Citrus Sinensis ID: 011855
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 476 | ||||||
| 224116766 | 502 | predicted protein [Populus trichocarpa] | 1.0 | 0.948 | 0.671 | 0.0 | |
| 255557435 | 474 | conserved hypothetical protein [Ricinus | 0.985 | 0.989 | 0.689 | 0.0 | |
| 225463384 | 484 | PREDICTED: uncharacterized protein LOC10 | 0.997 | 0.981 | 0.663 | 1e-170 | |
| 297740632 | 479 | unnamed protein product [Vitis vinifera] | 0.987 | 0.981 | 0.660 | 1e-167 | |
| 224116454 | 377 | predicted protein [Populus trichocarpa] | 0.785 | 0.992 | 0.753 | 1e-161 | |
| 356530555 | 470 | PREDICTED: uncharacterized protein LOC10 | 0.981 | 0.993 | 0.601 | 1e-154 | |
| 356556521 | 471 | PREDICTED: uncharacterized protein LOC10 | 0.983 | 0.993 | 0.594 | 1e-154 | |
| 147839779 | 482 | hypothetical protein VITISV_035567 [Viti | 0.880 | 0.869 | 0.657 | 1e-145 | |
| 449433585 | 484 | PREDICTED: uncharacterized protein LOC10 | 0.995 | 0.979 | 0.565 | 1e-145 | |
| 357450579 | 469 | CTD small phosphatase-like protein [Medi | 0.976 | 0.991 | 0.579 | 1e-143 |
| >gi|224116766|ref|XP_002331872.1| predicted protein [Populus trichocarpa] gi|222875390|gb|EEF12521.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 650 bits (1677), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 337/502 (67%), Positives = 393/502 (78%), Gaps = 26/502 (5%)
Query: 1 MPSLKMKTKSSAGSIKEKYGLHVCVKSSVISKKSCSHVRISQQTAEFDSCSGDCSD--VS 58
MPSLKMKT + S++EK L VC KS+++SKKSCS V +S+Q AE D C C D V+
Sbjct: 1 MPSLKMKTNLNMSSLREKKCLSVCQKSNILSKKSCSQVPVSRQAAESDKCVQKCQDGYVA 60
Query: 59 SSMEASTLG--FNCEDGIRHRELVDEESSHFQVQPPIFVDSTTIGRMEPTHICSSDLETI 116
SSME T G ++ + ++L + +S F QPP VDS T G ME + +S+LETI
Sbjct: 61 SSMEIYTQGEDIKTDEAVDQQDLPRDGNSQFLKQPPTSVDSGTTGDMESIYNFASNLETI 120
Query: 117 FSPILEPVEIFCGSNVDYAAGNNEGSRVPGVGTDDGDDNRSSCDYQTCNVSDFFISDMII 176
FSP+LE +E+ +N+ AG+N VPG+G DD DDNRSSCDYQTCN+SDFFISDMII
Sbjct: 121 FSPVLELIEVHSVANIYDDAGSNSDLNVPGLGIDDSDDNRSSCDYQTCNISDFFISDMII 180
Query: 177 ASLPLDGNADV--ITETNPFPDYKCAEPNMFFDVADECMMLPFLEDTAKSSNTIDVKSHE 234
ASLP DG+ V T+ NPFPDYK AEP+M FDVA+ECM+LPFLEDTAK S++ D+KS E
Sbjct: 181 ASLPFDGSTVVNDFTDANPFPDYKYAEPSMLFDVAEECMILPFLEDTAKMSDSDDMKSCE 240
Query: 235 VASIEQDNGSLYLAINQMKSFNQESDVNANSDQAQHFDPQFFIKYLPELSDI-ANFRPTA 293
A+I+ DN SLYLAINQ++S ++ESD+N +SDQA+ FDPQFFIK LPELSD+ +NF P+
Sbjct: 241 EATIDSDNSSLYLAINQIRSCDRESDLNIDSDQAEDFDPQFFIKNLPELSDVVSNFLPSI 300
Query: 294 SPKETQGRKSVTLVLDLDE-------------------TLVHSTLEYCDDADFTFTVFFN 334
PKE+ RKSVTLVLDLDE TLVHSTLE+CDDADFTFTVFFN
Sbjct: 301 HPKESCRRKSVTLVLDLDELCPMYNTKVELQMAFLFSETLVHSTLEHCDDADFTFTVFFN 360
Query: 335 MKEHTVYVKQRPHLKTFLERVAEMFEVVIFTASQSIYAAQLLDILDPDGKLISRRVYRES 394
MKEH VYVKQRPHL TFLERVAEMFEVVIFTASQSIYAAQLLDILDPD KLIS+R+YRES
Sbjct: 361 MKEHIVYVKQRPHLHTFLERVAEMFEVVIFTASQSIYAAQLLDILDPDRKLISQRLYRES 420
Query: 395 CIFSDGTYTKDLTVLGVDLAKVAIIDNSPQVFRLQVNNGIPIESWFDDPSDCSLISLLPF 454
CIFSDG+YTKDLTVLGVDLAKVAIIDNSPQVFRLQVNNGIPI+SWF DPSDC+LISLLPF
Sbjct: 421 CIFSDGSYTKDLTVLGVDLAKVAIIDNSPQVFRLQVNNGIPIKSWFTDPSDCALISLLPF 480
Query: 455 LDILADAEDVRPIIAKTFGNKE 476
L+ L DA+DVRPIIAK FGNKE
Sbjct: 481 LETLVDADDVRPIIAKRFGNKE 502
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255557435|ref|XP_002519748.1| conserved hypothetical protein [Ricinus communis] gi|223541165|gb|EEF42721.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225463384|ref|XP_002271705.1| PREDICTED: uncharacterized protein LOC100258847 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297740632|emb|CBI30814.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224116454|ref|XP_002317305.1| predicted protein [Populus trichocarpa] gi|222860370|gb|EEE97917.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356530555|ref|XP_003533846.1| PREDICTED: uncharacterized protein LOC100786602 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356556521|ref|XP_003546573.1| PREDICTED: uncharacterized protein LOC100799803 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147839779|emb|CAN65912.1| hypothetical protein VITISV_035567 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449433585|ref|XP_004134578.1| PREDICTED: uncharacterized protein LOC101215257 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357450579|ref|XP_003595566.1| CTD small phosphatase-like protein [Medicago truncatula] gi|355484614|gb|AES65817.1| CTD small phosphatase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 476 | ||||||
| TAIR|locus:2170458 | 456 | SSP4 "SCP1-like small phosphat | 0.798 | 0.833 | 0.534 | 4.5e-98 | |
| TAIR|locus:2117661 | 446 | SSP4b "SCP1-like small phospha | 0.720 | 0.769 | 0.527 | 6.9e-96 | |
| TAIR|locus:2143019 | 305 | SSP5 "SCP1-like small phosphat | 0.443 | 0.691 | 0.566 | 9e-61 | |
| DICTYBASE|DDB_G0290365 | 567 | ctdspl2 "CTD small phosphatase | 0.588 | 0.493 | 0.369 | 1.2e-44 | |
| ZFIN|ZDB-GENE-030131-1809 | 460 | ctdspl2b "CTD (carboxy-termina | 0.424 | 0.439 | 0.448 | 1e-43 | |
| ZFIN|ZDB-GENE-061013-647 | 469 | ctdspl2a "CTD (carboxy-termina | 0.424 | 0.430 | 0.448 | 1e-43 | |
| UNIPROTKB|E1B8W1 | 466 | CTDSPL2 "Uncharacterized prote | 0.424 | 0.433 | 0.448 | 2.8e-43 | |
| UNIPROTKB|F6XTC9 | 466 | CTDSPL2 "Uncharacterized prote | 0.424 | 0.433 | 0.448 | 2.8e-43 | |
| UNIPROTKB|Q05D32 | 466 | CTDSPL2 "CTD small phosphatase | 0.424 | 0.433 | 0.448 | 2.8e-43 | |
| UNIPROTKB|F1SN06 | 405 | F1SN06 "Uncharacterized protei | 0.424 | 0.498 | 0.448 | 2.8e-43 |
| TAIR|locus:2170458 SSP4 "SCP1-like small phosphatase 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 974 (347.9 bits), Expect = 4.5e-98, P = 4.5e-98
Identities = 215/402 (53%), Positives = 274/402 (68%)
Query: 78 ELVDEESSHFQVQPPIFVD-STTIGRMEPTHICSSDLETIFSPILEPVEIFCGSNVDYAA 136
E++ E++S Q P +VD S ++ ME S+ +TIFSP+L E+ G+ + A
Sbjct: 74 EMLVEDTSQSQGFAP-WVDGSQSVENMENACNHMSNSDTIFSPVLND-ELD-GTGRVFTA 130
Query: 137 GNNEGSRVPGVGTDDGDDNRSSCDYQTCNVSDFFISDMIIASLPLD--GNADVITETNPF 194
GN+ P G D+ N+ D QTCNVSDF+ISD++IASLP D GN D TE +P
Sbjct: 131 GNSVIWETPRWGADESS-NKICFDNQTCNVSDFYISDVLIASLPFDESGNNDAFTEISPL 189
Query: 195 PDYKCAEPNMFFDVADECMMLPFLEDTAKSSNTIDVKSHEVASIEQDNGSLYLAINQMKS 254
P Y +F ++ M+LP+LED S+N D+KS + I DN L+LA N+ +S
Sbjct: 190 PHY------IF---PEQYMVLPYLEDG--SANKDDIKS-DTDKINLDNHDLFLAFNRTRS 237
Query: 255 FNQESDVNANSDQAQHFDPQFFIKYLPELSDIANFRPTASPKETQGRKSXXXXXXXXXXX 314
+N E D A S+ A+ FDPQ FIK PELSD+ + P++T +KS
Sbjct: 238 YNVEPDDRAESEVAEDFDPQLFIKNQPELSDVVS---NYWPRDTLRKKSVTLVLDLDETL 294
Query: 315 XHSTLEYCDDADFTFTVFFNMKEHTVYVKQRPHLKTFLERVAEMFEVVIFTASQSIYAAQ 374
HSTLE C+ ADF+F VFFNM+E+TVYV+QRPHL FLERV E+F VVIFTAS SIYA+Q
Sbjct: 295 VHSTLESCNVADFSFRVFFNMQENTVYVRQRPHLYRFLERVGELFHVVIFTASHSIYASQ 354
Query: 375 LLDILDPDGKLISRRVYRESCIFSDGTYTKDLTVLGVDLAKVAIIDNSPQVFRLQVNNGI 434
LLDILDPDGK IS+R YR+SCI DG YTKDLTVLG+DLAKVAIIDN PQV+RLQ+NNGI
Sbjct: 355 LLDILDPDGKFISQRFYRDSCILLDGIYTKDLTVLGLDLAKVAIIDNCPQVYRLQINNGI 414
Query: 435 PIESWFDDPSDCSLISLLPFLDILADAEDVRPIIAKTFGNKE 476
PI+SW+DDP+D LI++LPFL+ LA A+DVRPII + FGNKE
Sbjct: 415 PIKSWYDDPTDDGLITILPFLETLAVADDVRPIIGRRFGNKE 456
|
|
| TAIR|locus:2117661 SSP4b "SCP1-like small phosphatase 4b" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2143019 SSP5 "SCP1-like small phosphatase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0290365 ctdspl2 "CTD small phosphatase-like protein 2" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-1809 ctdspl2b "CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-061013-647 ctdspl2a "CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B8W1 CTDSPL2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6XTC9 CTDSPL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q05D32 CTDSPL2 "CTD small phosphatase-like protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SN06 F1SN06 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 476 | |||
| TIGR02251 | 162 | TIGR02251, HIF-SF_euk, Dullard-like phosphatase do | 1e-74 | |
| pfam03031 | 153 | pfam03031, NIF, NLI interacting factor-like phosph | 5e-66 | |
| smart00577 | 148 | smart00577, CPDc, catalytic domain of ctd-like pho | 1e-58 | |
| COG5190 | 390 | COG5190, FCP1, TFIIF-interacting CTD phosphatases, | 2e-40 | |
| TIGR02250 | 156 | TIGR02250, FCP1_euk, FCP1-like phosphatase, phosph | 2e-21 | |
| COG5190 | 390 | COG5190, FCP1, TFIIF-interacting CTD phosphatases, | 0.004 |
| >gnl|CDD|233801 TIGR02251, HIF-SF_euk, Dullard-like phosphatase domain | Back alignment and domain information |
|---|
Score = 231 bits (591), Expect = 1e-74
Identities = 92/161 (57%), Positives = 119/161 (73%), Gaps = 1/161 (0%)
Query: 304 VTLVLDLDETLVHSTLEYCD-DADFTFTVFFNMKEHTVYVKQRPHLKTFLERVAEMFEVV 362
TLVLDLDETLVHST + DADF V + K VYV +RPH+ FLERV++ +E+V
Sbjct: 2 KTLVLDLDETLVHSTFKMPKVDADFKVPVLIDGKIIPVYVFKRPHVDEFLERVSKWYELV 61
Query: 363 IFTASQSIYAAQLLDILDPDGKLISRRVYRESCIFSDGTYTKDLTVLGVDLAKVAIIDNS 422
IFTAS YA +LDILD GK+ISRR+YRESC+F++G Y KDL+++G DL+KV IIDNS
Sbjct: 62 IFTASLEEYADPVLDILDRGGKVISRRLYRESCVFTNGKYVKDLSLVGKDLSKVIIIDNS 121
Query: 423 PQVFRLQVNNGIPIESWFDDPSDCSLISLLPFLDILADAED 463
P + LQ +N IPI+SWF DP+D L++L+PFL+ L +D
Sbjct: 122 PYSYSLQPDNAIPIKSWFGDPNDTELLNLIPFLEGLRFEDD 162
|
This model represents the putative phosphatase domain of a family of eukaryotic proteins including "Dullard" , and the NLI interacting factor (NIF)-like phosphatases. This domain is a member of the haloacid dehalogenase (HAD) superfamily by virtue of a conserved set of three catalytic motifs and a conserved fold as predicted by PSIPRED. The third motif in this family is distinctive (hhhhDNxPxxa) and aparrently lacking the last aspartate. This domain is classified as a "Class III" HAD, since there is no large "cap" domain found between motifs 1 and 2 or motifs 2 and 3. This domain is related to domains found in FCP1-like phosphatases (TIGR02250), and together both are detected by the pfam03031. Length = 162 |
| >gnl|CDD|217328 pfam03031, NIF, NLI interacting factor-like phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >gnl|CDD|227517 COG5190, FCP1, TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|131304 TIGR02250, FCP1_euk, FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >gnl|CDD|227517 COG5190, FCP1, TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 476 | |||
| KOG1605 | 262 | consensus TFIIF-interacting CTD phosphatase, inclu | 100.0 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 100.0 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 100.0 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 100.0 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 99.97 | |
| KOG2832 | 393 | consensus TFIIF-interacting CTD phosphatase, inclu | 99.97 | |
| COG5190 | 390 | FCP1 TFIIF-interacting CTD phosphatases, including | 99.95 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 99.94 | |
| KOG0323 | 635 | consensus TFIIF-interacting CTD phosphatases, incl | 99.76 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 98.58 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 98.47 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 98.43 | |
| COG5190 | 390 | FCP1 TFIIF-interacting CTD phosphatases, including | 98.29 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 98.22 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 98.21 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 98.18 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 98.15 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 98.1 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 98.05 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 98.04 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 98.02 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 98.01 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 97.9 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 97.9 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 97.88 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 97.88 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 97.84 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 97.83 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 97.81 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 97.78 | |
| PLN02940 | 382 | riboflavin kinase | 97.69 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 97.59 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 97.51 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 97.51 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 97.44 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 97.37 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 97.36 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 97.34 | |
| PRK06769 | 173 | hypothetical protein; Validated | 97.32 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 97.28 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 97.28 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 97.27 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 97.26 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 97.26 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 97.25 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 97.24 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 97.22 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 97.21 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 97.2 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 97.14 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 97.11 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 97.1 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 97.09 | |
| PLN02954 | 224 | phosphoserine phosphatase | 97.07 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 97.04 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 96.97 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 96.94 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 96.91 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 96.91 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 96.86 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 96.84 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 96.79 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 96.77 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 96.73 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 96.68 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 96.62 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 96.58 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 96.5 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 96.45 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 96.42 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 96.39 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 96.38 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 96.36 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 96.29 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 96.27 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 96.25 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 96.22 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 96.2 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 96.2 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 96.18 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 96.16 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 96.15 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 96.13 | |
| PRK08238 | 479 | hypothetical protein; Validated | 96.12 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 96.11 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 95.94 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 95.78 | |
| PLN02811 | 220 | hydrolase | 95.77 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 95.51 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 95.38 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 95.27 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 95.15 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 95.07 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 94.99 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 94.89 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 94.76 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 94.69 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 94.66 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 94.54 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 94.49 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 94.41 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 94.37 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 94.34 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 94.33 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 94.22 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 94.07 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 93.94 | |
| KOG2914 | 222 | consensus Predicted haloacid-halidohydrolase and r | 93.93 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 93.83 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 93.74 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 93.72 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 93.68 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 93.24 | |
| PF06941 | 191 | NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol | 93.07 | |
| COG3882 | 574 | FkbH Predicted enzyme involved in methoxymalonyl-A | 92.95 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 92.91 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 92.56 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 92.54 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 92.49 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 92.43 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 92.19 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 92.07 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 91.75 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 91.73 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 91.73 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 91.52 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 91.24 | |
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 91.09 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 91.03 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 90.7 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 90.13 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 90.03 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 89.97 | |
| PLN02423 | 245 | phosphomannomutase | 89.64 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 89.08 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 88.92 | |
| PLN02887 | 580 | hydrolase family protein | 88.45 | |
| COG4502 | 180 | 5'(3')-deoxyribonucleotidase [Nucleotide transport | 88.22 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 87.14 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 85.76 | |
| COG2503 | 274 | Predicted secreted acid phosphatase [General funct | 85.28 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 85.28 | |
| PLN02151 | 354 | trehalose-phosphatase | 85.27 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 84.87 | |
| PLN02580 | 384 | trehalose-phosphatase | 84.39 | |
| PLN03017 | 366 | trehalose-phosphatase | 84.32 | |
| KOG3120 | 256 | consensus Predicted haloacid dehalogenase-like hyd | 82.28 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 82.17 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 81.95 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 81.42 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 80.96 | |
| TIGR02244 | 343 | HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd | 80.43 |
| >KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-47 Score=379.71 Aligned_cols=180 Identities=59% Similarity=0.969 Sum_probs=172.7
Q ss_pred CCccCCCCceEEEEecCccccccc--ccccCCCCceEEEEeccccceEEEeeCchHHHHHHHhhcccEEEEEcCCcHHHH
Q 011855 295 PKETQGRKSVTLVLDLDETLVHST--LEYCDDADFTFTVFFNMKEHTVYVKQRPHLKTFLERVAEMFEVVIFTASQSIYA 372 (476)
Q Consensus 295 P~~~~~~kk~tLVLDLDeTLVhSs--~~~~~~~df~~~v~~~~~~~~~~V~lRPgl~eFLe~Lsk~YEIVIfTAs~~~YA 372 (476)
|......+|++|||||||||||++ ..+...++|.+++.+++..+.+||.+|||+++||++++++||++||||+.+.||
T Consensus 81 ~~~~~~~~kk~lVLDLDeTLvHss~~~~~~~~~d~~~~v~~~~~~~~~yV~kRP~vdeFL~~~s~~~e~v~FTAs~~~Ya 160 (262)
T KOG1605|consen 81 PLRLATVGRKTLVLDLDETLVHSSLNLKPIVNADFTVPVEIDGHIHQVYVRKRPHVDEFLSRVSKWYELVLFTASLEVYA 160 (262)
T ss_pred CcccccCCCceEEEeCCCcccccccccCCCCCcceeeeeeeCCcceEEEEEcCCCHHHHHHHhHHHHHHHHHHhhhHHHH
Confidence 344557889999999999999999 777789999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHCCCCCeeeeEEEcccceeeCCceeecccccCCCCCcEEEEECCchhhccCCCceeeeccccCCCCchHHHHHH
Q 011855 373 AQLLDILDPDGKLISRRVYRESCIFSDGTYTKDLTVLGVDLAKVAIIDNSPQVFRLQVNNGIPIESWFDDPSDCSLISLL 452 (476)
Q Consensus 373 ~~ILd~LDP~~~lF~~RLyRe~C~~~~g~yiKDLs~LGrdlskVVIIDDsp~s~~~q~~NgIpI~~f~gd~~D~eLl~Ll 452 (476)
.+|++.|||.++.|.+|+||++|.+.+|.|+|||+.+|+++++||||||+|.+|.+||+|||||++|++++.|+||++|+
T Consensus 161 ~~v~D~LD~~~~i~~~RlyR~~C~~~~g~yvKdls~~~~dL~~viIiDNsP~sy~~~p~NgIpI~sw~~d~~D~eLL~Ll 240 (262)
T KOG1605|consen 161 DPLLDILDPDRKIISHRLYRDSCTLKDGNYVKDLSVLGRDLSKVIIVDNSPQSYRLQPENGIPIKSWFDDPTDTELLKLL 240 (262)
T ss_pred HHHHHHccCCCCeeeeeecccceEeECCcEEEEcceeccCcccEEEEcCChHHhccCccCCCcccccccCCChHHHHHHH
Confidence 99999999988899999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhccCCCCcHHHHHhhhCC
Q 011855 453 PFLDILADAEDVRPIIAKTFGN 474 (476)
Q Consensus 453 pfLe~L~~~dDVR~~L~krf~~ 474 (476)
|||+.|+..+|||++++++|+.
T Consensus 241 pfLe~L~~~~Dvr~~l~~~~~~ 262 (262)
T KOG1605|consen 241 PFLEALAFVDDVRPILARRFGN 262 (262)
T ss_pred HHHHHhcccccHHHHHHHhhcC
Confidence 9999999999999999999974
|
|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >KOG2832 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] | Back alignment and domain information |
|---|
| >COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins | Back alignment and domain information |
|---|
| >COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >COG4502 5'(3')-deoxyribonucleotidase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >COG2503 Predicted secreted acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 476 | ||||
| 3l0y_A | 184 | Crystal Structure Of Scp1 Phosphatase D98a Mutant L | 8e-32 | ||
| 1ta0_A | 197 | Three-Dimensional Structure Of A Rna-Polymerase Ii | 8e-32 | ||
| 2ghq_A | 181 | Ctd-Specific Phosphatase Scp1 In Complex With Pepti | 1e-31 | ||
| 3pgl_A | 180 | Crystal Structure Of Human Small C-Terminal Domain | 1e-31 | ||
| 2q5e_A | 187 | Crystal Structure Of Human Carboxy-Terminal Domain | 4e-31 | ||
| 1t9z_A | 197 | Three-Dimensional Structure Of A Rna-Polymerase Ii | 5e-31 | ||
| 3l0b_A | 184 | Crystal Structure Of Scp1 Phosphatase D206a Mutant | 5e-31 | ||
| 3l0c_A | 184 | Crystal Structure Of Scp1 Phosphatase D206a Mutant | 5e-31 | ||
| 2hhl_A | 195 | Crystal Structure Of The Human Small Ctd Phosphatas | 8e-31 | ||
| 3qle_A | 204 | Structural Basis For The Function Of Tim50 In The M | 9e-23 | ||
| 3ef1_A | 442 | The Structure Of Fcp1, An Essential Rna Polymerase | 2e-06 | ||
| 3ef0_A | 372 | The Structure Of Fcp1, An Essential Rna Polymerase | 2e-06 |
| >pdb|3L0Y|A Chain A, Crystal Structure Of Scp1 Phosphatase D98a Mutant Length = 184 | Back alignment and structure |
|
| >pdb|1TA0|A Chain A, Three-Dimensional Structure Of A Rna-Polymerase Ii Binding Protein With Associated Ligand Length = 197 | Back alignment and structure |
| >pdb|2GHQ|A Chain A, Ctd-Specific Phosphatase Scp1 In Complex With Peptide C- Terminal Domain Of Rna Polymerase Ii Length = 181 | Back alignment and structure |
| >pdb|3PGL|A Chain A, Crystal Structure Of Human Small C-Terminal Domain Phosphatase 1 (Scp1) Bound To Rabeprazole Length = 180 | Back alignment and structure |
| >pdb|2Q5E|A Chain A, Crystal Structure Of Human Carboxy-Terminal Domain Rna Polymerase Ii Polypeptide A Small Phosphatase 2 Length = 187 | Back alignment and structure |
| >pdb|1T9Z|A Chain A, Three-Dimensional Structure Of A Rna-Polymerase Ii Binding Protein Length = 197 | Back alignment and structure |
| >pdb|3L0B|A Chain A, Crystal Structure Of Scp1 Phosphatase D206a Mutant Phosphory Intermediate Length = 184 | Back alignment and structure |
| >pdb|3L0C|A Chain A, Crystal Structure Of Scp1 Phosphatase D206a Mutant With Trap Inorganic Phosphate Length = 184 | Back alignment and structure |
| >pdb|2HHL|A Chain A, Crystal Structure Of The Human Small Ctd Phosphatase 3 Isoform 1 Length = 195 | Back alignment and structure |
| >pdb|3QLE|A Chain A, Structural Basis For The Function Of Tim50 In The Mitochondrial Presequence Translocase Length = 204 | Back alignment and structure |
| >pdb|3EF1|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 442 | Back alignment and structure |
| >pdb|3EF0|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 372 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 476 | |||
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 2e-79 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 2e-79 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 5e-71 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 2e-43 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 2e-40 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 7e-38 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 |
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181 | Back alignment and structure |
|---|
Score = 244 bits (624), Expect = 2e-79
Identities = 75/176 (42%), Positives = 111/176 (63%), Gaps = 1/176 (0%)
Query: 295 PKETQGRKSVTLVLDLDETLVHSTLEYCDDADFTFTVFFNMKEHTVYVKQRPHLKTFLER 354
+ Q + +V++LDETLVHS+ + ++ADF V + H VYV +RPH+ FL+R
Sbjct: 7 EAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQR 66
Query: 355 VAEMFEVVIFTASQSIYAAQLLDILDPDGKLISRRVYRESCIFSDGTYTKDLTVLGVDLA 414
+ E+FE V+FTAS + YA + D+LD G R++RESC+F G Y KDL+ LG DL
Sbjct: 67 MGELFECVLFTASLAKYADPVADLLDKWGA-FRARLFRESCVFHRGNYVKDLSRLGRDLR 125
Query: 415 KVAIIDNSPQVFRLQVNNGIPIESWFDDPSDCSLISLLPFLDILADAEDVRPIIAK 470
+V I+DNSP + +N +P+ SWFD+ SD L LLPF + L+ +DV ++ +
Sbjct: 126 RVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ 181
|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 476 | |||
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 100.0 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 100.0 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 100.0 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 100.0 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 99.98 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 99.97 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 98.61 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 98.49 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 98.47 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 98.38 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 98.36 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 98.33 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 98.3 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 98.2 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 98.17 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 98.11 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 98.04 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 98.04 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 98.03 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 98.03 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 98.01 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 98.0 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 98.0 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 97.99 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 97.98 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 97.96 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 97.91 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 97.88 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 97.87 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 97.82 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 97.77 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 97.75 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 97.74 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 97.72 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 97.72 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 97.71 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 97.7 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 97.69 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 97.67 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 97.66 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 97.64 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 97.59 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 97.58 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 97.56 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 97.55 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 97.51 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 97.49 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 97.45 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 97.43 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 97.41 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 97.38 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 97.25 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 97.24 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 97.21 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 97.2 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 97.19 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 96.95 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 96.91 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 96.87 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 96.87 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 96.85 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 96.85 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 96.81 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 96.8 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 96.74 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 96.67 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 96.66 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 96.65 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 96.63 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 96.63 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 96.45 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 96.44 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 96.43 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 96.39 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 96.39 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 96.37 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 96.36 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 96.35 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 96.34 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 96.34 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 96.34 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 96.23 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 96.21 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 95.93 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 95.86 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 95.81 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 95.78 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 95.75 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 95.75 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 95.68 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 95.58 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 95.5 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 95.47 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 95.43 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 95.4 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 95.38 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 95.35 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 95.32 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 95.12 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 94.94 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 94.87 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 94.84 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 94.77 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 94.74 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 94.7 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 94.69 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 94.56 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 94.53 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 94.52 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 94.43 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 94.41 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 94.35 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 94.3 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 94.18 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 94.18 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 93.96 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 93.96 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 93.95 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 93.95 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 93.92 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 93.68 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 93.57 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 93.57 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 92.52 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 93.27 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 93.25 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 93.2 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 93.11 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 93.09 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 92.87 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 92.6 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 92.56 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 92.51 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 92.14 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 91.75 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 91.61 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 91.6 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 91.56 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 91.36 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 90.86 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 90.74 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 90.72 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 90.66 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 90.36 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 90.32 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 90.05 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 89.68 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 87.16 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 86.56 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 86.29 |
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
Probab=100.00 E-value=8.8e-44 Score=339.70 Aligned_cols=160 Identities=37% Similarity=0.717 Sum_probs=148.4
Q ss_pred CCCCceEEEEecCcccccccccccCCCCceEEEEeccccceEEEeeCchHHHHHHHhhcccEEEEEcCCcHHHHHHHHHH
Q 011855 299 QGRKSVTLVLDLDETLVHSTLEYCDDADFTFTVFFNMKEHTVYVKQRPHLKTFLERVAEMFEVVIFTASQSIYAAQLLDI 378 (476)
Q Consensus 299 ~~~kk~tLVLDLDeTLVhSs~~~~~~~df~~~v~~~~~~~~~~V~lRPgl~eFLe~Lsk~YEIVIfTAs~~~YA~~ILd~ 378 (476)
..++|+||||||||||||+.|.+ .++|+|++|||+++||++|+++|||+||||+.+.||++|++.
T Consensus 30 ~~~~~~tLVLDLDeTLvh~~~~~---------------~~~~~v~~RPgl~eFL~~l~~~yeivI~Tas~~~ya~~vl~~ 94 (204)
T 3qle_A 30 PYQRPLTLVITLEDFLVHSEWSQ---------------KHGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEK 94 (204)
T ss_dssp --CCSEEEEEECBTTTEEEEEET---------------TTEEEEEECTTHHHHHHHHTTTEEEEEECSSCHHHHHHHHHH
T ss_pred ccCCCeEEEEeccccEEeeeccc---------------cCceeEEeCCCHHHHHHHHHhCCEEEEEcCCcHHHHHHHHHH
Confidence 56889999999999999998753 357899999999999999999999999999999999999999
Q ss_pred HCCCCCeeeeEEEcccceeeCCceeecccccCCCCCcEEEEECCchhhccCCCceeeeccccCCCCchHHHHHHHHHHhc
Q 011855 379 LDPDGKLISRRVYRESCIFSDGTYTKDLTVLGVDLAKVAIIDNSPQVFRLQVNNGIPIESWFDDPSDCSLISLLPFLDIL 458 (476)
Q Consensus 379 LDP~~~lF~~RLyRe~C~~~~g~yiKDLs~LGrdlskVVIIDDsp~s~~~q~~NgIpI~~f~gd~~D~eLl~LlpfLe~L 458 (476)
|||.+.+|.+|++|++|...+|.|+|||++|||++++||||||++.+|..|++|||+|++|.|++ |+||++|+|||+.|
T Consensus 95 LDp~~~~f~~rl~R~~c~~~~g~y~KdL~~Lgrdl~~vIiIDDsp~~~~~~p~N~I~I~~~~~~~-D~eL~~L~~~L~~L 173 (204)
T 3qle_A 95 LDPIHAFVSYNLFKEHCVYKDGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEA-DDKLVRLIPFLEYL 173 (204)
T ss_dssp TSTTCSSEEEEECGGGSEEETTEEECCGGGSCSCGGGEEEEESCTTTTTTCGGGEEECCCCCSSC-CCHHHHHHHHHHHH
T ss_pred hCCCCCeEEEEEEecceeEECCeeeecHHHhCCChHHEEEEECCHHHHhhCccCceEeeeECCCC-ChhHHHHHHHHHHH
Confidence 99998899999999999999999999999999999999999999999999999999999999876 67999999999999
Q ss_pred c--CCCCcHHHHHhhhCCC
Q 011855 459 A--DAEDVRPIIAKTFGNK 475 (476)
Q Consensus 459 ~--~~dDVR~~L~krf~~k 475 (476)
+ .++|||++| ++|+.+
T Consensus 174 ~~~~~~DVR~~L-~~~~~~ 191 (204)
T 3qle_A 174 ATQQTKDVRPIL-NSFEDK 191 (204)
T ss_dssp HHTCCSCSHHHH-TTSSCG
T ss_pred hhcChHHHHHHH-HHhcCC
Confidence 8 589999999 567653
|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 476 | ||||
| d1ta0a_ | 181 | c.108.1.16 (A:) Carboxy-terminal domain RNA polyme | 3e-59 |
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NLI interacting factor-like phosphatase domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 190 bits (484), Expect = 3e-59
Identities = 76/176 (43%), Positives = 111/176 (63%), Gaps = 1/176 (0%)
Query: 295 PKETQGRKSVTLVLDLDETLVHSTLEYCDDADFTFTVFFNMKEHTVYVKQRPHLKTFLER 354
+ Q + +V+DLDETLVHS+ + ++ADF V + H VYV +RPH+ FL+R
Sbjct: 7 EAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQR 66
Query: 355 VAEMFEVVIFTASQSIYAAQLLDILDPDGKLISRRVYRESCIFSDGTYTKDLTVLGVDLA 414
+ E+FE V+FTAS + YA + D+LD G R++RESC+F G Y KDL+ LG DL
Sbjct: 67 MGELFECVLFTASLAKYADPVADLLDKWGA-FRARLFRESCVFHRGNYVKDLSRLGRDLR 125
Query: 415 KVAIIDNSPQVFRLQVNNGIPIESWFDDPSDCSLISLLPFLDILADAEDVRPIIAK 470
+V I+DNSP + +N +P+ SWFD+ SD L LLPF + L+ +DV ++ +
Sbjct: 126 RVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ 181
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 476 | |||
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 100.0 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 98.84 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 98.45 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 98.39 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 98.31 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 98.29 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 98.27 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 98.21 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 98.12 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 98.04 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 97.98 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 97.93 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 97.83 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 97.83 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 97.72 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 97.69 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 97.68 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 97.63 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 97.61 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 97.51 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 97.5 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 97.41 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 97.35 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 97.17 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 97.15 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 97.08 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 96.71 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 96.46 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 96.32 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 96.04 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 95.95 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 95.9 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 95.63 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 95.36 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 95.24 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 95.08 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 94.92 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 94.83 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 94.77 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 94.76 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 94.4 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 94.29 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 94.21 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 94.07 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 93.67 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 93.51 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 93.46 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 93.23 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 93.02 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 87.96 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 85.14 |
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NLI interacting factor-like phosphatase domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=6.5e-47 Score=350.96 Aligned_cols=176 Identities=43% Similarity=0.777 Sum_probs=167.7
Q ss_pred CCCccCCCCceEEEEecCcccccccccccCCCCceEEEEeccccceEEEeeCchHHHHHHHhhcccEEEEEcCCcHHHHH
Q 011855 294 SPKETQGRKSVTLVLDLDETLVHSTLEYCDDADFTFTVFFNMKEHTVYVKQRPHLKTFLERVAEMFEVVIFTASQSIYAA 373 (476)
Q Consensus 294 ~P~~~~~~kk~tLVLDLDeTLVhSs~~~~~~~df~~~v~~~~~~~~~~V~lRPgl~eFLe~Lsk~YEIVIfTAs~~~YA~ 373 (476)
+|+.+..++|+|||||||||||||+..+....++.+.+.+......+||++|||+++||++|+++|||+|||||.+.||+
T Consensus 6 p~~~~~~~~k~~LVLDLDeTLihs~~~~~~~~~~~~~~~~~~~~~~~~v~~RP~l~eFL~~l~~~yei~I~Ta~~~~YA~ 85 (181)
T d1ta0a_ 6 PEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYAD 85 (181)
T ss_dssp CCCCGGGTTSCEEEECCBTTTEEEESSCCTTCSEEEEEEETTEEEEEEEEECTTHHHHHHHHHHHSEEEEECSSCHHHHH
T ss_pred CCCCcccCCCeEEEEeCCCCEEccccCCCCCccceeeecccceeeeeEEecCCCHHHHHHHHHhceEEEEEcCCcHHHHH
Confidence 44556678899999999999999999988899999999999888999999999999999999999999999999999999
Q ss_pred HHHHHHCCCCCeeeeEEEcccceeeCCceeecccccCCCCCcEEEEECCchhhccCCCceeeeccccCCCCchHHHHHHH
Q 011855 374 QLLDILDPDGKLISRRVYRESCIFSDGTYTKDLTVLGVDLAKVAIIDNSPQVFRLQVNNGIPIESWFDDPSDCSLISLLP 453 (476)
Q Consensus 374 ~ILd~LDP~~~lF~~RLyRe~C~~~~g~yiKDLs~LGrdlskVVIIDDsp~s~~~q~~NgIpI~~f~gd~~D~eLl~Llp 453 (476)
+|++.|||++ .|.+++||++|....+.++|||+++||++++||||||++.+|..|++|||+|++|+|+++|++|+.|++
T Consensus 86 ~il~~ldp~~-~~~~~~~r~~c~~~~~~~~KdL~~l~~~l~~vvivDd~~~~~~~~~~N~I~I~~f~~~~~D~eL~~l~~ 164 (181)
T d1ta0a_ 86 PVADLLDKWG-AFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLP 164 (181)
T ss_dssp HHHHHHCSSC-CEEEEECGGGSEEETTEEECCGGGSCSCGGGEEEECSCGGGGTTCGGGBCCCCCCSSCTTCCHHHHHHH
T ss_pred HHHHHhccCC-ceeEEEEeeeeeecCCcccccHhhcCCCHHHeEEEcCChhhhhcCccCeeEecCcCCCCCcHHHHHHHH
Confidence 9999999987 678999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHhccCCCCcHHHHHh
Q 011855 454 FLDILADAEDVRPIIAK 470 (476)
Q Consensus 454 fLe~L~~~dDVR~~L~k 470 (476)
||+.|+.++|||++|++
T Consensus 165 ~L~~l~~~~DVR~~l~~ 181 (181)
T d1ta0a_ 165 FFEQLSRVDDVYSVLRQ 181 (181)
T ss_dssp HHHHHTTCSCHHHHHCC
T ss_pred HHHHHccCCcHHHHhcC
Confidence 99999999999999963
|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|