Citrus Sinensis ID: 011864

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470------

MPAQKRSLQESHHANNGEQLQGEEQQRQDSFQQSHAKQSRHERQQLELQQNEQQQLEEDQKDDEEVEGEGDEEDEENEDDSEGPSSDTSGEKPEFVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALISALYPDIDKYEEEELAFHEEERTRNKQIQASIAKIFQRQSEALVKRRTPGKDTASPFMTRPQRNPRTAHLRRRRNSRGTEHQGSEDNEDENDDNGGKDSSSNDERSAEVRPRRRKRRSGIRSSQPSSSAANSDGGCIENDLEVGRESRGISPGLVWNPEMLAWGRGGTRSNTRHGSASGCNSKSSRSTRLNKLVEYLRSLQENNDELDVRLMLVSADTQCAPSLQQPYLCCQPSLSVKQLCETPLQAEEVEILMVKERLDAKGNQSTPIPTTDQLQILEGQETLAGLRVNHTSNTDHLILAYRQKQSR

cccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHHHHHHHHHcccccccccEEEEEEEEcccccccccccccCCccccccHHHHHccccccccEEEEEEEccccccccccccccccHHHHHcccccHHHHcccccccccccEEEEEEccccc

**********************************************************************************************FVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALISALYPDIDKYEEEELA*************************************************************************************************************************************ISPGLVWNPEMLAWG****************************LVEYLRSLQENNDELDVRLMLVSADTQCAPSLQQPYLCCQPSLSVKQLCETPLQAEEVEILMVKE******************QILEGQETLAGLRVNHTSNTDHLILAYRQK***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MPAQKRSLQESHHANNGEQLQGEEQQRQDSFQQSHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEGEGDEEDEENEDDSEGPSSDTSGEKPEFVFVELPEIRKDVQCPICLGIIKKTRTVMECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALISALYPDIDKYEEEELAFHEEERTRNKQIQASIAKIFQRQSEALVKRRTPGKDTASPFMTRPQRNPRTAHLRRRRNSRGTEHQGSEDNEDENDDNGGKDSSSNDERSAEVRPRRRKRRSGIRSSQPSSSAANSDGGCIENDLEVGRESRGISPGLVWNPEMLAWGRGGTRSNTRHGSASGCNSKSSRSTRxxxxxxxxxxxxxxxxxxxxxLMLVSADTQCAPSLQQPYLCCQPSLSVKQLCETPLQAEEVEILMVKERLDAKGNQSTPIPTTDQLQILEGQETLAGLRVNHTSNTDHLILAYRQKQSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Putative E3 ubiquitin-protein ligase RING1a	As part of the PRC1-like complex, repress class I KNOX gene expression. PcG PRC1 complex maintains the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility.	probable	Q9FKW0

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CKL, chain A
Confidence level:very confident
Coverage over the Query: 98-176
View the alignment between query and template
View the model in PyMOL

Template: 4EPO, chain C
Confidence level:probable
Coverage over the Query: 98-189
View the alignment between query and template
View the model in PyMOL

Template: 3H9D, chain A
Confidence level:probable
Coverage over the Query: 377-473
View the alignment between query and template
View the model in PyMOL