Citrus Sinensis ID: 011871


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470------
MAEAMMKQVNGGLAEKFGPVFDPTAVVAEPVPPVVTENGHELKHKTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFKAKLLQNKDKPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGSENCVCAAHK
cHHHHHHHHcccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccccccEEEEccHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHcccccccEEEEEEccccccccccccccccccccccccEEEEccccccccccccEEEEEEcccHHHHcccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccEEccccccEEEEEccccHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHccHHHHccccccccccccccccccccccccc
ccccHHHHcccccccccccccccccEcccccccccccccccccccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccccccEEEEccccHHHHHHHHHHHHHccccEEEEcHHHcHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHHcccccEEEEEEEccccccccccHHHHHHHHHHcccccccEEEEEEHHHHccccccccccccccccccccEEEEccccEEEEcccccEEEEEccHHcEEcccHHHHHccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccEccccccEEEEEEccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHcHHcccccccccccHHHHccccccccccc
MAEAMMKQVNgglaekfgpvfdptavvaepvppvvtenghelkhkTAEKEIVlgknvhascfsvtepeaddeftgdkEAYMAGVLARYRKTLMERTkhhlgypynldfdygALAQLQHFsinnlgdpfiesnygvhsrqFEVGVLDWFARLWELENNEYWgyitncgtegnlhgilvgrevfpdgilyasreSHYSVFKAARMYRMECVkvdclisgeidCADFKAKLlqnkdkpaiinvnigttvkgavdDLDLVIQTLEesgftqdrfyihcdgalfglmmpfvkkapkvsfkkpigsvsvsghkfvgcpmpcgvqitRMEHINVLSSNVEYLASRdatimgsrnghapIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSstvvferpqdeEFVRRWQLACqgniahvvvmpnvtiDKLDDFLNELIENRstwyedgkrqppciaadigsencvcaahk
MAEAMMKQVNGGLAEKFGPVFDPTAVVAEPVPPVVTENGHELKHKTAEKEIVLGKNVHASCFSVtepeaddeftgdKEAYMAGVLARYRKTLMERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFKAKLlqnkdkpaiinvnigttvkgavdDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIENRstwyedgkrqPPCIAADIGSENCVCAAHK
MAEAMMKQVNGGLAEKFGPVFDptavvaepvppvvteNGHELKHKTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFKAKLLQNKDKPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGSENCVCAAHK
***************KFGPVFDPTAVVAEPVPPVVT*********TAEKEIVLGKNVHASCFSVTE*****EFTGDKEAYMAGVLARYRKTLMERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFKAKLLQNKDKPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGSENCVC****
***************KFGPVFDPTAVVAEPVPPVVTENGH***************************************YMAGVLARYRKTLMERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFKAKLLQNKDKPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGSENCVCAAH*
MAEAMMKQVNGGLAEKFGPVFDPTAVVAEPVPPVVTENGHELKHKTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFKAKLLQNKDKPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGSENCVCAAHK
**************EKFGPVFDPTAVVAEPVPPVVTENGHE**HKTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFKAKLLQNKDKPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGSENCVCA***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEAMMKQVNGGLAEKFGPVFDPTAVVAEPVPPVVTENGHELKHKTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFKAKLLQNKDKPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGSENCVCAAHK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query476 2.2.26 [Sep-21-2011]
P54772413 Histidine decarboxylase O N/A no 0.821 0.946 0.583 1e-140
A7MVI6386 Histidine decarboxylase O yes no 0.739 0.911 0.409 7e-77
Q56581386 Histidine decarboxylase O yes no 0.735 0.906 0.409 1e-76
Q1IAK7403 Histidine decarboxylase O yes no 0.752 0.888 0.392 1e-75
P05034378 Histidine decarboxylase O N/A no 0.712 0.896 0.406 1e-74
P28578378 Histidine decarboxylase O N/A no 0.728 0.917 0.383 3e-74
P95477405 Histidine decarboxylase O yes no 0.693 0.814 0.412 4e-74
B2HVG6383 Histidine decarboxylase O yes no 0.724 0.900 0.397 9e-74
A3M7A4383 Histidine decarboxylase O yes no 0.722 0.898 0.398 2e-73
B0VBU8383 Histidine decarboxylase O yes no 0.724 0.900 0.394 9e-73
>sp|P54772|DCHS_SOLLC Histidine decarboxylase OS=Solanum lycopersicum GN=HDC PE=2 SV=1 Back     alignment and function desciption
 Score =  497 bits (1279), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 231/396 (58%), Positives = 303/396 (76%), Gaps = 5/396 (1%)

Query: 84  VLARYRKTLMERTKHHLGYPYNLDFDYGA-LAQLQHFSINNLGDPFIESNYGVHSRQFEV 142
           +L +Y +TL ER K+H+GYP N+ +++ A LA L  F +NN GDPF +     HS+ FEV
Sbjct: 17  ILTQYLETLSERKKYHIGYPINMCYEHHATLAPLLQFHLNNCGDPFTQHPTDFHSKDFEV 76

Query: 143 GVLDWFARLWELENNEYWGYITNCGTEGNLHGILVGR-EVFPDGILYASRESHYSVFKAA 201
            VLDWFA+LWE+E +EYWGYIT+ GTEGNLHG  +GR E+ P+G LYAS++SHYS+FKAA
Sbjct: 77  AVLDWFAQLWEIEKDEYWGYITSGGTEGNLHGFWLGRRELLPNGYLYASKDSHYSIFKAA 136

Query: 202 RMYRMECVKVDCLISGEIDCADFKAKLLQNKDKPAIINVNIGTTVKGAVDDLDLVIQTLE 261
           RMYRME   ++ L++GEID  D ++KLL NK+KPAIIN+NIGTT KGA+DDLD VIQTLE
Sbjct: 137 RMYRMELQTINTLVNGEIDYEDLQSKLLVNKNKPAIININIGTTFKGAIDDLDFVIQTLE 196

Query: 262 ESGFTQDRFYIHCDGALFGLMMPFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITR 321
             G++ D +YIHCD AL GL++PF+K A K++FKKPIGS+S+SGHKF+GCPM CGVQITR
Sbjct: 197 NCGYSNDNYYIHCDRALCGLILPFIKHAKKITFKKPIGSISISGHKFLGCPMSCGVQITR 256

Query: 322 MEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLK 381
             +++ LS  +EY+ S DATI GSRNG  PIFLWY L++KG+   Q++   C+ NA YLK
Sbjct: 257 RSYVSTLSK-IEYINSADATISGSRNGFTPIFLWYCLSKKGHARLQQDSITCIENARYLK 315

Query: 382 DRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLN 441
           DRLL+AGIS MLN+ S TVVFERP D +F+RRW L C   +AHVV+MP +T + +D F  
Sbjct: 316 DRLLEAGISVMLNDFSITVVFERPCDHKFIRRWNLCCLRGMAHVVIMPGITRETIDSFFK 375

Query: 442 ELIENRS-TWYEDGKRQPPCIAADIGSENCVCAAHK 476
           +L++ R+  WY+D K  PPC+A D+ + NC+C+  K
Sbjct: 376 DLMQERNYKWYQDVKALPPCLADDL-ALNCMCSNKK 410





Solanum lycopersicum (taxid: 4081)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 2
>sp|A7MVI6|DCHS_VIBHB Histidine decarboxylase OS=Vibrio harveyi (strain ATCC BAA-1116 / BB120) GN=hdc PE=3 SV=1 Back     alignment and function description
>sp|Q56581|DCHS_VIBA7 Histidine decarboxylase OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=hdc PE=3 SV=1 Back     alignment and function description
>sp|Q1IAK7|DCHS_PSEE4 Histidine decarboxylase OS=Pseudomonas entomophila (strain L48) GN=hdc PE=3 SV=1 Back     alignment and function description
>sp|P05034|DCHS_MORMO Histidine decarboxylase OS=Morganella morganii GN=hdc PE=1 SV=2 Back     alignment and function description
>sp|P28578|DCHS_RAOPL Histidine decarboxylase OS=Raoultella planticola GN=hdc PE=3 SV=4 Back     alignment and function description
>sp|P95477|DCHS_PSEFL Histidine decarboxylase OS=Pseudomonas fluorescens GN=hdc PE=3 SV=1 Back     alignment and function description
>sp|B2HVG6|DCHS_ACIBC Histidine decarboxylase OS=Acinetobacter baumannii (strain ACICU) GN=hdc PE=3 SV=1 Back     alignment and function description
>sp|A3M7A4|DCHS_ACIBT Histidine decarboxylase OS=Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755) GN=hdc PE=3 SV=2 Back     alignment and function description
>sp|B0VBU8|DCHS_ACIBY Histidine decarboxylase OS=Acinetobacter baumannii (strain AYE) GN=hdc PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query476
224082428478 predicted protein [Populus trichocarpa] 0.949 0.945 0.888 0.0
255584582471 group II plp decarboxylase, putative [Ri 0.974 0.985 0.845 0.0
224066727463 predicted protein [Populus trichocarpa] 0.922 0.948 0.891 0.0
71000475487 putative serine decarboxylase [Beta vulg 0.957 0.936 0.833 0.0
449446423486 PREDICTED: histidine decarboxylase-like 0.987 0.967 0.801 0.0
225463912482 PREDICTED: histidine decarboxylase-like 0.997 0.985 0.845 0.0
449446425481 PREDICTED: histidine decarboxylase-like 0.987 0.977 0.801 0.0
297735834438 unnamed protein product [Vitis vinifera] 0.894 0.972 0.899 0.0
147815605473 hypothetical protein VITISV_034634 [Viti 0.978 0.985 0.854 0.0
357445703486 Histidine decarboxylase [Medicago trunca 0.983 0.962 0.801 0.0
>gi|224082428|ref|XP_002306690.1| predicted protein [Populus trichocarpa] gi|222856139|gb|EEE93686.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/458 (88%), Positives = 425/458 (92%), Gaps = 6/458 (1%)

Query: 21  FDPTAVVA-EPVPPVVT-ENGHELKHKTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKE 78
           FD +AVV  EP+PP+V  ENG     K   +EIVLGKNVH +C  VTEPEA+DEFTGDKE
Sbjct: 20  FDISAVVQPEPLPPIVAAENGD----KQNGREIVLGKNVHTTCLEVTEPEANDEFTGDKE 75

Query: 79  AYMAGVLARYRKTLMERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSR 138
           AYMA VLARYRK LMERTK+HLGYPYNLDFDYGAL QLQHFSINNLGDPFIESNYGVHSR
Sbjct: 76  AYMASVLARYRKNLMERTKYHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGVHSR 135

Query: 139 QFEVGVLDWFARLWELENNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVF 198
           QFEVGVLDWFARLWE+E NEYWGYITNCGTEGNLHGILVGREVFPDG+LYASRESHYSVF
Sbjct: 136 QFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVFPDGVLYASRESHYSVF 195

Query: 199 KAARMYRMECVKVDCLISGEIDCADFKAKLLQNKDKPAIINVNIGTTVKGAVDDLDLVIQ 258
           KAARMYRM+C KVDCLISGEIDCADFKAKLL NKDKPAIINVNIGTTVKGAVDDLDLVIQ
Sbjct: 196 KAARMYRMDCEKVDCLISGEIDCADFKAKLLANKDKPAIINVNIGTTVKGAVDDLDLVIQ 255

Query: 259 TLEESGFTQDRFYIHCDGALFGLMMPFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQ 318
           TLEESGF+QDRFYIHCDGALFGLMMPFVK+APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ
Sbjct: 256 TLEESGFSQDRFYIHCDGALFGLMMPFVKRAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQ 315

Query: 319 ITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAH 378
           ITRMEHI+VLS NVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAH
Sbjct: 316 ITRMEHIDVLSRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAH 375

Query: 379 YLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDD 438
           YLKDRL DAGISAMLNELSSTVVFERP DEEFVRRWQLACQGNIAHVVVMP+VTI+KLDD
Sbjct: 376 YLKDRLHDAGISAMLNELSSTVVFERPLDEEFVRRWQLACQGNIAHVVVMPSVTIEKLDD 435

Query: 439 FLNELIENRSTWYEDGKRQPPCIAADIGSENCVCAAHK 476
           FLNEL+E RS WY DG  QPPCIAAD+G ENC CA HK
Sbjct: 436 FLNELVEKRSIWYRDGGVQPPCIAADVGCENCACALHK 473




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255584582|ref|XP_002533017.1| group II plp decarboxylase, putative [Ricinus communis] gi|223527206|gb|EEF29371.1| group II plp decarboxylase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224066727|ref|XP_002302186.1| predicted protein [Populus trichocarpa] gi|222843912|gb|EEE81459.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|71000475|dbj|BAE07183.1| putative serine decarboxylase [Beta vulgaris] Back     alignment and taxonomy information
>gi|449446423|ref|XP_004140971.1| PREDICTED: histidine decarboxylase-like isoform 1 [Cucumis sativus] gi|449526882|ref|XP_004170442.1| PREDICTED: histidine decarboxylase-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225463912|ref|XP_002266398.1| PREDICTED: histidine decarboxylase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449446425|ref|XP_004140972.1| PREDICTED: histidine decarboxylase-like isoform 2 [Cucumis sativus] gi|449526884|ref|XP_004170443.1| PREDICTED: histidine decarboxylase-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297735834|emb|CBI18554.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147815605|emb|CAN70523.1| hypothetical protein VITISV_034634 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357445703|ref|XP_003593129.1| Histidine decarboxylase [Medicago truncatula] gi|355482177|gb|AES63380.1| Histidine decarboxylase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query476
TAIR|locus:2031133482 EMB1075 "embryo defective 1075 0.899 0.887 0.853 2.8e-208
UNIPROTKB|F1N890282 GAD2 "Uncharacterized protein" 0.424 0.716 0.266 2.6e-12
UNIPROTKB|Q99259594 GAD1 "Glutamate decarboxylase 0.415 0.333 0.285 6.6e-12
UNIPROTKB|Q9YI58590 GAD67 "Glutamate decarboxylase 0.424 0.342 0.28 8.5e-12
UNIPROTKB|A0PA85594 GAD1 "Glutamate decarboxylase 0.415 0.333 0.285 1.8e-11
UNIPROTKB|F1PRT3594 GAD1 "Glutamate decarboxylase 0.415 0.333 0.285 1.8e-11
UNIPROTKB|J9P2A8595 GAD1 "Glutamate decarboxylase 0.415 0.332 0.285 1.9e-11
UNIPROTKB|F1NS42493 GAD2 "Uncharacterized protein" 0.424 0.409 0.266 2.2e-11
UNIPROTKB|P48319594 GAD1 "Glutamate decarboxylase 0.415 0.333 0.285 2.4e-11
RGD|2652593 Gad1 "glutamate decarboxylase 0.415 0.333 0.285 3.1e-11
TAIR|locus:2031133 EMB1075 "embryo defective 1075" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2014 (714.0 bits), Expect = 2.8e-208, P = 2.8e-208
 Identities = 366/429 (85%), Positives = 403/429 (93%)

Query:    48 EKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPYNLD 107
             E+E+VLG+N+H +  +VTEPE +DEFTGDKEAYMA VLARYRKTL+ERTK+HLGYPYNLD
Sbjct:    55 EREMVLGRNIHTTSLAVTEPEVNDEFTGDKEAYMASVLARYRKTLVERTKNHLGYPYNLD 114

Query:   108 FDYGALAQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYITNCG 167
             FDYGAL QLQHFSINNLGDPFIESNYGVHSR FEVGVLDWFARLWE+E ++YWGYITNCG
Sbjct:   115 FDYGALGQLQHFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITNCG 174

Query:   168 TEGNLHGILVGREVFPDGILYASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFKAK 227
             TEGNLHGILVGRE+FPDGILYASRESHYSVFKAARMYRMEC KVD L+SGEIDC D + K
Sbjct:   175 TEGNLHGILVGREMFPDGILYASRESHYSVFKAARMYRMECEKVDTLMSGEIDCDDLRKK 234

Query:   228 LLQNKDKPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFVK 287
             LL NKDKPAI+NVNIGTTVKGAVDDLDLVI+TLEE GF+ DRFYIHCDGALFGLMMPFVK
Sbjct:   235 LLANKDKPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVK 294

Query:   288 KAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRN 347
             +APKV+F KPIGSVSVSGHKFVGCPMPCGVQITRMEHI VLSSNVEYLASRDATIMGSRN
Sbjct:   295 RAPKVTFNKPIGSVSVSGHKFVGCPMPCGVQITRMEHIKVLSSNVEYLASRDATIMGSRN 354

Query:   348 GHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQD 407
             GHAP+FLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRL +AGISAMLNELSSTVVFERP+D
Sbjct:   355 GHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKD 414

Query:   408 EEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNELIENRSTWYEDGKRQPPCIAADIGS 467
             EEFVRRWQLACQG+IAHVVVMP+VTI+KLD+FL +L+++R  WYEDG  QPPC+A+++G+
Sbjct:   415 EEFVRRWQLACQGDIAHVVVMPSVTIEKLDNFLKDLVKHRLIWYEDGS-QPPCLASEVGT 473

Query:   468 ENCVCAAHK 476
              NC+C AHK
Sbjct:   474 NNCICPAHK 482




GO:0003824 "catalytic activity" evidence=IEA
GO:0006520 "cellular amino acid metabolic process" evidence=ISS
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0016831 "carboxy-lyase activity" evidence=IEA;ISS
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0006580 "ethanolamine metabolic process" evidence=IMP
UNIPROTKB|F1N890 GAD2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q99259 GAD1 "Glutamate decarboxylase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9YI58 GAD67 "Glutamate decarboxylase 67" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A0PA85 GAD1 "Glutamate decarboxylase 1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRT3 GAD1 "Glutamate decarboxylase 1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P2A8 GAD1 "Glutamate decarboxylase 1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NS42 GAD2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P48319 GAD1 "Glutamate decarboxylase 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|2652 Gad1 "glutamate decarboxylase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P54772DCHS_SOLLC4, ., 1, ., 1, ., 2, 20.58330.82140.9467N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.1.1.220.914
3rd Layer4.1.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query476
PLN02263470 PLN02263, PLN02263, serine decarboxylase 0.0
PLN03032374 PLN03032, PLN03032, serine decarboxylase; Provisio 0.0
PRK02769380 PRK02769, PRK02769, histidine decarboxylase; Provi 1e-166
COG0076460 COG0076, GadB, Glutamate decarboxylase and related 1e-45
TIGR03812373 TIGR03812, tyr_de_CO2_Arch, tyrosine decarboxylase 2e-31
cd06450345 cd06450, DOPA_deC_like, DOPA decarboxylase family 7e-30
PRK13520371 PRK13520, PRK13520, L-tyrosine decarboxylase; Prov 1e-26
pfam00282373 pfam00282, Pyridoxal_deC, Pyridoxal-dependent deca 9e-23
TIGR01788431 TIGR01788, Glu-decarb-GAD, glutamate decarboxylase 3e-10
TIGR03799522 TIGR03799, NOD_PanD_pyr, putative pyridoxal-depend 9e-06
>gnl|CDD|177904 PLN02263, PLN02263, serine decarboxylase Back     alignment and domain information
 Score =  992 bits (2566), Expect = 0.0
 Identities = 397/458 (86%), Positives = 422/458 (92%), Gaps = 2/458 (0%)

Query: 21  FDPTAVVAEPVPPVVTENG--HELKHKTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKE 78
            DP  +V++P+P          E      E+EIVLG+NVH +C +VTEPEADDEFTGDKE
Sbjct: 13  IDPDLLVSDPLPVATYNVAVVAEYGDLGGEREIVLGRNVHTTCLAVTEPEADDEFTGDKE 72

Query: 79  AYMAGVLARYRKTLMERTKHHLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGVHSR 138
           AYMA VLARYRKTL+ERTKHHLGYPYNLDFDYGAL QLQHFSINNLGDPFIESNYGVHSR
Sbjct: 73  AYMASVLARYRKTLVERTKHHLGYPYNLDFDYGALGQLQHFSINNLGDPFIESNYGVHSR 132

Query: 139 QFEVGVLDWFARLWELENNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVF 198
           QFEVGVLDWFARLWE+E NEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVF
Sbjct: 133 QFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVF 192

Query: 199 KAARMYRMECVKVDCLISGEIDCADFKAKLLQNKDKPAIINVNIGTTVKGAVDDLDLVIQ 258
           KAARMYRMECVKVD L+SGEIDCADFKAKLL NKDKPAIINVNIGTTVKGAVDDLDLVI+
Sbjct: 193 KAARMYRMECVKVDTLVSGEIDCADFKAKLLANKDKPAIINVNIGTTVKGAVDDLDLVIK 252

Query: 259 TLEESGFTQDRFYIHCDGALFGLMMPFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQ 318
           TLEE GF+QDRFYIHCDGALFGLMMPFVK+APKV+FKKPIGSVSVSGHKFVGCPMPCGVQ
Sbjct: 253 TLEECGFSQDRFYIHCDGALFGLMMPFVKRAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQ 312

Query: 319 ITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAH 378
           ITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY+GFQKEVQKCLRNAH
Sbjct: 313 ITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAH 372

Query: 379 YLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDD 438
           YLKDRL +AGISAMLNELSSTVVFERP+DEEFVRRWQLACQGNIAHVVVMP+VTI+KLD 
Sbjct: 373 YLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQLACQGNIAHVVVMPSVTIEKLDY 432

Query: 439 FLNELIENRSTWYEDGKRQPPCIAADIGSENCVCAAHK 476
           FL EL+E RSTWY DGK QPPC+A D+G ENC+C+ HK
Sbjct: 433 FLKELVEKRSTWYPDGKVQPPCVAKDVGEENCLCSLHK 470


Length = 470

>gnl|CDD|166673 PLN03032, PLN03032, serine decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|235068 PRK02769, PRK02769, histidine decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|223154 COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234361 TIGR03812, tyr_de_CO2_Arch, tyrosine decarboxylase MnfA Back     alignment and domain information
>gnl|CDD|99743 cd06450, DOPA_deC_like, DOPA decarboxylase family Back     alignment and domain information
>gnl|CDD|237409 PRK13520, PRK13520, L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|215836 pfam00282, Pyridoxal_deC, Pyridoxal-dependent decarboxylase conserved domain Back     alignment and domain information
>gnl|CDD|130848 TIGR01788, Glu-decarb-GAD, glutamate decarboxylase Back     alignment and domain information
>gnl|CDD|163511 TIGR03799, NOD_PanD_pyr, putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 476
PLN02263470 serine decarboxylase 100.0
PLN03032374 serine decarboxylase; Provisional 100.0
PRK02769380 histidine decarboxylase; Provisional 100.0
PLN02590539 probable tyrosine decarboxylase 100.0
PLN02880490 tyrosine decarboxylase 100.0
KOG0629510 consensus Glutamate decarboxylase and related prot 100.0
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 100.0
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 100.0
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 100.0
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 100.0
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 100.0
KOG0628511 consensus Aromatic-L-amino-acid/L-histidine decarb 100.0
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 100.0
PRK13520371 L-tyrosine decarboxylase; Provisional 100.0
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 100.0
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 100.0
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 100.0
KOG1383491 consensus Glutamate decarboxylase/sphingosine phos 100.0
PLN02651364 cysteine desulfurase 99.97
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.97
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 99.97
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.97
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.97
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 99.97
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.97
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.97
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.97
PRK02948381 cysteine desulfurase; Provisional 99.97
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.97
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 99.97
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.96
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.96
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.96
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.96
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 99.96
PLN02409401 serine--glyoxylate aminotransaminase 99.96
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.96
PRK14012404 cysteine desulfurase; Provisional 99.96
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 99.96
KOG1549428 consensus Cysteine desulfurase NFS1 [Amino acid tr 99.96
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 99.96
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.96
PRK05367954 glycine dehydrogenase; Provisional 99.95
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.95
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.95
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.95
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.95
TIGR01814406 kynureninase kynureninase. This model describes ky 99.95
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.95
PLN02414993 glycine dehydrogenase (decarboxylating) 99.95
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.94
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.94
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.94
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.94
PRK07179407 hypothetical protein; Provisional 99.94
PLN02724 805 Molybdenum cofactor sulfurase 99.94
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.94
PLN02955476 8-amino-7-oxononanoate synthase 99.93
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.93
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.93
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 99.93
PRK09064407 5-aminolevulinate synthase; Validated 99.92
PRK03080378 phosphoserine aminotransferase; Provisional 99.92
PRK06108382 aspartate aminotransferase; Provisional 99.92
PLN02483489 serine palmitoyltransferase 99.92
PRK13393406 5-aminolevulinate synthase; Provisional 99.92
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.92
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.92
PRK13392410 5-aminolevulinate synthase; Provisional 99.92
PLN00175413 aminotransferase family protein; Provisional 99.91
PRK08361391 aspartate aminotransferase; Provisional 99.91
KOG1359417 consensus Glycine C-acetyltransferase/2-amino-3-ke 99.91
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.91
PRK06207405 aspartate aminotransferase; Provisional 99.91
PLN02721353 threonine aldolase 99.91
PRK07681399 aspartate aminotransferase; Provisional 99.91
PRK09082386 methionine aminotransferase; Validated 99.91
PRK13580493 serine hydroxymethyltransferase; Provisional 99.9
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.9
PRK08912387 hypothetical protein; Provisional 99.9
PRK06290410 aspartate aminotransferase; Provisional 99.9
PRK07309391 aromatic amino acid aminotransferase; Validated 99.9
PRK05957389 aspartate aminotransferase; Provisional 99.9
PTZ00377481 alanine aminotransferase; Provisional 99.9
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 99.9
PLN03226475 serine hydroxymethyltransferase; Provisional 99.9
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.9
PRK07682378 hypothetical protein; Validated 99.9
PLN02187462 rooty/superroot1 99.9
PRK07324373 transaminase; Validated 99.9
KOG1360570 consensus 5-aminolevulinate synthase [Coenzyme tra 99.9
PRK12566954 glycine dehydrogenase; Provisional 99.9
PLN02656409 tyrosine transaminase 99.9
PRK12414384 putative aminotransferase; Provisional 99.9
PLN03227392 serine palmitoyltransferase-like protein; Provisio 99.9
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.9
PRK05764393 aspartate aminotransferase; Provisional 99.9
PRK13034416 serine hydroxymethyltransferase; Reviewed 99.89
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.89
PRK08960387 hypothetical protein; Provisional 99.89
PLN02822481 serine palmitoyltransferase 99.89
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 99.89
KOG0257420 consensus Kynurenine aminotransferase, glutamine t 99.89
PRK07777387 aminotransferase; Validated 99.89
PRK13355517 bifunctional HTH-domain containing protein/aminotr 99.89
PRK05942394 aspartate aminotransferase; Provisional 99.89
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.89
PRK03317368 histidinol-phosphate aminotransferase; Provisional 99.89
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.89
PRK08636403 aspartate aminotransferase; Provisional 99.89
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 99.89
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.89
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.89
PRK09148405 aminotransferase; Validated 99.89
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.88
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.88
PRK14807351 histidinol-phosphate aminotransferase; Provisional 99.88
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 99.88
PRK07337388 aminotransferase; Validated 99.88
PRK06348384 aspartate aminotransferase; Provisional 99.88
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.88
PRK07550386 hypothetical protein; Provisional 99.88
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.88
PRK09147396 succinyldiaminopimelate transaminase; Provisional 99.88
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.88
PRK08068389 transaminase; Reviewed 99.88
PRK15481431 transcriptional regulatory protein PtsJ; Provision 99.88
PTZ00433412 tyrosine aminotransferase; Provisional 99.88
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.88
PRK08363398 alanine aminotransferase; Validated 99.87
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 99.87
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.87
PRK06107402 aspartate aminotransferase; Provisional 99.87
PRK07683387 aminotransferase A; Validated 99.87
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 99.87
PRK08175395 aminotransferase; Validated 99.87
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 99.87
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.87
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 99.87
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.87
PRK06225380 aspartate aminotransferase; Provisional 99.87
PLN02368407 alanine transaminase 99.87
PRK09105370 putative aminotransferase; Provisional 99.86
PLN02231534 alanine transaminase 99.86
PRK09265404 aminotransferase AlaT; Validated 99.86
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.86
PLN03026380 histidinol-phosphate aminotransferase; Provisional 99.86
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 99.86
PRK00950361 histidinol-phosphate aminotransferase; Validated 99.86
PRK06836394 aspartate aminotransferase; Provisional 99.86
PRK08153369 histidinol-phosphate aminotransferase; Provisional 99.86
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.86
PRK07908349 hypothetical protein; Provisional 99.85
PRK06855433 aminotransferase; Validated 99.85
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.85
PRK04635354 histidinol-phosphate aminotransferase; Provisional 99.85
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.85
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.85
PRK01688351 histidinol-phosphate aminotransferase; Provisional 99.85
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.85
PRK07568397 aspartate aminotransferase; Provisional 99.85
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.85
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 99.84
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.84
PRK02610374 histidinol-phosphate aminotransferase; Provisional 99.84
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 99.84
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.83
PRK06767386 methionine gamma-lyase; Provisional 99.83
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 99.83
PRK08861388 cystathionine gamma-synthase; Provisional 99.83
PLN02242418 methionine gamma-lyase 99.83
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 99.83
KOG0259447 consensus Tyrosine aminotransferase [Amino acid tr 99.83
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 99.83
PTZ00376404 aspartate aminotransferase; Provisional 99.83
PLN02271586 serine hydroxymethyltransferase 99.83
PRK03321352 putative aminotransferase; Provisional 99.82
KOG1357519 consensus Serine palmitoyltransferase [Posttransla 99.82
KOG2862385 consensus Alanine-glyoxylate aminotransferase AGT1 99.82
PRK05166371 histidinol-phosphate aminotransferase; Provisional 99.82
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 99.82
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.82
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.82
PRK05968389 hypothetical protein; Provisional 99.81
PRK08114395 cystathionine beta-lyase; Provisional 99.81
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.81
PRK09257396 aromatic amino acid aminotransferase; Provisional 99.81
PLN02509464 cystathionine beta-lyase 99.81
PRK10534333 L-threonine aldolase; Provisional 99.81
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 99.81
PRK04781364 histidinol-phosphate aminotransferase; Provisional 99.81
PRK05839374 hypothetical protein; Provisional 99.81
PRK06234400 methionine gamma-lyase; Provisional 99.81
PRK08249398 cystathionine gamma-synthase; Provisional 99.81
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 99.81
PRK08776405 cystathionine gamma-synthase; Provisional 99.81
PRK09028394 cystathionine beta-lyase; Provisional 99.81
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 99.81
PRK05367 954 glycine dehydrogenase; Provisional 99.81
PRK09275527 aspartate aminotransferase; Provisional 99.81
PRK07050394 cystathionine beta-lyase; Provisional 99.81
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 99.81
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.8
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.8
PLN02397423 aspartate transaminase 99.8
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.8
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.8
PRK06460376 hypothetical protein; Provisional 99.8
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 99.8
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.8
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.8
PRK08574385 cystathionine gamma-synthase; Provisional 99.8
KOG1368384 consensus Threonine aldolase [Amino acid transport 99.8
PRK08247366 cystathionine gamma-synthase; Reviewed 99.8
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 99.8
PLN026721082 methionine S-methyltransferase 99.8
PRK08064390 cystathionine beta-lyase; Provisional 99.8
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.8
PRK14809357 histidinol-phosphate aminotransferase; Provisional 99.8
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.8
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.79
PRK07811388 cystathionine gamma-synthase; Provisional 99.79
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.79
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.79
PRK08045386 cystathionine gamma-synthase; Provisional 99.79
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.79
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.79
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.78
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 99.78
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 99.78
PRK15029 755 arginine decarboxylase; Provisional 99.78
TIGR00707379 argD acetylornithine and succinylornithine aminotr 99.78
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 99.78
PRK07503403 methionine gamma-lyase; Provisional 99.78
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 99.77
PRK08637388 hypothetical protein; Provisional 99.77
PRK14808335 histidinol-phosphate aminotransferase; Provisional 99.77
PRK07392360 threonine-phosphate decarboxylase; Validated 99.77
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 99.77
PRK07582366 cystathionine gamma-lyase; Validated 99.77
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 99.77
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 99.77
PRK07505402 hypothetical protein; Provisional 99.77
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.77
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 99.76
PRK07269364 cystathionine gamma-synthase; Reviewed 99.76
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 99.76
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.76
PRK07671377 cystathionine beta-lyase; Provisional 99.76
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 99.76
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.76
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 99.76
PRK05939397 hypothetical protein; Provisional 99.76
PRK05967395 cystathionine beta-lyase; Provisional 99.76
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 99.75
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 99.75
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.75
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 99.75
PTZ00125400 ornithine aminotransferase-like protein; Provision 99.75
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.75
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.75
PLN02452365 phosphoserine transaminase 99.74
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 99.74
PRK15399 713 lysine decarboxylase LdcC; Provisional 99.74
PRK01278389 argD acetylornithine transaminase protein; Provisi 99.73
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.73
PRK15400 714 lysine decarboxylase CadA; Provisional 99.73
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.73
PRK06959339 putative threonine-phosphate decarboxylase; Provis 99.73
PRK07049427 methionine gamma-lyase; Validated 99.73
PRK02627396 acetylornithine aminotransferase; Provisional 99.73
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 99.72
PRK13578 720 ornithine decarboxylase; Provisional 99.71
PRK12381406 bifunctional succinylornithine transaminase/acetyl 99.7
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 99.7
PRK04311464 selenocysteine synthase; Provisional 99.7
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 99.7
PRK08354311 putative aminotransferase; Provisional 99.7
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.7
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.69
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.69
PRK12462364 phosphoserine aminotransferase; Provisional 99.68
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.67
PRK03715395 argD acetylornithine transaminase protein; Provisi 99.67
PLN02624474 ornithine-delta-aminotransferase 99.66
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 99.66
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.66
PRK06434384 cystathionine gamma-lyase; Validated 99.66
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.66
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 99.65
PRK13237460 tyrosine phenol-lyase; Provisional 99.65
PRK04260375 acetylornithine aminotransferase; Provisional 99.64
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.63
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 99.62
PRK08117433 4-aminobutyrate aminotransferase; Provisional 99.61
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 99.61
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 99.6
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 99.6
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 99.6
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 99.59
KOG0256471 consensus 1-aminocyclopropane-1-carboxylate syntha 99.59
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 99.58
PRK06541460 hypothetical protein; Provisional 99.57
PRK12403460 putative aminotransferase; Provisional 99.57
KOG20401001 consensus Glycine dehydrogenase (decarboxylating) 99.57
PRK08360443 4-aminobutyrate aminotransferase; Provisional 99.56
PRK04612408 argD acetylornithine transaminase protein; Provisi 99.56
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 99.55
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 99.55
PLN02760504 4-aminobutyrate:pyruvate transaminase 99.55
PRK06062451 hypothetical protein; Provisional 99.53
PRK08593445 4-aminobutyrate aminotransferase; Provisional 99.53
PRK05769441 4-aminobutyrate aminotransferase; Provisional 99.53
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 99.53
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 99.53
PRK09221445 beta alanine--pyruvate transaminase; Provisional 99.52
PRK08088425 4-aminobutyrate aminotransferase; Validated 99.52
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 99.52
PRK13360442 omega amino acid--pyruvate transaminase; Provision 99.5
KOG2467477 consensus Glycine/serine hydroxymethyltransferase 99.5
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 99.5
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.49
PLN00144382 acetylornithine transaminase 99.49
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 99.48
KOG0634472 consensus Aromatic amino acid aminotransferase and 99.48
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 99.47
PRK07046453 aminotransferase; Validated 99.47
PRK09792421 4-aminobutyrate transaminase; Provisional 99.47
PRK06058443 4-aminobutyrate aminotransferase; Provisional 99.47
COG0160447 GabT 4-aminobutyrate aminotransferase and related 99.47
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 99.46
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 99.46
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transam 99.46
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 99.46
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 99.45
PRK07678451 aminotransferase; Validated 99.45
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 99.45
KOG1358467 consensus Serine palmitoyltransferase [Posttransla 99.44
PRK07495425 4-aminobutyrate aminotransferase; Provisional 99.44
PRK06105460 aminotransferase; Provisional 99.44
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 99.43
PRK05639457 4-aminobutyrate aminotransferase; Provisional 99.42
PRK06082459 4-aminobutyrate aminotransferase; Provisional 99.41
KOG0053409 consensus Cystathionine beta-lyases/cystathionine 99.41
PRK05965459 hypothetical protein; Provisional 99.41
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 99.41
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 99.4
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 99.4
PRK07482461 hypothetical protein; Provisional 99.4
PRK06917447 hypothetical protein; Provisional 99.39
PRK07481449 hypothetical protein; Provisional 99.39
PRK07480456 putative aminotransferase; Validated 99.39
PRK07030466 adenosylmethionine--8-amino-7-oxononanoate transam 99.39
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 99.39
PRK06916460 adenosylmethionine--8-amino-7-oxononanoate transam 99.38
PRK07036466 hypothetical protein; Provisional 99.37
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transam 99.37
PRK06149972 hypothetical protein; Provisional 99.35
TIGR02617467 tnaA_trp_ase tryptophanase, leader peptide-associa 99.33
PRK07483443 hypothetical protein; Provisional 99.31
PRK12566 954 glycine dehydrogenase; Provisional 99.3
PRK061481013 hypothetical protein; Provisional 99.3
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 99.29
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 99.28
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 99.25
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 99.24
TIGR00699464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 99.24
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 99.23
PRK08297443 L-lysine aminotransferase; Provisional 99.22
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 99.21
KOG0258475 consensus Alanine aminotransferase [Amino acid tra 99.17
KOG1402427 consensus Ornithine aminotransferase [Amino acid t 99.08
KOG1401433 consensus Acetylornithine aminotransferase [Amino 99.07
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 99.03
KOG1404442 consensus Alanine-glyoxylate aminotransferase AGT2 99.01
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer seleni 99.01
KOG0630 838 consensus Predicted pyridoxal-dependent decarboxyl 99.0
KOG0633375 consensus Histidinol phosphate aminotransferase [A 98.98
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 98.95
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme meta 98.9
PLN02974817 adenosylmethionine-8-amino-7-oxononanoate transami 98.9
PF06838403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 98.86
PF03841367 SelA: L-seryl-tRNA selenium transferase; InterPro: 98.75
COG3033471 TnaA Tryptophanase [Amino acid transport and metab 98.73
KOG3846465 consensus L-kynurenine hydrolase [Amino acid trans 98.7
PF12897425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 98.6
KOG3843432 consensus Predicted serine hydroxymethyltransferas 98.52
KOG2790370 consensus Phosphoserine aminotransferase [Coenzyme 98.28
KOG1403452 consensus Predicted alanine-glyoxylate aminotransf 98.13
COG4100416 Cystathionine beta-lyase family protein involved i 98.13
KOG2040 1001 consensus Glycine dehydrogenase (decarboxylating) 97.53
KOG1405484 consensus 4-aminobutyrate aminotransferase [Amino 97.4
KOG1412410 consensus Aspartate aminotransferase/Glutamic oxal 97.11
PF04864363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 96.84
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 96.56
KOG1411427 consensus Aspartate aminotransferase/Glutamic oxal 94.71
COG2515323 Acd 1-aminocyclopropane-1-carboxylate deaminase [A 85.71
>PLN02263 serine decarboxylase Back     alignment and domain information
Probab=100.00  E-value=4.4e-79  Score=622.74  Aligned_cols=433  Identities=90%  Similarity=1.473  Sum_probs=410.4

Q ss_pred             CCccceeeeccCCcccccccccCCCccccccCCCCCcHHHHHHHHHHHHhcccccccCCCCcCCcchHHHHHHHHHhhCC
Q 011871           44 HKTAEKEIVLGKNVHASCFSVTEPEADDEFTGDKEAYMAGVLARYRKTLMERTKHHLGYPYNLDFDYGALAQLQHFSINN  123 (476)
Q Consensus        44 ~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~il~~~~~~~~~~~~~~~g~p~~~~~~~~~l~~~l~~~~n~  123 (476)
                      .....|+++++++.+..+|+..+|+..++...+....++.+++++.+.+.++..+++|||.+..++++.+++++.+.+||
T Consensus        38 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~gYp~n~~~d~s~l~~~l~~~~nN  117 (470)
T PLN02263         38 DLGGEREIVLGRNVHTTCLAVTEPEADDEFTGDKEAYMASVLARYRKTLVERTKHHLGYPYNLDFDYGALGQLQHFSINN  117 (470)
T ss_pred             cccccceeeeecccccccccccCCCCchhhhhcchhhHHHHHHHHHHHHHhcccceeCCCCcccCChhhHHHHHHhhccC
Confidence            44558899999999999999999999887777776678999999999999999999999999999889999999999999


Q ss_pred             CCCCcccCccchhhHHHHHHHHHHHHHHcCCCCCcccEEEcCCchhHHHHHHHHHHhhCCCcEEEecCCCchHHHHHHHH
Q 011871          124 LGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARM  203 (476)
Q Consensus       124 ~g~~~~~~~~~~~~~~le~~~~~~la~l~g~~~~~~~g~~t~ggt~An~~al~aa~~~~p~~~Vl~s~~~H~S~~~~~~~  203 (476)
                      .|++|..++++.+++++|+++.+|+++++|++++.++|++|+|||+||++|++++|+..++.++|+|+.+|+|+.|++++
T Consensus       118 ~Gdp~~~s~~~~~s~~~E~~Vi~wla~L~g~p~~~~~G~vtsGGTEaNL~Al~aARe~~~~~vvy~S~~aH~Sv~KAa~l  197 (470)
T PLN02263        118 LGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARM  197 (470)
T ss_pred             CCCccccCCcchhHHHHHHHHHHHHHHHhCCCCCCCeEEEeCcHHHHHHHHHHHHHhhcCCcEEEEcCCccHHHHHHHHh
Confidence            99999999999899999999999999999998766789999999999999999999988888999999999999999999


Q ss_pred             cCCeEEEEeCCCCCccCHHHHHHHHHcCCCCcEEEEEeeCCCccccccCHHHHHHHHHHhCCCCCceEEEEecCcccccc
Q 011871          204 YRMECVKVDCLISGEIDCADFKAKLLQNKDKPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMM  283 (476)
Q Consensus       204 ~G~~v~~v~~~~~g~~D~~~Le~~l~~~~~~p~~vv~t~gtt~tG~id~l~~I~~ia~~~g~~~~~~~lhvD~a~~g~~~  283 (476)
                      +|++++.||++++|+||+++|+++|.+++.+|++|++|.|||++|++|||++|+++|++||+++.++|+||||||||+++
T Consensus       198 lgi~~~~Vp~d~~g~mD~~aL~~aI~~d~~~P~iVvataGTT~~GAiDpi~eIa~i~~~~g~~~~~iwlHVDAA~GG~~l  277 (470)
T PLN02263        198 YRMECVKVDTLVSGEIDCADFKAKLLANKDKPAIINVNIGTTVKGAVDDLDLVIKTLEECGFSQDRFYIHCDGALFGLMM  277 (470)
T ss_pred             cCCcceEeccCCCCcCcHHHHHHHHHhCCCCcEEEEEEecCCCCcCCCCHHHHHHHHHHcCCccCCeeEEEeccchhhHh
Confidence            99999999999999999999999999888889999999999999999999999999999998777889999999999999


Q ss_pred             cccccCCCCCCcccccEEEEcCCCCCCCCCCceeEEeehhhhhhhcCCccccCCCCCcccCCCCChhHHHHHHHHHHhCh
Q 011871          284 PFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY  363 (476)
Q Consensus       284 ~~~~~~~~~~~~~~~Dsi~~s~hK~l~~p~~~G~l~~~~~~~~~l~~~~~yl~~~~~~~~~sr~~~~~l~~~~~l~~~g~  363 (476)
                      |+.++.+.+++.+.+|||++|+|||+++|++||++++|+++++.+...++|+...+.++.+||++..++++|++|+.+|.
T Consensus       278 Pf~~~~~~~df~~~vDSIsvD~HK~l~~P~~cgvll~R~~~~~~~~~~~~Yl~~~d~ti~gSR~g~~al~lW~~L~~~G~  357 (470)
T PLN02263        278 PFVKRAPKVTFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGY  357 (470)
T ss_pred             hhcccccccCCCcCccEEEECCccccCCCcCEEEEEEehhhHhhhccChHhhCCCCCCcCCCCCcHHHHHHHHHHHHhCH
Confidence            98888777888878999999999999999999999999888888888899999999999999999889999999999999


Q ss_pred             hcHHHHHHHHHHHHHHHHHHHHhcCCeEeecCCeeEEEEecCCcHHHhhceeecccCCEEEEEEcCCCCHHHHHHHHHHH
Q 011871          364 KGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRRWQLACQGNIAHVVVMPNVTIDKLDDFLNEL  443 (476)
Q Consensus       364 ~g~~~~~~~~~~~a~~l~~~L~~~g~~~~~~~~~~iv~f~~~~~~~~~~~~~l~~~~~~lRv~~~~~~T~edid~~~~~l  443 (476)
                      +|++++++++.+++++|.++|++.|+..+.+|.+++|+|+.|.++...++|++++.++.+|++++|++|.+.||.|+++|
T Consensus       358 ~G~~~~i~~~~~~A~~l~~~l~~~g~~~~~~p~s~~V~f~~p~~~~~~~gW~L~~~~~~~Hivvmphv~~~~id~fi~DL  437 (470)
T PLN02263        358 RGFQKEVQKCLRNAHYLKDRLREAGISAMLNELSSTVVFERPKDEEFVRRWQLACQGNIAHVVVMPSVTIEKLDYFLKEL  437 (470)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhCCCeEEeCCCceEEEEecCchHHhhcceEEccCCCcEEEEEcCCCCHHHHHHHHHHH
Confidence            99999999999999999999999999888899999999998876667899999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCCCCCccccccCCcccccccCC
Q 011871          444 IENRSTWYEDGKRQPPCIAADIGSENCVCAAHK  476 (476)
Q Consensus       444 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  476 (476)
                      ++..+.++.|++..+||+|+|+|++||+|++|+
T Consensus       438 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  470 (470)
T PLN02263        438 VEKRSTWYPDGKVQPPCVAKDVGEENCLCSLHK  470 (470)
T ss_pred             HHHHhhhhhccccCCceeecccccccchhhccC
Confidence            999999999999999999999999999999996



>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>KOG0629 consensus Glutamate decarboxylase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>KOG0628 consensus Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>KOG0257 consensus Kynurenine aminotransferase, glutamine transaminase K [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>KOG1357 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>KOG0256 consensus 1-aminocyclopropane-1-carboxylate synthase, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>KOG2467 consensus Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>KOG0634 consensus Aromatic amino acid aminotransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>KOG1358 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>KOG0258 consensus Alanine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1402 consensus Ornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1401 consensus Acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>KOG1404 consensus Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism] Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0630 consensus Predicted pyridoxal-dependent decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0633 consensus Histidinol phosphate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3846 consensus L-kynurenine hydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>KOG3843 consensus Predicted serine hydroxymethyltransferase SLA/LP (autoimmune hepatitis marker in humans) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2790 consensus Phosphoserine aminotransferase [Coenzyme transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>KOG1403 consensus Predicted alanine-glyoxylate aminotransferase [General function prediction only] Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1405 consensus 4-aminobutyrate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism] Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>KOG1411 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT1/GOT2 [Amino acid transport and metabolism] Back     alignment and domain information
>COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query476
3f9t_A397 Crystal Structure Of L-tyrosine Decarboxylase Mfna 1e-15
2okj_A504 The X-Ray Crystal Structure Of The 67kda Isoform Of 1e-13
3vp6_A511 Structural Characterization Of Glutamic Acid Decarb 2e-13
2okk_A497 The X-Ray Crystal Structure Of The 65kda Isoform Of 1e-12
2dgk_A452 Crystal Structure Of An N-terminal Deletion Mutant 1e-07
1pmm_A466 Crystal Structure Of Escherichia Coli Gadb (Low Ph) 1e-07
1xey_A466 Crystal Structure Of The Complex Of Escherichia Col 1e-07
3hbx_A502 Crystal Structure Of Gad1 From Arabidopsis Thaliana 1e-05
2qma_A497 Crystal Structure Of Glutamate Decarboxylase Domain 4e-05
>pdb|3F9T|A Chain A, Crystal Structure Of L-tyrosine Decarboxylase Mfna (ec 4.1.1.25) (np_247014.1) From Methanococcus Jannaschii At 2.11 A Resolution Length = 397 Back     alignment and structure

Iteration: 1

Score = 81.3 bits (199), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 87/352 (24%), Positives = 151/352 (42%), Gaps = 40/352 (11%) Query: 119 FSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELENNEYWGYITNCGTEGNLHGIL-- 176 F NLGDP + ++ E + L L N + +G+I + GTE NL + Sbjct: 53 FLETNLGDPGLFKG----TKLLEEKAVALLGSL--LNNKDAYGHIVSGGTEANLXALRCI 106 Query: 177 --VGREVFPDGI-------LYASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFKAK 227 + RE G+ + +H+S K +E + ID F Sbjct: 107 KNIWREKRRKGLSKNEHPKIIVPITAHFSFEKGREXXDLEYIYAPIKEDYTID-EKFVKD 165 Query: 228 LLQNKDKPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFV- 286 +++ D II + GTT G +D+++ + + +E + YIH D A GL++PF+ Sbjct: 166 AVEDYDVDGIIGI-AGTTELGTIDNIEELSKIAKE-----NNIYIHVDAAFGGLVIPFLD 219 Query: 287 ----KKAPKVSFKKPIG--SVSVSGHKFVGCPMPCG-VQITRMEHINVLSSNVEYLA-SR 338 KK F +G S+++ HK CP+P G + + + L + YL +R Sbjct: 220 DKYKKKGVNYKFDFSLGVDSITIDPHKXGHCPIPSGGILFKDIGYKRYLDVDAPYLTETR 279 Query: 339 DATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSS 398 ATI+G+R G + L G +G +K V +C N YL +L + ++ + + Sbjct: 280 QATILGTRVGFGGACTYAVLRYLGREGQRKIVNECXENTLYLYKKLKENNFKPVIEPILN 339 Query: 399 TVVFERPQDEEFVRR------WQLACQGNIA-HVVVMPNVTIDKLDDFLNEL 443 V E +E ++ + C A +VV P++ + +D+F+ L Sbjct: 340 IVAIEDEDYKEVCKKLRDRGIYVSVCNCVKALRIVVXPHIKREHIDNFIEIL 391
>pdb|2OKJ|A Chain A, The X-Ray Crystal Structure Of The 67kda Isoform Of Glutamic Acid Decarboxylase (Gad67) Length = 504 Back     alignment and structure
>pdb|3VP6|A Chain A, Structural Characterization Of Glutamic Acid Decarboxylase; Insights Into The Mechanism Of Autoinactivation Length = 511 Back     alignment and structure
>pdb|2OKK|A Chain A, The X-Ray Crystal Structure Of The 65kda Isoform Of Glutamic Acid Decarboxylase (Gad65) Length = 497 Back     alignment and structure
>pdb|2DGK|A Chain A, Crystal Structure Of An N-terminal Deletion Mutant Of Escherichia Coli Gadb In An Autoinhibited State (aldamine) Length = 452 Back     alignment and structure
>pdb|1PMM|A Chain A, Crystal Structure Of Escherichia Coli Gadb (Low Ph) Length = 466 Back     alignment and structure
>pdb|1XEY|A Chain A, Crystal Structure Of The Complex Of Escherichia Coli Gada With Glutarate At 2.05 A Resolution Length = 466 Back     alignment and structure
>pdb|3HBX|A Chain A, Crystal Structure Of Gad1 From Arabidopsis Thaliana Length = 502 Back     alignment and structure
>pdb|2QMA|A Chain A, Crystal Structure Of Glutamate Decarboxylase Domain Of Diaminobutyrate-Pyruvate Transaminase And L-2,4-Diaminobutyrate Decarboxylase From Vibrio Parahaemolyticus Length = 497 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query476
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 3e-97
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 9e-69
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 1e-56
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 1e-39
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 4e-37
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 9e-27
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 7e-26
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 1e-25
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 8e-25
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1e-24
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 2e-23
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 8e-23
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 3e-08
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 7e-08
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Length = 397 Back     alignment and structure
 Score =  297 bits (762), Expect = 3e-97
 Identities = 86/394 (21%), Positives = 159/394 (40%), Gaps = 47/394 (11%)

Query: 84  VLARYRKTLMERTKHHLGYPYNLDFDYGALAQLQH-----FSINNLGDPFIESNYGVHSR 138
           +L   +K      K+  G           +  +       F   NLGDP +       ++
Sbjct: 15  ILEELKKYRSLDLKYEDGNI--FGSMCSNVLPITRKIVDIFLETNLGDPGLFKG----TK 68

Query: 139 QFEVGVLDWFARLWELENNEYWGYITNCGTEGNLHGILVGREVFPDGI-----------L 187
             E   +     L   +  + +G+I + GTE NL  +   + ++ +             +
Sbjct: 69  LLEEKAVALLGSLLNNK--DAYGHIVSGGTEANLMALRCIKNIWREKRRKGLSKNEHPKI 126

Query: 188 YASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFKAKLLQNKDKPAIINVNIGTTVK 247
                +H+S  K   M  +E +         ID    K   +++ D   II    GTT  
Sbjct: 127 IVPITAHFSFEKGREMMDLEYIYAPIKEDYTIDEKFVK-DAVEDYDVDGII-GIAGTTEL 184

Query: 248 GAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFVKKAPKVS-------FKKPIGS 300
           G +D+++ + +  +E+       YIH D A  GL++PF+    K         F   + S
Sbjct: 185 GTIDNIEELSKIAKENNI-----YIHVDAAFGGLVIPFLDDKYKKKGVNYKFDFSLGVDS 239

Query: 301 VSVSGHKFVGCPMPCGVQITR-MEHINVLSSNVEYL-ASRDATIMGSRNGHAPIFLWYTL 358
           +++  HK   CP+P G  + + + +   L  +  YL  +R ATI+G+R G      +  L
Sbjct: 240 ITIDPHKMGHCPIPSGGILFKDIGYKRYLDVDAPYLTETRQATILGTRVGFGGACTYAVL 299

Query: 359 NRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNELSSTVVFERPQDEEFVRR----- 413
              G +G +K V +C+ N  YL  +L +     ++  + + V  E    +E  ++     
Sbjct: 300 RYLGREGQRKIVNECMENTLYLYKKLKENNFKPVIEPILNIVAIEDEDYKEVCKKLRDRG 359

Query: 414 WQL-ACQGNIA-HVVVMPNVTIDKLDDFLNELIE 445
             +  C    A  +VVMP++  + +D+F+  L  
Sbjct: 360 IYVSVCNCVKALRIVVMPHIKREHIDNFIEILNS 393


>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Length = 452 Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Length = 502 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Length = 514 Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Length = 504 Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Length = 515 Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Length = 486 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Length = 497 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Length = 481 Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} Length = 475 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Length = 501 Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Length = 450 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query476
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 100.0
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 100.0
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 100.0
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 100.0
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 100.0
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 100.0
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 100.0
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 100.0
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 100.0
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 100.0
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 100.0
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 100.0
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 100.0
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.97
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.97
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.97
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 99.96
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.96
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.96
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.96
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 99.96
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.96
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.96
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 99.96
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.96
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.96
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.96
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 99.96
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.96
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.96
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.96
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.95
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 99.95
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.95
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.95
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.95
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.95
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.95
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.95
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.95
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.95
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.95
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.95
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.95
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.95
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.95
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.95
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.94
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.94
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.94
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.94
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.94
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.94
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.94
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.94
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.94
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.94
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.94
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 99.94
3aow_A448 Putative uncharacterized protein PH0207; protein-P 99.94
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.94
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.94
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.94
1svv_A359 Threonine aldolase; structural genomics, structura 99.94
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.93
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.93
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.93
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.93
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 99.93
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 99.93
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.93
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.93
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.93
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.93
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.93
3ele_A398 Amino transferase; RER070207001803, structural gen 99.93
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.93
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.93
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.93
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.93
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 99.93
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.93
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.92
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.92
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.92
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 99.92
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.92
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.92
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.92
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 99.92
3l8a_A421 METC, putative aminotransferase, probable beta-cys 99.92
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.92
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 99.92
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.92
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 99.92
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.92
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 99.92
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.92
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.91
3rq1_A418 Aminotransferase class I and II; structural genomi 99.91
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.91
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.91
2fnu_A375 Aminotransferase; protein-product complex, structu 99.91
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.91
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.91
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.91
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.91
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.91
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.91
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.91
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.91
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.91
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.91
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.91
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.9
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.9
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.9
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.9
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.9
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.9
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.9
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.9
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 99.9
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.9
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.9
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.9
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.9
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.9
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.9
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.9
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.9
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.9
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.9
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.9
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.89
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.89
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.89
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.89
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.89
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.89
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.89
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.89
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.88
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.88
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.88
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.88
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.88
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.88
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.88
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.88
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.88
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.87
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.87
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.87
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.87
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.87
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.87
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.87
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.87
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.87
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.87
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.87
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.87
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.87
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.87
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.86
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.86
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.86
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.86
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.86
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.86
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.86
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.86
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.86
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.86
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.86
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.85
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.85
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.85
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 99.85
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.85
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.85
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.85
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.85
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.85
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.84
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.84
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.84
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.84
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.84
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.84
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.83
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.83
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.83
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.83
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.83
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.83
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.83
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.72
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.83
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.82
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.82
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.82
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.82
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.82
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.82
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.82
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.82
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.82
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 99.82
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.82
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.81
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.81
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.81
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.81
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.81
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.8
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 99.8
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.8
3hmu_A472 Aminotransferase, class III; structural genomics, 99.8
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.8
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 99.79
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 99.79
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 99.78
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.76
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.76
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.76
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.7
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 99.69
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.68
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 99.66
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 99.65
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 99.42
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 99.41
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 99.37
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.34
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=9e-48  Score=404.16  Aligned_cols=383  Identities=18%  Similarity=0.176  Sum_probs=313.2

Q ss_pred             ccccccCCCcccc----ccCCCCCcHHHHHHHHHHHHhcccccccCCCCcCCcc------hHHHHHHHHHhhCCCCCCcc
Q 011871           60 SCFSVTEPEADDE----FTGDKEAYMAGVLARYRKTLMERTKHHLGYPYNLDFD------YGALAQLQHFSINNLGDPFI  129 (476)
Q Consensus        60 ~~~~~~~p~~~~~----~~~~~~~~~~~il~~~~~~~~~~~~~~~g~p~~~~~~------~~~l~~~l~~~~n~~g~~~~  129 (476)
                      +++...+|+++..    .+|++|.+.+++++++.+.+.++.+ +|.||+++++.      ++.+++++...+|+++..|.
T Consensus        33 ~v~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~-~~~~p~~~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~  111 (481)
T 4e1o_A           33 RVTPDVQPGYLRAQLPESAPEDPDSWDSIFGDIERIIMPGVV-HWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWA  111 (481)
T ss_dssp             CSSCCCCTTTTGGGSCSSCCSSCCCHHHHHHHHHHHTGGGCC-CTTSTTBCSSSCCCCCHHHHHHHHHHHHHCCCCSSTT
T ss_pred             CCCCCCCHHHHHHhcCCCCCCCCCCHHHHHHHHHHHHhcCCC-CCCCCCeeEeCCCCCCHHHHHHHHHHHHhCcccCCcC
Confidence            4566667776664    7899999999999999999988876 67899987764      57889999999999888887


Q ss_pred             cCccchhhHHHHHHHHHHHHHHcCCCCCc--------ccEEEcCCchhHHHHHHHHHHhh-----------------CCC
Q 011871          130 ESNYGVHSRQFEVGVLDWFARLWELENNE--------YWGYITNCGTEGNLHGILVGREV-----------------FPD  184 (476)
Q Consensus       130 ~~~~~~~~~~le~~~~~~la~l~g~~~~~--------~~g~~t~ggt~An~~al~aa~~~-----------------~p~  184 (476)
                      .++   ..+++|+++.+|+++++|++...        .+|++|+|||+||++|++++|++                 .|+
T Consensus       112 ~~p---~~~~lE~~v~~~l~~l~g~~~~~~~~~~~~~~~g~~~~ggt~an~~al~~ar~~~~~~~~~~~~~~~~~~~~~~  188 (481)
T 4e1o_A          112 SSP---ACTELEMNVMDWLAKMLGLPEHFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESSLNAR  188 (481)
T ss_dssp             TCH---HHHHHHHHHHHHHHHHHTCCGGGCTTCTTCBCEEEEESCHHHHHHHHHHHHHHHHHHHHHHHCTTSCHHHHHTT
T ss_pred             CCc---HHHHHHHHHHHHHHHHhCCChhhhccccCCCCceEEeCchHHHHHHHHHHHHHHHHHHhhhcCcccccccccCC
Confidence            766   78899999999999999998532        36899999999999999999864                 157


Q ss_pred             cEEEecCCCchHHHHHHHHcCCeEEEEeCCCCCccCHHHHHHHHHcC---CCCcEEEEEeeCCCccccccCHHHHHHHHH
Q 011871          185 GILYASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFKAKLLQN---KDKPAIINVNIGTTVKGAVDDLDLVIQTLE  261 (476)
Q Consensus       185 ~~Vl~s~~~H~S~~~~~~~~G~~v~~v~~~~~g~~D~~~Le~~l~~~---~~~p~~vv~t~gtt~tG~id~l~~I~~ia~  261 (476)
                      ++||+++.+|+|+.+++++.|++++.||+++++.||+++|+++|+++   ..+|++|++++++|++|.++|+++|+++|+
T Consensus       189 ~~v~~s~~~H~s~~~~~~~~g~~~~~v~~~~~~~~d~~~Le~~i~~~~~~g~~~~~vv~~~~~t~~G~id~l~~I~~la~  268 (481)
T 4e1o_A          189 LVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVFVCATLGTTGVCAFDCLSELGPICA  268 (481)
T ss_dssp             EEEEEETTSCHHHHHHHHHHTCEEEEECCCTTSCCCHHHHHHHHHHHHHTTCEEEEEEEEBSCTTTCCBCCHHHHHHHHH
T ss_pred             eEEEEcCcchHHHHHHHHhCCCceEEEEcCCCCcCCHHHHHHHHHHHHhCCCCcEEEEEecCCCCCcCcCCHHHHHHHHH
Confidence            89999999999999999999999999999989999999999999765   234788999999999999999999999999


Q ss_pred             HhCCCCCceEEEEecCcccccccccccCCCCCCcccccEEEEcCCCCCCCCCCceeEEeehhh--hhhhcCCccccCCCC
Q 011871          262 ESGFTQDRFYIHCDGALFGLMMPFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEH--INVLSSNVEYLASRD  339 (476)
Q Consensus       262 ~~g~~~~~~~lhvD~a~~g~~~~~~~~~~~~~~~~~~Dsi~~s~hK~l~~p~~~G~l~~~~~~--~~~l~~~~~yl~~~~  339 (476)
                      +||+     |+|||+||+++.+..........+.+.+|++++++|||+++|.+||+++++++.  .+.+.....|+....
T Consensus       269 ~~~~-----~lhvDaA~g~~~~~~~~~~~~~~gi~~aDsi~~~~hK~l~~p~g~g~l~~~~~~~l~~~~~~~~~yl~~~~  343 (481)
T 4e1o_A          269 REGL-----WLHIDAAYAGTAFLCPEFRGFLKGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHAN  343 (481)
T ss_dssp             HHTC-----EEEEECTTGGGGGGSGGGGGGGTTGGGCSEEEECHHHHSSCCSSCEEEEESBHHHHHTTTCCCCGGGCCTT
T ss_pred             HcCC-----eEEeehhhHHHHHhChhhHHHhcCcccCCEEEEChHHhcCCCCceEEEEEeCHHHHHHHhcCCchhccCcc
Confidence            9999     999999999875543333323344456899999999999999999999999873  345555667775432


Q ss_pred             ---------CcccCCCCChhHHHHHHHHHHhChhcHHHHHHHHHHHHHHHHHHHHhc-CCeEeecCCeeEEEEecCCcH-
Q 011871          340 ---------ATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDA-GISAMLNELSSTVVFERPQDE-  408 (476)
Q Consensus       340 ---------~~~~~sr~~~~~l~~~~~l~~~g~~g~~~~~~~~~~~a~~l~~~L~~~-g~~~~~~~~~~iv~f~~~~~~-  408 (476)
                               .++.++|+ +.++++|++++.+|.+++++++++..+++++|.+.|++. ++.++.++..++++|+.++.. 
T Consensus       344 ~~~~~~~~~~~~~~~r~-~~~l~~~~al~~~g~~g~~~~~~~~~~~a~~l~~~L~~~~g~~~~~~~~~~~v~f~~~~~~~  422 (481)
T 4e1o_A          344 SGVATDFMHWQIPLSRR-FRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNS  422 (481)
T ss_dssp             TTTSCCGGGGSSSSCCC-CTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCTTEECCSCCCSSEEEEEESSCHH
T ss_pred             cCCCCCcccccccCCCC-ccHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHhcCCCeEEecCCceeEEEEEeCCchH
Confidence                     35667877 468999999999999999999999999999999999998 444444566889999875421 


Q ss_pred             ---HHhhce------eec----ccCCEEEEEE-cCCCCHHHHHHHHHHHHHHHHHHHh
Q 011871          409 ---EFVRRW------QLA----CQGNIAHVVV-MPNVTIDKLDDFLNELIENRSTWYE  452 (476)
Q Consensus       409 ---~~~~~~------~l~----~~~~~lRv~~-~~~~T~edid~~~~~l~~~~~~~~~  452 (476)
                         ++.+++      .+.    .....+|+++ ++++|++||++++++|+++.+++.+
T Consensus       423 ~~~~l~~~L~~~g~~~~~~~~~~g~~~lR~~~~~~~tt~~di~~~~~~i~~~~~~l~~  480 (481)
T 4e1o_A          423 LTENVLKEIAKAGRLFLIPATIQDKLIIRFTVTSQFTTRDDILRDWNLIRDAATLILS  480 (481)
T ss_dssp             HHHHHHHHHHHHCSSBCEEEEETTEEEEEEECCCTTCCHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHhCCeEEEEeeEECCEEEEEEEeCCCCCCHHHHHHHHHHHHHHHHHHhh
Confidence               222211      111    1235799985 5778999999999999999887654



>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 476
d1js3a_476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 2e-30
d1pmma_450 c.67.1.6 (A:) Glutamate decarboxylase beta, GadB { 1e-27
d3bc8a1445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 1e-19
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Pyridoxal-dependent decarboxylase
domain: DOPA decarboxylase
species: Pig (Sus scrofa) [TaxId: 9823]
 Score =  121 bits (303), Expect = 2e-30
 Identities = 60/426 (14%), Positives = 126/426 (29%), Gaps = 70/426 (16%)

Query: 81  MAGVLARYRKTLMERTKH-----HLGYPYNLDFDYGALAQLQHFSINNLGDPFIESNYGV 135
              +L    K +M    H        Y          LA +   +I  +G  +  S    
Sbjct: 53  FEDILQDVEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPA-- 110

Query: 136 HSRQFEVGVLDWFARLWEL-------ENNEYWGYITNCGTEGNLHGILVGRE-------- 180
              + E  ++DW  ++ +L       E  E  G I    +E  L  +L  R         
Sbjct: 111 -CTELETVMMDWLGKMLQLPEAFLAGEAGEGGGVIQGSASEATLVALLAARTKVVRRLQA 169

Query: 181 ---------VFPDGILYASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFK---AKL 228
                    V    + YAS ++H SV +A  +  ++   +       +  +  +    + 
Sbjct: 170 ASPGLTQGAVLEKLVAYASDQAHSSVERAGLIGGVKLKAIPSDGKFAMRASALQEALERD 229

Query: 229 LQNKDKPAIINVNIGTTVKGAVDDLDLVIQTLEESGFTQDRFYIHCDGALFGLMMPFVKK 288
                 P  +   +GTT   + D+L  V     E        ++H D A  G      + 
Sbjct: 230 KAAGLIPFFVVATLGTTSCCSFDNLLEVGPICHEEDI-----WLHVDAAYAGSAFICPEF 284

Query: 289 APKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEHINVLSSNVEYLASRDA-------- 340
              ++  +   S + + HK++     C     +       +  ++ +  + +        
Sbjct: 285 RHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFKLDPVYLKHSHQGSGLIT 344

Query: 341 -----TIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAMLNE 395
                 +   R   + + +W+     G KG Q  ++K ++ +H  +  +L      +  E
Sbjct: 345 DYRHWQLPLGRRFRS-LKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQDPRFEVCAE 403

Query: 396 -LSSTVVFERPQDEEFVRRW-QLACQGNIAHV--------------VVMPNVTIDKLDDF 439
                V F     +       +        H+              +    V    +   
Sbjct: 404 VTLGLVCFRLKGSDGLNEALLERINSARKIHLVPCRLRGQFVLRFAICSRKVESGHVRLA 463

Query: 440 LNELIE 445
              +  
Sbjct: 464 WEHIRG 469


>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Length = 450 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query476
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 100.0
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 100.0
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 100.0
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 99.97
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.97
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.97
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 99.97
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.97
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.97
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.95
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 99.95
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.95
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.94
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.94
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.94
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 99.93
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.93
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.92
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 99.91
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 99.91
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.9
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.9
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 99.9
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 99.9
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.9
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.89
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.89
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 99.89
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 99.89
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.89
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 99.89
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.88
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 99.88
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.87
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 99.86
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.86
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.85
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.85
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.85
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.83
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.82
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.81
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.8
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.79
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.79
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.79
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.77
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.77
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.77
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.76
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.76
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.75
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.74
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 99.74
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 99.74
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.73
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.73
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.72
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.7
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.7
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 99.69
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 99.69
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 99.68
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.66
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.65
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.64
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.64
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.63
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.61
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.6
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.6
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.57
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 99.56
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.53
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.53
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.5
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 99.49
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.48
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 99.48
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.48
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 99.43
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.41
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 99.4
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 99.33
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.3
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 99.14
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Pyridoxal-dependent decarboxylase
domain: DOPA decarboxylase
species: Pig (Sus scrofa) [TaxId: 9823]
Probab=100.00  E-value=3.2e-54  Score=447.93  Aligned_cols=380  Identities=17%  Similarity=0.225  Sum_probs=316.7

Q ss_pred             ccccCCCcccc----ccCCCCCcHHHHHHHHHHHHhcccccccCCCCcCCcc------hHHHHHHHHHhhCCCCCCcccC
Q 011871           62 FSVTEPEADDE----FTGDKEAYMAGVLARYRKTLMERTKHHLGYPYNLDFD------YGALAQLQHFSINNLGDPFIES  131 (476)
Q Consensus        62 ~~~~~p~~~~~----~~~~~~~~~~~il~~~~~~~~~~~~~~~g~p~~~~~~------~~~l~~~l~~~~n~~g~~~~~~  131 (476)
                      ....+|+++..    .+|+.|.+.+++++++.+.+.++.+ +|+||+++++.      ++.+++++...+|+++..|..+
T Consensus        30 ~~~~~p~~l~~~~~~~~P~~g~~~~~~l~~~~~~i~~~~~-~~~~P~f~~~~~~~~~~~~~l~~~~~~~~n~n~~~~~~s  108 (476)
T d1js3a_          30 YPDVQPGYLRPLIPATAPQEPDTFEDILQDVEKIIMPGVT-HWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAAS  108 (476)
T ss_dssp             SCCCCTTCSGGGSCSSCCSSCCCHHHHHHHHHHTTGGGCC-CTTSTTBCSSSCCCCCHHHHHHHHHHHHHCCCCSSGGGC
T ss_pred             CCCCChHHHHHhcCcccCcCCCCHHHHHHHHHHHHhCCCC-CCCCCCeeEeCCCCCCHHHHHHHHHHHhhcccccchhhh
Confidence            33445655543    7899999999999999999988875 78899998874      6889999999999999999888


Q ss_pred             ccchhhHHHHHHHHHHHHHHcCCCCC-------cccEEEcCCchhHHHHHHHHHHhhC-----------------CCcEE
Q 011871          132 NYGVHSRQFEVGVLDWFARLWELENN-------EYWGYITNCGTEGNLHGILVGREVF-----------------PDGIL  187 (476)
Q Consensus       132 ~~~~~~~~le~~~~~~la~l~g~~~~-------~~~g~~t~ggt~An~~al~aa~~~~-----------------p~~~V  187 (476)
                      |   ..+++|+++.+|+++++|++..       ..+|++|+|||+||++|+++||++.                 +..+|
T Consensus       109 p---~~t~iE~~v~~wl~~l~g~p~~~~~~~~~~~~G~~~~Ggs~anl~al~~AR~~~~~~~~~~~~g~~~~~~~~~~vv  185 (476)
T d1js3a_         109 P---ACTELETVMMDWLGKMLQLPEAFLAGEAGEGGGVIQGSASEATLVALLAARTKVVRRLQAASPGLTQGAVLEKLVA  185 (476)
T ss_dssp             H---HHHHHHHHHHHHHHHHTTCCGGGCCTTTCSCEEEEESCHHHHHHHHHHHHHHHHHHHHHHHSTTCCHHHHHHHEEE
T ss_pred             h---hHHHHHHHHHHHHHHHhCCCcccccCCCCCCCceECCcHHHHHHHHHHHHHHHHHHhhcccccCcccccccCceEE
Confidence            7   5789999999999999999742       3578999999999999999998741                 23589


Q ss_pred             EecCCCchHHHHHHHHcCCeEEEEeCCCCCccCHHHHHHHHHcC---CCCcEEEEEeeCCCccccccCHHHHHHHHHHhC
Q 011871          188 YASRESHYSVFKAARMYRMECVKVDCLISGEIDCADFKAKLLQN---KDKPAIINVNIGTTVKGAVDDLDLVIQTLEESG  264 (476)
Q Consensus       188 l~s~~~H~S~~~~~~~~G~~v~~v~~~~~g~~D~~~Le~~l~~~---~~~p~~vv~t~gtt~tG~id~l~~I~~ia~~~g  264 (476)
                      |+++.+|||+.|+++++|++++.||++++++||+++|+++|+++   +..|++|++|.|||.+|.+|||++|+++|++||
T Consensus       186 ~~s~~~H~Si~ka~~~lGl~~~~v~~d~~~~md~~~L~~~i~~~~~~g~~p~~VvataGtt~~G~iDpl~~I~~i~~~~~  265 (476)
T d1js3a_         186 YASDQAHSSVERAGLIGGVKLKAIPSDGKFAMRASALQEALERDKAAGLIPFFVVATLGTTSCCSFDNLLEVGPICHEED  265 (476)
T ss_dssp             EEETTCCHHHHHHHHHHTCEEEEECCCTTSCCCHHHHHHHHHHHHHTTCEEEEEEEEBSCTTTCCBCCHHHHHHHHHHTT
T ss_pred             EecccccHHHHHHHHhcCceEEEeccCCCCCcCHHHHHHHHHHHHhcCCCcEEEeecCCCccceeeccHHHHHHHHHhcC
Confidence            99999999999999999999999999999999999999999864   567899999999999999999999999999999


Q ss_pred             CCCCceEEEEecCcccccccccccCCCCCCcccccEEEEcCCCCCCCCCCceeEEeehhh--hhhhcCCccccCC-----
Q 011871          265 FTQDRFYIHCDGALFGLMMPFVKKAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRMEH--INVLSSNVEYLAS-----  337 (476)
Q Consensus       265 ~~~~~~~lhvD~a~~g~~~~~~~~~~~~~~~~~~Dsi~~s~hK~l~~p~~~G~l~~~~~~--~~~l~~~~~yl~~-----  337 (476)
                      +     |+||||||||+..++.++...+.+.+.+||+++++|||+++|++||++++|++.  ...+.....|+..     
T Consensus       266 ~-----wlHVDAA~Gg~~~~~~~~~~~~~gi~~aDSit~d~HK~l~~P~~~g~~l~r~~~~~~~~~~~~~~~~~~~~~~~  340 (476)
T d1js3a_         266 I-----WLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFKLDPVYLKHSHQGS  340 (476)
T ss_dssp             C-----EEEEECTTGGGGGGSTTTGGGGTTGGGCSEEEECHHHHSSCCSSCEEEEESCHHHHHGGGC------------C
T ss_pred             c-----EEEEecccchhhhhhcchhhhhcCCcccceeeecCccccccCCcceeecccchHHHHHHHhcChhhhccccccc
Confidence            9     999999999998888777777888888999999999999999999999999863  3444444445432     


Q ss_pred             ------CCCcccCCCCChhHHHHHHHHHHhChhcHHHHHHHHHHHHHHHHHHHHhcCCeEe-ecCCeeEEEEecCCcHHH
Q 011871          338 ------RDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLLDAGISAM-LNELSSTVVFERPQDEEF  410 (476)
Q Consensus       338 ------~~~~~~~sr~~~~~l~~~~~l~~~g~~g~~~~~~~~~~~a~~l~~~L~~~g~~~~-~~~~~~iv~f~~~~~~~~  410 (476)
                            .+.++.+||+ +.++++|.+++.+|.+|+++++++..+++++|.+.|++.+.+.+ .+|..++|+|+..+.+.+
T Consensus       341 ~~~~~~~~~~~~~sr~-~~al~lw~~l~~~G~~g~~~~i~~~~~lA~~l~~~l~~~~~fel~~~p~l~iV~Fr~~~~d~~  419 (476)
T d1js3a_         341 GLITDYRHWQLPLGRR-FRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQDPRFEVCAEVTLGLVCFRLKGSDGL  419 (476)
T ss_dssp             CSCCCGGGSSSCSCCC-CTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTEEECSCCCSSEEEEEESSCHHH
T ss_pred             cccccccccccccchh-hHHHHHHHHHHHHhHhHHHHHHHHHHHHHHHHHHHHhcCCCeEEECCCceEEEEEEccCChHH
Confidence                  2356889997 45799999999999999999999999999999999999865554 466789999997543332


Q ss_pred             ----hhce------ee-cc---cCCEEEEEE-cCCCCHHHHHHHHHHHHHHHHHHH
Q 011871          411 ----VRRW------QL-AC---QGNIAHVVV-MPNVTIDKLDDFLNELIENRSTWY  451 (476)
Q Consensus       411 ----~~~~------~l-~~---~~~~lRv~~-~~~~T~edid~~~~~l~~~~~~~~  451 (476)
                          .+++      .+ ++   +..++|+++ ++.+|++|||.+++.|+++.+++.
T Consensus       420 n~~l~~~l~~~G~~~~s~t~~~g~~~lR~~i~n~~Tt~~did~~~~~i~~~a~~ll  475 (476)
T d1js3a_         420 NEALLERINSARKIHLVPCRLRGQFVLRFAICSRKVESGHVRLAWEHIRGLAAELL  475 (476)
T ss_dssp             HHHHHHHHHHHTSCBCEEEEETTEEEEEEECCCTTCCHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCCEEEeeeeECCEEEEEEEeCCCCCCHHHHHHHHHHHHHHHHHHh
Confidence                2211      11 11   234789875 599999999999999999998764



>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure