Citrus Sinensis ID: 011881


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-----
MGAVLSLAGPRCRKRDYIDTSQNESCKKQKLSPSNYEDGLRLIPSLPDELSIQILARVPRIFYLNLRAVSRKWKATVTSPELFEVRKELGTTEEWLYILTKVSDDRLLWHALDPLSKRWQRLPPLPNVVDEEESRKSSSGLWNMVGSGIKIAEVVRGWLGWNDTLPQMPFCGCAIGAVDGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGGVSRARGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVPQSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYAFDPSSSLNSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISILRADPRDHLGSTSSSSVSLSADSLHEHSDSLAESDTVVWKAIATRNFGSAELVSCQVLDV
cccEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHccccccccEEEEEEcccccccEEEEECcccccEEEcccccccccccccEEEcccEEEEEcccEEEEEEEcccccccccccccccccCEEEEEccEEEEEccccccccccEEEEECcccccEEEccccccccccEEEEEEccEEEEEccECccccccccccEEEEECcccccEEEccccccccccccccccccccccEEEEcEEEEccEEEEcccccccccccccEEEEEccccccEEEccccccccccccccccCEEEEEccEEEEEcccccccccEEEEECcccccEEEccccccccccccccccEEEEEEccEEEEEEccccccEEEEEEccccccCEEEEcccEEcccccCEccccccccccEEEEEEEECcccccEEEEEEEECc
*GAV***********************************LRLIPSLPDELSIQILARVPRIFYLNLRAVSRKWKATVTSPELFEVRKELGTTEEWLYILTKVSDDRLLWHALDPLSKRWQRLPPLPNVVDEEESRKSSSGLWNMVGSGIKIAEVVRGWLGWNDTLPQMPFCGCAIGAVDGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGGVSRARGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVPQSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYAFDPSSSLNSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISILRADPRDHLGSTSSSSVSLSADSLHEHSDSLAESDTVVWKAIATRNFGSAELVSCQVLDV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGAVLSLAGPRCRKRDYIDTSQNESCKKQKLSPSNYEDGLRLIPSLPDELSIQILARVPRIFYLNLRAVSRKWKATVTSPELFEVRKELGTTEEWLYILTKVSDDRLLWHALDPLSKRWQRLPPLPNVVDEEESRKSSSGLWNMVGSGIKIAEVVRGWLGWNDTLPQMPFCGCAIGAVDGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGGVSRARGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVPQSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYAFDPSSSLNSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISILRADPRDHLGSTSSSSVSLSADSLHEHSDSLAESDTVVWKAIATRNFGSAELVSCQVLDV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box/kelch-repeat protein At1g22040 probableQ9LM55

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZGK, chain A
Confidence level:very confident
Coverage over the Query: 90-127,169-270,286-412,440-466
View the alignment between query and template
View the model in PyMOL
Template: 1ZGK, chain A
Confidence level:very confident
Coverage over the Query: 66-128,170-270,286-398
View the alignment between query and template
View the model in PyMOL
Template: 2WOZ, chain A
Confidence level:very confident
Coverage over the Query: 92-127,167-270,286-421,438-473
View the alignment between query and template
View the model in PyMOL
Template: 2E31, chain A
Confidence level:confident
Coverage over the Query: 61-87
View the alignment between query and template
View the model in PyMOL
Template: 3VNG, chain A
Confidence level:probable
Coverage over the Query: 172-269,285-325
View the alignment between query and template
View the model in PyMOL