|E1BS91 | 1147 | CEP135 "Uncharacterized protei | 0.684 | 0.284 | 0.230 | 1.2e-09 | |
| UNIPROTKB|E1C7U7 | 1155 | CEP135 "Uncharacterized protei | 0.684 | 0.282 | 0.230 | 1.2e-09 | |
| UNIPROTKB|E1BPX8 | 1942 | LOC521764 "Uncharacterized pro | 0.857 | 0.210 | 0.201 | 2.2e-09 | |
| UNIPROTKB|F1S4X7 | 1944 | MYH7B "Uncharacterized protein | 0.857 | 0.209 | 0.201 | 2.2e-09 | |
| ZFIN|ZDB-GENE-081030-1 | 1059 | golga2 "golgi autoantigen, gol | 0.808 | 0.363 | 0.244 | 2.3e-09 | |
| RGD|1305732 | 1679 | Gcc2 "GRIP and coiled-coil dom | 0.657 | 0.186 | 0.214 | 2.4e-09 | |
| SGD|S000004300 | 911 | IMH1 "Protein involved in vesi | 0.75 | 0.391 | 0.220 | 3.1e-09 |
| TAIR|locus:2064168 AT2G38580 "AT2G38580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 451 (163.8 bits), Expect = 1.2e-42, P = 1.2e-42
Identities = 114/347 (32%), Positives = 197/347 (56%)
Query: 69 ESANLAEAERQHLLQREAMAILEETVKHLRNERESHIQKEATLEGTVQQLQNECDLYKEK 128
E+ E E + +Q+EA+ LEE + HL+ E E+H+ EA LEG + L+ E + + +
Sbjct: 107 ENVRRLETENEAHIQKEAL--LEERLVHLKTENEAHVHNEALLEGKLLHLRTENEDHIQN 164
Query: 129 VQATLEETIQQLQRQNDLRMQKEATLEETIKQLRNQNDLHIQREGGLEMNIANLQSEKEF 188
+A LEE + L+ +N+ +Q EA LEE + R +N+ H Q E LE + +++ +
Sbjct: 165 -EALLEEKLLHLRTENEAHIQNEALLEERLLHFRTENEAHKQNEEKLEERLVQYKNKNDM 223
Query: 189 WLQKEAALEQKISQLRDESAALNMKRASLEERLKLLEADKDSWTQMESVSKETIAGLSVD 248
L++ ++ E ++ QL DE + K ASLE++++ L+ D++S E S+E I+ L+ +
Sbjct: 224 LLREMSSTEAQMRQLLDERSTFTQKEASLEKKVQQLQHDEESLVAEEKSSREMISSLNNE 283
Query: 249 ITQLRMQVVELEESRNNLLQENRQLKENVXXXXXXXXXXXXKKLQHATSEQKDFSTQIEA 308
I +LR QV ELE+S++NLL++N+ LKE + SE+ + ++QIEA
Sbjct: 284 IARLRAQVTELEKSKSNLLEQNQSLKETISNLQVQHENHDSNA--KGASEE-ELNSQIEA 340
Query: 309 AGALIDKLITENIELVEKVNDLSVKLDRQSVAAGLSSAIGSDAVTALTSDTEPMSESSDN 368
A L++KLITEN +LVEKVN+L +KL++ A+ S AI + +L + P+ D
Sbjct: 341 ACTLVEKLITENADLVEKVNELCIKLNQSQHASPESLAIEVEKSESL--EEIPIH---DE 395
Query: 369 MSSLNNRLETQGVVAVKEDRNGINGVHADPPPLVLSSS-EAEYSGEI 414
+ ++N + ++K RN G + PL L+++ E + ++
Sbjct: 396 LIRIDNSRDMD-TASIK--RNFSEGEIEETVPLSLNANGEVDVESQV 439
|
|
| MGI|MGI:3041210 Ccdc157 "coiled-coil domain containing 157" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PWZ2 MYH7B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BS91 CEP135 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C7U7 CEP135 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BPX8 LOC521764 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S4X7 MYH7B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-081030-1 golga2 "golgi autoantigen, golgin subfamily a, 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1305732 Gcc2 "GRIP and coiled-coil domain containing 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004300 IMH1 "Protein involved in vesicular transport" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 476 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-08 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 9e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 9e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 6e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 8e-04 | |
| pfam00429 | 560 | pfam00429, TLV_coat, ENV polyprotein (coat polypro | 0.001 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.002 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 0.002 | |
| TIGR03185 | 650 | TIGR03185, DNA_S_dndD, DNA sulfur modification pro | 0.002 | |
| TIGR03185 | 650 | TIGR03185, DNA_S_dndD, DNA sulfur modification pro | 0.003 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 63.6 bits (155), Expect = 1e-10
Identities = 56/234 (23%), Positives = 99/234 (42%), Gaps = 1/234 (0%)
Query: 60 ADRHQSNGAESANLAEAERQHLLQREAMAILEETVKHLRNERESHIQKEATLEGTVQQLQ 119
+ L E RQ + L+ + L E E + LE +++L+
Sbjct: 691 KSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELE 750
Query: 120 NECDLYKEKVQATLEETIQQLQRQNDLRMQKEATLEETIKQLRNQNDLHIQREGGLEMNI 179
E + +E++ LEE ++ L+ ++ LEE + L+ + + + E +
Sbjct: 751 EELEELQERL-EELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRL 809
Query: 180 ANLQSEKEFWLQKEAALEQKISQLRDESAALNMKRASLEERLKLLEADKDSWTQMESVSK 239
L+ E E Q+ LEQ+I +L +E L K LEE L+ LE + + + +
Sbjct: 810 DALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELE 869
Query: 240 ETIAGLSVDITQLRMQVVELEESRNNLLQENRQLKENVSSLRSQLSSDESKKLQ 293
L ++ +L + ELEE L E +LKE + LR +L E+K +
Sbjct: 870 AEKEELEDELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLER 923
|
Length = 1163 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|215915 pfam00429, TLV_coat, ENV polyprotein (coat polyprotein) | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 476 | |||
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 99.66 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.74 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.73 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.7 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.64 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.63 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.54 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.52 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 98.22 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 98.17 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.15 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 98.12 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.1 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.06 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.05 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.04 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.03 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.02 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.02 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.01 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.96 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.96 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.94 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.93 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 97.9 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 97.88 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.86 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.83 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.82 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.8 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.75 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.74 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.67 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.66 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 97.62 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.6 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.6 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 97.53 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.49 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 97.48 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.47 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 97.47 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.46 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 97.45 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.44 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.4 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 97.39 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.39 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 97.39 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 97.34 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.28 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.28 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.28 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 97.28 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.24 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 97.2 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 97.19 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 97.16 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.16 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 97.12 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.12 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 97.12 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.09 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 97.08 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.05 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.03 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.02 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 97.01 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.0 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 96.99 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.99 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.97 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.97 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.97 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.96 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.95 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 96.93 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 96.9 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.89 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.82 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.81 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 96.79 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 96.77 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 96.72 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 96.72 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 96.62 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 96.61 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 96.58 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 96.56 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.55 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 96.48 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 96.47 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 96.45 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 96.43 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 96.43 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.38 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 96.34 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 96.34 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 96.34 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 96.32 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 96.31 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 96.3 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.25 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.25 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.2 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 96.14 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 96.13 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.1 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 96.1 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.07 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 96.05 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 96.01 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 95.98 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 95.93 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 95.9 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 95.9 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 95.89 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 95.8 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.8 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 95.69 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 95.68 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 95.67 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 95.62 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 95.55 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 95.54 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 95.53 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 95.49 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 95.48 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 95.46 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 95.45 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 95.44 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 95.43 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 95.43 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 95.43 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 95.42 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 95.4 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 95.36 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 95.35 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 95.34 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 95.16 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 95.1 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.0 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 94.83 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 94.79 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 94.73 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 94.64 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 94.59 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 94.57 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 94.49 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 94.35 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 94.34 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 94.34 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 94.33 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 94.22 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 94.2 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 94.19 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 94.16 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 94.12 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 94.05 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 94.02 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 94.02 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 93.91 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 93.84 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 93.74 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 93.74 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 93.49 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 93.47 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 93.43 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 93.4 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 93.32 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 93.27 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 93.22 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 93.2 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 93.19 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 93.15 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 93.03 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 92.96 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 92.89 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 92.8 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 92.77 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 92.69 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 92.64 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 92.59 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 92.56 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 92.43 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 92.04 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 92.01 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 91.84 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 91.83 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 91.6 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 91.6 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 91.57 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 90.86 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 90.85 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 90.83 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 90.73 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 90.64 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 90.53 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 89.97 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 89.96 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 89.9 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 89.74 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 89.65 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 89.61 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 89.58 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 89.54 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 89.54 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 89.47 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 89.35 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 88.97 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 88.93 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 88.77 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 88.68 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 88.64 | |
| PF13166 | 712 | AAA_13: AAA domain | 88.55 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 88.49 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 88.43 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 88.41 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 88.33 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 88.26 | |
| KOG0993 | 542 | consensus Rab5 GTPase effector Rabaptin-5 [Intrace | 88.06 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 87.88 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 87.76 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 87.75 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 87.58 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 87.45 | |
| PF13514 | 1111 | AAA_27: AAA domain | 87.25 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 87.23 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 87.1 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 86.96 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 86.82 | |
| PF10226 | 195 | DUF2216: Uncharacterized conserved proteins (DUF22 | 86.52 | |
| PF02994 | 370 | Transposase_22: L1 transposable element; InterPro: | 86.39 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 86.36 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 86.31 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 86.19 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 86.16 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 85.64 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 85.59 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 85.49 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 85.37 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 85.17 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 84.83 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 84.71 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 84.51 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 84.06 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 83.68 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 83.58 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 83.43 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 83.32 | |
| KOG4603 | 201 | consensus TBP-1 interacting protein [Signal transd | 83.27 | |
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 83.12 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 83.0 | |
| PF13166 | 712 | AAA_13: AAA domain | 82.99 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 82.92 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 82.81 | |
| KOG0240 | 607 | consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | 82.79 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 82.72 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 82.55 | |
| PF12709 | 87 | Kinetocho_Slk19: Central kinetochore-associated; I | 82.41 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 82.01 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 81.44 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 81.24 | |
| PRK06975 | 656 | bifunctional uroporphyrinogen-III synthetase/uropo | 81.13 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 81.11 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 81.09 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 81.04 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 80.87 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 80.59 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 80.07 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 80.01 |
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
Probab=99.66 E-value=1e-13 Score=154.29 Aligned_cols=181 Identities=21% Similarity=0.272 Sum_probs=174.5
Q ss_pred HHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHhhhhHHHHHhhhHHHHHHHHHHHHHHHH
Q 011828 111 LEGTVQQLQNECDLYKEKVQATLEETIQQLQRQNDLRMQKEATLEETIKQLRNQNDLHIQREGGLEMNIANLQSEKEFWL 190 (476)
Q Consensus 111 ~Ek~IkqLqeEi~~lkqkLE~llqEkIkQLq~E~~d~lQk~A~LE~tIKdLks~~es~~Qkea~LEeqIkqLe~EIs~~~ 190 (476)
-+..+.+|..++.++..+|..+..++ .|++++....+++.++++++|++|++++....|.+......+..|...|....
T Consensus 263 ~~d~~~~~~~~i~ele~~l~~l~~ek-eq~~a~~t~~~k~kt~lel~~kdlq~~i~~n~q~r~~~l~~l~~~~~ki~e~~ 341 (1200)
T KOG0964|consen 263 VEDESEDLKCEIKELENKLTNLREEK-EQLKARETKISKKKTKLELKIKDLQDQITGNEQQRNLALHVLQKVKDKIEEKK 341 (1200)
T ss_pred HHHHHHHHHhHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHhhhhhhhhHHHHHHhhhhhhhhhhHHHHHHHHHHHHHHHH
Confidence 34578899999999999999999999 99999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHH------------HHhhhhHhhhhh-chHHHHhhhHHHHHHHHHHHH
Q 011828 191 QKEAALEQKISQLRDESAALNMKRASLEERLKLL------------EADKDSWTQMES-VSKETIAGLSVDITQLRMQVV 257 (476)
Q Consensus 191 qEla~LepeiekL~~EeasLkQKLasLEeKL~~L------------KaERD~WLkkEI-sLke~IssL~~~i~sLq~QVe 257 (476)
.||+.++|+|..|.+++..++.+++.++.+++.| +.|||.|++.|| .++.-|...+.....|+.++.
T Consensus 342 ~EL~~I~Pky~~l~~ee~~~~~rl~~l~~~~~~l~~Kqgr~sqFssk~eRDkwir~ei~~l~~~i~~~ke~e~~lq~e~~ 421 (1200)
T KOG0964|consen 342 DELSKIEPKYNSLVDEEKRLKKRLAKLEQKQRDLLAKQGRYSQFSSKEERDKWIRSEIEKLKRGINDTKEQENILQKEIE 421 (1200)
T ss_pred HHHHHhhhHHHHHHhHHHHHHHHHHHHHHHHHHHHHhhccccccCcHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHH
Confidence 9999999999999999999999999999999988 899999999999 999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhh
Q 011828 258 ELEESRNNLLQENRQLKENVSSLRSQLSSDESKKL 292 (476)
Q Consensus 258 ~Leee~s~LeeEIq~LkeqIseLqs~lqeLeeei~ 292 (476)
.++..+....++++.+...+.+...++..+..++.
T Consensus 422 ~~e~~l~~~~e~i~~l~~si~e~~~r~~~~~~~~~ 456 (1200)
T KOG0964|consen 422 DLESELKEKLEEIKELESSINETKGRMEEFDAENT 456 (1200)
T ss_pred HHHHHHHHHHHHHHHHHhhHhhhhhHHHHHHHHHH
Confidence 99999999999999999999999999999987764
|
|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0993 consensus Rab5 GTPase effector Rabaptin-5 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain | Back alignment and domain information |
|---|
| >PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PRK06975 bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 476 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-16 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-16 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-11 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 9e-07 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 5e-04 | |
| 2xs1_A | 704 | Programmed cell death 6-interacting protein; prote | 5e-04 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 6e-04 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 8e-04 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 81.8 bits (202), Expect = 1e-16
Identities = 54/277 (19%), Positives = 112/277 (40%), Gaps = 23/277 (8%)
Query: 68 AESANLAEAERQHLLQREAMAILEETVKHLRNERESHIQKEATLEGTVQQLQNECDLYKE 127
AE+ AEAE + LEE + + E ++ L+ +++Q + +E
Sbjct: 903 AETELYAEAEEMRVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDLEE 962
Query: 128 KVQATLEETIQQLQRQNDLRMQKEATLEETIKQLRNQNDLHIQREGGLEMNIANLQSEKE 187
+++ E Q+LQ + K +E+ I + +QN+ + LE +++L +
Sbjct: 963 QLEE-EEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNL- 1020
Query: 188 FWLQKEAALEQKISQLRDESAALNMKRASLEERLKLLEADKDSWTQMESVSKETIAGLSV 247
A E+K L + LE RLK E + ++ L
Sbjct: 1021 ------AEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQEL-------EKIKRKLEG 1067
Query: 248 DITQLRMQVVELEESRNNLLQENRQLKENVSSLRSQLSSDESKKLQHATSEQKDFSTQI- 306
+ + L Q+ EL+ L + + +E + + ++L DE+ + +A + ++ + I
Sbjct: 1068 ESSDLHEQIAELQAQIAELKAQLAKKEEELQAALARLE-DETSQKNNALKKIRELESHIS 1126
Query: 307 ------EAAGALIDKLITENIELVEKVNDLSVKLDRQ 337
E+ A +K + +L E++ L +L+
Sbjct: 1127 DLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDT 1163
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Length = 464 | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Length = 464 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 476 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.95 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.88 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.37 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.27 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.36 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.27 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.25 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.21 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.18 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 96.62 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.48 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.47 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 96.47 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.39 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.38 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 95.93 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 95.31 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 94.85 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 94.64 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 94.46 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 94.31 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 93.96 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 93.78 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 93.56 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 93.4 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 92.89 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 92.28 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 91.86 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 91.84 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 91.72 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 91.22 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 91.17 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 91.06 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 91.02 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 90.54 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 89.82 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 89.64 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 89.33 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 88.52 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 88.22 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 87.63 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 87.13 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 86.96 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 86.34 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 86.27 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 85.98 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 85.49 | |
| 1z2t_A | 26 | Anchor peptide Ser65-Leu87 of ALMGS; lipid binding | 85.24 | |
| 3trt_A | 77 | Vimentin; cytoskeleton, intermediate filament, alp | 85.06 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 85.0 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 84.79 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 84.48 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 84.48 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 83.84 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 82.57 | |
| 1fxk_A | 107 | Prefoldin; archaeal protein, chaperone; 2.30A {Met | 82.33 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 82.28 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 82.24 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 82.08 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 81.8 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 81.41 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 81.32 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
Probab=98.95 E-value=1.6e-05 Score=72.09 Aligned_cols=127 Identities=12% Similarity=0.129 Sum_probs=52.0
Q ss_pred HHHHHHHhhhhhhhhhhhHhhHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHhhhhHHH
Q 011828 90 LEETVKHLRNERESHIQKEATLEGTVQQLQNECDLYKEKVQATLEETIQQLQRQNDLRMQKEATLEETIKQLRNQNDLHI 169 (476)
Q Consensus 90 ~eeti~~l~~e~d~~~~~e~~~Ek~IkqLqeEi~~lkqkLE~llqEkIkQLq~E~~d~lQk~A~LE~tIKdLks~~es~~ 169 (476)
+...+..|..+....-..-.-++..+..+..++..+...+..+ ...+..++.+...+......++..+..+........
T Consensus 18 ~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 96 (284)
T 1c1g_A 18 ALDRADEAEADKKAAEDRSKQLEDELVSLQKKLKATEDELDKY-SEALKDAQEKLELAEKKATDAEADVASLNRRIQLFE 96 (284)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 3333333433333333333334444444444444444443322 222244444444444444444444444444444444
Q ss_pred HHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhH
Q 011828 170 QREGGLEMNIANLQSEKEFWLQKEAALEQKISQLRDESAALNMKRASL 217 (476)
Q Consensus 170 Qkea~LEeqIkqLe~EIs~~~qEla~LepeiekL~~EeasLkQKLasL 217 (476)
.....+...+..+...+.....++..+...+..+......+...+..+
T Consensus 97 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~ 144 (284)
T 1c1g_A 97 EELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQ 144 (284)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHH
Confidence 444444444444444444443344444333333333333333333333
|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1z2t_A Anchor peptide Ser65-Leu87 of ALMGS; lipid binding protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 476 | |||
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 89.98 |
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Four-helical up-and-down bundle superfamily: MW0975(SA0943)-like family: MW0975(SA0943)-like domain: Hypothetical protein MW0975 (SA0943) species: Staphylococcus aureus [TaxId: 1280]
Probab=89.98 E-value=3.3 Score=32.06 Aligned_cols=44 Identities=5% Similarity=0.070 Sum_probs=19.8
Q ss_pred HHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 011828 239 KETIAGLSVDITQLRMQVVELEESRNNLLQENRQLKENVSSLRS 282 (476)
Q Consensus 239 ke~IssL~~~i~sLq~QVe~Leee~s~LeeEIq~LkeqIseLqs 282 (476)
...+......+..+...+..+......+...+..+...+..+..
T Consensus 136 ~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~ 179 (185)
T d2ap3a1 136 FKYLNQNDATQQGVNEKSKAIEQNYKKLKEVSDKYTKVLNKVQK 179 (185)
T ss_dssp HHHHTSTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHhhHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 33444444444444444444444444444444444444444333
|