Citrus Sinensis ID: 011852

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470------
MESNLYFSQNLGFRTVEHPDSTLRPLLYTKRRHFNRVLVLASSAQTVGGVSVNPVYKPTPRNRELRTPHSGYHFDGSTRRFFEGWYFRVSIPERKQSFCIIYSVENPAFKKKLSSLEVAQHGPRFTGVGVQILGADDKYMCHYSEESSNFWGSRHELMLGNTFRADKGSQPPTKEVPPQEFNRRVLEGFQVTPLWHQGCIHDDGRTNFAETVKSARWEYSTRPVYGWGNVGSKQNSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFQDAPSYSEKNWGGAFPRKWFWVQCNVFEGATGEVALTAGGGLRQLPVLDSFENAAMIGIHYDGILYEFVPWNGVVSWEISQWGYWYFAAENQTHMVELKATTKYPGTTLRAPTSEAGLAPACKDTCFGELTLQLWERRYDGTKGKMILDVTSDMAALEVGGGPWFNTWKAKTATPELLRRTLNVPVDVDGLFGFVPFFKPPGL
ccccccccccccccccccccccccccccccccccccEEEEccccCECcccccccccccccccccccccccccccccccccccEEEEEEEEcccccCEEEEEEEECccccccccccHHHHccccccccCEEEEEcccccEEEEcccccccccccccEEEEccCCcccccccccccccccccccccccccCEEccccccCEECcccccccccccccEEEEEEEEcccccccccccccccccccccccccccccEEEEccccEEEEEEEccEEEEEcccccccccccccccccccEEEEEcccccccccEEEEEcccccccccccccccEEEEEEEEccEEEEEEcccccEEEEEEEccEEEEEEEcccEEEEEEEECcccccEECcccccccccccccccccEEEEEEEEEEECcccccEEEEEEEEcEEEEEECccccccccCCccccHHHHHHHcccccccccccccccccccccc
******F*QNLGFRTVEHPDSTLRPLLYTKRRHFNRVLVL*********VSVNPVY*********RTPHSGYHFDGSTRRFFEGWYFRVSIPERKQSFCIIYSVENPAFKKKLSSLEVAQHGPRFTGVGVQILGADDKYMCHYSEESSNFWGSRHELMLGNTFRADKGSQPPTKEVPPQEFNRRVLEGFQVTPLWHQGCIHDDGRTNFAETVKSARWEYSTRPVYGWGNVGSKQNSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFQDAPSYSEKNWGGAFPRKWFWVQCNVFEGATGEVALTAGGGLRQLPVLDSFENAAMIGIHYDGILYEFVPWNGVVSWEISQWGYWYFAAENQTHMVELKATTKYPGTTLRAPTSEAGLAPACKDTCFGELTLQLWERRYDGTKGKMILDVTSDMAALEVGGGPWFNTWKAKTATPELLRRTLNVPVDVDGLFGFVPFFKPPG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESNLYFSQNLGFRTVEHPDSTLRPLLYTKRRHFNRVLVLASSAQTVGGVSVNPVYKPTPRNRELRTPHSGYHFDGSTRRFFEGWYFRVSIPERKQSFCIIYSVENPAFKKKLSSLEVAQHGPRFTGVGVQILGADDKYMCHYSEESSNFWGSRHELMLGNTFRADKGSQPPTKEVPPQEFNRRVLEGFQVTPLWHQGCIHDDGRTNFAETVKSARWEYSTRPVYGWGNVGSKQNSTAGWLAAFPVFEPHWQICMAGGLSTGWIEWDGERFEFQDAPSYSEKNWGGAFPRKWFWVQCNVFEGATGEVALTAGGGLRQLPVLDSFENAAMIGIHYDGILYEFVPWNGVVSWEISQWGYWYFAAENQTHMVELKATTKYPGTTLRAPTSEAGLAPACKDTCFGELTLQLWERRYDGTKGKMILDVTSDMAALEVGGGPWFNTWKAKTATPELLRRTLNVPVDVDGLFGFVPFFKPPGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tocopherol cyclase, chloroplastic Involved in the synthesis of both tocopherols and tocotrienols (vitamin E), which presumably protect photosynthetic complexes from oxidative stress. Catalyzes the conversion of 2-methyl-6-phytyl-1,4-hydroquinone and 2,3-dimethyl-5-phytyl-1,4-hydroquinone (DMPQ) to delta- and gamma-tocopherol respectively. Converts also 2,3-dimethyl-5-geranylgeranyl-1,4-hydroquinone (DMGQ) to gamma-tocotrienol.confidentQ94FY7
Probable tocopherol cyclase, chloroplastic Involved in the synthesis of both tocopherols and tocotrienols (vitamin E), which presumably protect photosynthetic complexes from oxidative stress. Catalyzes the conversion of 2-methyl-6-phytyl-1,4-hydroquinone and 2,3-dimethyl-5-phytyl-1,4-hydroquinone (DMPQ) to delta- and gamma-tocopherol respectively. Converts also 2,3-dimethyl-5-geranylgeranyl-1,4-hydroquinone (DMGQ) to gamma-tocotrienol.confidentQ6K7V6
Probable tocopherol cyclase, chloroplastic Involved in the synthesis of both tocopherols and tocotrienols (vitamin E), which presumably protect photosynthetic complexes from oxidative stress. Catalyzes the conversion of 2-methyl-6-phytyl-1,4-hydroquinone and 2,3-dimethyl-5-phytyl-1,4-hydroquinone (DMPQ) to delta- and gamma-tocopherol respectively. Converts also 2,3-dimethyl-5-geranylgeranyl-1,4-hydroquinone (DMGQ) to gamma-tocotrienol.probableQ94FY8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ICH, chain A
Confidence level:probable
Coverage over the Query: 56-178,189-203,214-312
View the alignment between query and template
View the model in PyMOL