Citrus Sinensis ID: 011881

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-----
MGAVLSLAGPRCRKRDYIDTSQNESCKKQKLSPSNYEDGLRLIPSLPDELSIQILARVPRIFYLNLRAVSRKWKATVTSPELFEVRKELGTTEEWLYILTKVSDDRLLWHALDPLSKRWQRLPPLPNVVDEEESRKSSSGLWNMVGSGIKIAEVVRGWLGWNDTLPQMPFCGCAIGAVDGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGGVSRARGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVPQSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYAFDPSSSLNSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISILRADPRDHLGSTSSSSVSLSADSLHEHSDSLAESDTVVWKAIATRNFGSAELVSCQVLDV
cccEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHccccccccEEEEEEcccccccEEEEEEcccccEEEcccccccccccccEEEcccEEEEEcccEEEEEEEcccccccccccccccccEEEEEEccEEEEEccccccccccEEEEEEcccccEEEccccccccccEEEEEEccEEEEEccEEccccccccccEEEEEEcccccEEEccccccccccccccccccccccEEEEcEEEEccEEEEcccccccccccccEEEEEccccccEEEccccccccccccccccEEEEEEccEEEEEcccccccccEEEEEEcccccEEEccccccccccccccccEEEEEEccEEEEEEccccccEEEEEEccccccEEEEEcccEEcccccEEccccccccccEEEEEEEEEcccccEEEEEEEEEc
cccEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHccccccEEEEEEcccccccEEEEEccccccEEEccccccccccccEEEEccEEEEEEcccccEEEEcccccccccccccccccccEEEEEccEEEEEEcccccccccEEEEEccccccEEEcccccccccccEEEEEccEEEEEEEEcccccccccccEEEEEccccccEEEccccccccccccEEEEEcccccEEEEEEEEEccEEEEEccccccccccccEEEEEccccccEEEcccccccccccccccccEEEEEccEEEEEcccccccccEEEEEccccccEEEEcccccccccccccccEEEEEEccEEEEEEccccccEEEEEEEcccccccEEEccEEEccccccEEEEEEEcccEEEEEEEEEccccccEEEEEEEEcc
mgavlslagprcrkrdyidtsqnesckkqklspsnyedglrlipslpdelSIQILARVPRIFYLNLRAVSRKwkatvtspeLFEVRKELGTTEEWLYILTKVSDDRLLWHALdplskrwqrlpplpnvvdeeesrksssGLWNMVGSGIKIAEVVRgwlgwndtlpqmpfcgcaigavDGCLYVlggfsrtsamrcvrrydpiantwneatsmsvgRAYCktgilndklYVVGgvsrarggltplqsaevfdpttdawsevpsmpfsraqglpnaffadmlKPIATGMtsymgrlcvpqslyswpffvdvggeiydpdtnswvempigmgegwparqagtklsvvldgelyafdpssslnsakikvydqkedtWKVVIGkvpirdfadsespylLSAFHGKLHVLTKDAsrnisilradprdhlgstssssvslsadslhehsdslaesDTVVWKAIATrnfgsaelvscqvldv
mgavlslagprcrkrdyidtsqnesckkqklspsnyeDGLRLIPSLPDELSIQILARVPRIFYLNLRAVSrkwkatvtspelfevrkelgtteEWLYILTKVSDDRLLWHALdplskrwqrlpplpnvvdeeesrksssglwnmVGSGIKIAEVVRGWLGWNDTLPQMPFCGCAIGAVDGCLYVLGGFSRTSAMRCVRRYDPIantwneatsmsVGRAYCKTGILNDKLYVVGGVSRArggltplqsaevfDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVPQSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYafdpssslnsakikvydqkedtwkVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISILRadprdhlgstsSSSVSLSADSLHEHSDSLAESDTVVWKAIATRnfgsaelvscqvldv
MGAVLSLAGPRCRKRDYIDTSQNESCKKQKLSPSNYEDGLRLIPSLPDELSIQILARVPRIFYLNLRAVSRKWKATVTSPELFEVRKELGTTEEWLYILTKVSDDRLLWHALDPLSKRWQRLPPLPNVVDEEESRKSSSGLWNMVGSGIKIAEVVRGWLGWNDTLPQMPFCGCAIGAVDGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGGVSRARGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVPQSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYAFDPSSSLNSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISILRADPRDHlgstssssvslsadslHEHSDSLAESDTVVWKAIATRNFGSAELVSCQVLDV
***************************************LRLIPSLPDELSIQILARVPRIFYLNLRAVSRKWKATVTSPELFEVRKELGTTEEWLYILTKVSDDRLLWHALDPLSKRWQRL*****************GLWNMVGSGIKIAEVVRGWLGWNDTLPQMPFCGCAIGAVDGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGGVSRARGGLTPLQSAEVFDPTTDAWSEV***PFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVPQSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYAFDPSSSLNSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISI***********************************TVVWKAIATRNFGSAELVSCQV***
*GAV****************************************SLPDELSIQILARVPRIFYLNLRAVSRKWKATVTSPELFEVRKELGTTEEWLYILTKVSDDRLLWHALDPLSKRWQRLPPLPNVVDEEESRKSSSGLWNMVGSGIKIAEVVRGWLGWNDTLPQMPFCGCAIGAVDGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGGVSRARGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVPQSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYAFDPSSSLNSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISILRADPRDHLGSTSSSSVSLSADSLHEHSDSLAESDTVVWKAIATRNFGSAELVSCQVLDV
MGAVLSLAGPRCRKRDYID**************SNYEDGLRLIPSLPDELSIQILARVPRIFYLNLRAVSRKWKATVTSPELFEVRKELGTTEEWLYILTKVSDDRLLWHALDPLSKRWQRLPPLPNV***********GLWNMVGSGIKIAEVVRGWLGWNDTLPQMPFCGCAIGAVDGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGGVSRARGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVPQSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYAFDPSSSLNSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISILRADPRD*************************ESDTVVWKAIATRNFGSAELVSCQVLDV
**************************************GLRLIPSLPDELSIQILARVPRIFYLNLRAVSRKWKATVTSPELFEVRKELGTTEEWLYILTKVSDDRLLWHALDPLSKRWQRLPPLPNVVDEEESRKSSSGLWNMVGSGIKIAEVVRGWLGWNDTLPQMPFCGCAIGAVDGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGGVSRARGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVPQSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYAFDPSSSLNSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISILRADPRDHLGSTSSSSVSLSADSLHEHSDSLAESDTVVWKAIATRNFGSAELVSCQVLDV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGAVLSLAGPRCRKRDYIDTSQNESCKKQKLSPSNYEDGLRLIPSLPDELSIQILARVPRIFYLNLRAVSRKWKATVTSPELFEVRKELGTTEEWLYILTKVSDDRLLWHALDPLSKRWQRLPPLPNVVDEEESRKSSSGLWNMVGSGIKIAEVVRGWLGWNDTLPQMPFCGCAIGAVDGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGGVSRARGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVPQSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYAFDPSSSLNSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISILRADPRDHLGSTSSSSVSLSADSLHEHSDSLAESDTVVWKAIATRNFGSAELVSCQVLDV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query475 2.2.26 [Sep-21-2011]
Q9LM55475 F-box/kelch-repeat protei yes no 0.987 0.987 0.661 1e-177
Q93W93434 F-box/kelch-repeat protei no no 0.728 0.797 0.281 1e-33
Q8LAW2372 F-box protein AFR OS=Arab no no 0.578 0.739 0.275 4e-26
Q9C6Z0398 F-box/kelch-repeat protei no no 0.637 0.761 0.245 5e-25
Q9CAG8376 F-box/kelch-repeat protei no no 0.688 0.869 0.253 9e-21
Q9SVA0375 F-box/kelch-repeat protei no no 0.745 0.944 0.260 4e-20
Q0WW40383 F-box/kelch-repeat protei no no 0.383 0.475 0.279 6e-18
Q9M1W7352 F-box/kelch-repeat protei no no 0.555 0.75 0.254 6e-17
Q9ZW38415 F-box/kelch-repeat protei no no 0.665 0.761 0.253 6e-17
Q9SJ04372 F-box/kelch-repeat protei no no 0.625 0.798 0.249 1e-16
>sp|Q9LM55|FBK8_ARATH F-box/kelch-repeat protein At1g22040 OS=Arabidopsis thaliana GN=At1g22040 PE=2 SV=1 Back     alignment and function desciption
 Score =  620 bits (1599), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 318/481 (66%), Positives = 388/481 (80%), Gaps = 12/481 (2%)

Query: 1   MGAVLSLAGPRCRKRDYIDTSQNESC-----KKQKLSPSN-YEDGLRLIPSLPDELSIQI 54
           MG+V+SL+   C KR    TSQ+  C     K++K+S  N  E+  RLIPSLPDELSIQI
Sbjct: 1   MGSVMSLS---CSKRK--ATSQDVECSSESRKRRKISSENDEEECCRLIPSLPDELSIQI 55

Query: 55  LARVPRIFYLNLRAVSRKWKATVTSPELFEVRKELGTTEEWLYILTKVSDDRLLWHALDP 114
           LAR+PRI Y ++R VSR+W++ V++ E++ +RKELG TEEWLY+LTK  +D+LLW+ALDP
Sbjct: 56  LARLPRICYSSVRLVSRRWRSAVSTSEVYSLRKELGRTEEWLYVLTKGHEDKLLWYALDP 115

Query: 115 LSKRWQRLPPLPNVVDEEESRKSSSGLWNMVGSGIKIAEVVRGWLGWNDTLPQMPFCGCA 174
           +S +WQRLPP+P VV EEESRKS SGLWNM+     +  +VR +LG  D+  QMPFCGCA
Sbjct: 116 VSTKWQRLPPMPVVVYEEESRKSLSGLWNMITPSFNVGAIVRSFLGRRDSSEQMPFCGCA 175

Query: 175 IGAVDGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGG 234
           IGAVDG LYV+GG SR+  + CV R+DPI N+W+E +SM   RAY KTG+LN KLYVVGG
Sbjct: 176 IGAVDGGLYVIGGLSRSKTVSCVWRFDPILNSWSEVSSMLASRAYSKTGVLNKKLYVVGG 235

Query: 235 VSRARGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGR 294
           V R RGGL+PLQSAEV+DP+TDAWSEVPSMPFS+AQ LPNAF AD+LKPIATGMT Y GR
Sbjct: 236 VDRGRGGLSPLQSAEVYDPSTDAWSEVPSMPFSKAQVLPNAFLADLLKPIATGMTCYNGR 295

Query: 295 LCVPQSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYAFD 354
           LCVPQSLYSWPFFVDVGGE+YDP+TN WVEMP GMGEGWPARQAGTKLSVV+DGELYAFD
Sbjct: 296 LCVPQSLYSWPFFVDVGGEVYDPETNLWVEMPSGMGEGWPARQAGTKLSVVVDGELYAFD 355

Query: 355 PSSSLNSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNIS 414
           PSSS+ + KIKVYDQKEDTWKVVIG+VP+ D  DSESPYLL+ FHGKLH +T+D + N++
Sbjct: 356 PSSSMENGKIKVYDQKEDTWKVVIGEVPVYDLTDSESPYLLAGFHGKLHFITRDPNHNVT 415

Query: 415 ILRADPRDHLGSTSSSSVSLSADSLHEHSDSLAESDTVVWKAIATRNFGSAELVSCQVLD 474
           +LRAD   ++  +SSSS S S    H  +++  +SDTV WK IAT++FG+AELVSCQV+D
Sbjct: 416 VLRAD-VPNIPVSSSSSSSSSVSIPHLKTNAPNKSDTVTWKLIATKDFGAAELVSCQVID 474

Query: 475 V 475
           +
Sbjct: 475 I 475

Arabidopsis thaliana (taxid: 3702)
>sp|Q93W93|FBK22_ARATH F-box/kelch-repeat protein At1g55270 OS=Arabidopsis thaliana GN=At1g55270 PE=2 SV=1 Back     alignment and function description
>sp|Q8LAW2|AFR_ARATH F-box protein AFR OS=Arabidopsis thaliana GN=AFR PE=1 SV=2 Back     alignment and function description
>sp|Q9C6Z0|FBK17_ARATH F-box/kelch-repeat protein At1g30090 OS=Arabidopsis thaliana GN=At1g30090 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAG8|FBK28_ARATH F-box/kelch-repeat protein At1g67480 OS=Arabidopsis thaliana GN=At1g67480 PE=2 SV=1 Back     alignment and function description
>sp|Q9SVA0|FK101_ARATH F-box/kelch-repeat protein At4g39580 OS=Arabidopsis thaliana GN=At4g39580 PE=4 SV=1 Back     alignment and function description
>sp|Q0WW40|FBK5_ARATH F-box/kelch-repeat protein At1g16250 OS=Arabidopsis thaliana GN=At1g16250 PE=2 SV=1 Back     alignment and function description
>sp|Q9M1W7|SKI30_ARATH F-box/kelch-repeat protein SKIP30 OS=Arabidopsis thaliana GN=SKIP30 PE=1 SV=2 Back     alignment and function description
>sp|Q9ZW38|FBK36_ARATH F-box/kelch-repeat protein At2g29600 OS=Arabidopsis thaliana GN=At2g29600 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJ04|SKIP6_ARATH F-box/kelch-repeat protein SKIP6 OS=Arabidopsis thaliana GN=SKIP6 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query475
225459394477 PREDICTED: F-box/kelch-repeat protein At 1.0 0.995 0.779 0.0
427199304473 F-box family protein [Morella rubra] 0.991 0.995 0.716 0.0
224082190474 f-box family protein [Populus trichocarp 0.991 0.993 0.711 0.0
356515826476 PREDICTED: F-box/kelch-repeat protein At 0.995 0.993 0.692 0.0
255545612471 conserved hypothetical protein [Ricinus 0.987 0.995 0.691 0.0
356548407475 PREDICTED: F-box/kelch-repeat protein At 0.993 0.993 0.650 0.0
297845212478 kelch repeat-containing F-box family pro 0.989 0.983 0.654 1e-180
356551628471 PREDICTED: F-box/kelch-repeat protein At 0.985 0.993 0.639 1e-178
225447858479 PREDICTED: F-box/kelch-repeat protein At 1.0 0.991 0.647 1e-177
449438171479 PREDICTED: F-box/kelch-repeat protein At 0.995 0.987 0.635 1e-176
>gi|225459394|ref|XP_002285816.1| PREDICTED: F-box/kelch-repeat protein At1g22040 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/477 (77%), Positives = 416/477 (87%), Gaps = 2/477 (0%)

Query: 1   MGAVLSLAGPRCRKRDYIDTSQNESCKKQKLSPSNYEDGLRLIPSLPDELSIQILARVPR 60
           MG+ LSLAGP+ R  ++ + SQ+E+CK+Q++S S  E+  RLIPSLPDE+SI ILAR+PR
Sbjct: 1   MGSFLSLAGPKSRTSEHDEGSQHETCKRQRMSSSFNEENPRLIPSLPDEISILILARLPR 60

Query: 61  IFYLNLRAVSRKWKATVTSPELFEVRKELGTTEEWLYILTKVSDDRLLWHALDPLSKRWQ 120
           I Y +LR VSR WKAT+TSPELF +RKELG TEEWLYILTKV +DRLLWHALDPLS+RWQ
Sbjct: 61  ICYFDLRLVSRNWKATITSPELFNLRKELGKTEEWLYILTKVEEDRLLWHALDPLSRRWQ 120

Query: 121 RLPPLPNVVDEEESRKSSSGLW--NMVGSGIKIAEVVRGWLGWNDTLPQMPFCGCAIGAV 178
           RLP +PNVV EEESRK SSGLW  NMVG  IKIA+V+RGWLG  DTL QMPFCGCAIGAV
Sbjct: 121 RLPSMPNVVYEEESRKVSSGLWMWNMVGPSIKIADVIRGWLGRKDTLDQMPFCGCAIGAV 180

Query: 179 DGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGGVSRA 238
           DGCLYVLGGFS  S MRCV R+DPI N W+E T MS GRAYCKTGILNDKLYVVGGVSR 
Sbjct: 181 DGCLYVLGGFSSASTMRCVWRFDPILNAWSEVTPMSTGRAYCKTGILNDKLYVVGGVSRG 240

Query: 239 RGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVP 298
           RGGLTPLQSAEVFDP TD WS++PSMPFSRAQ LP AF ADMLKPIATGMTSYMGRLCVP
Sbjct: 241 RGGLTPLQSAEVFDPCTDTWSQIPSMPFSRAQVLPTAFLADMLKPIATGMTSYMGRLCVP 300

Query: 299 QSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYAFDPSSS 358
           QSLYSWPFFVDVGGEIYDP+TNSWVEMPIGMG+GWPARQAGTKLSVV+DGELYAFDPSSS
Sbjct: 301 QSLYSWPFFVDVGGEIYDPETNSWVEMPIGMGDGWPARQAGTKLSVVVDGELYAFDPSSS 360

Query: 359 LNSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISILRA 418
           L+S  IKVYDQKED WKVVIGKVPI DF DSESPYLL+ FHGKLH++TKDA+ +I++L+A
Sbjct: 361 LDSGNIKVYDQKEDAWKVVIGKVPICDFTDSESPYLLAGFHGKLHIITKDANHDIAVLQA 420

Query: 419 DPRDHLGSTSSSSVSLSADSLHEHSDSLAESDTVVWKAIATRNFGSAELVSCQVLDV 475
           D RD+LG   S+S S SA S HEHSD LAE++TVVWK IATR+FG+AELVSCQVLD+
Sbjct: 421 DLRDNLGFPPSTSPSCSAASSHEHSDLLAETETVVWKVIATRDFGTAELVSCQVLDI 477

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|427199304|gb|AFY26883.1| F-box family protein [Morella rubra] Back     alignment and taxonomy information
>gi|224082190|ref|XP_002306596.1| f-box family protein [Populus trichocarpa] gi|222856045|gb|EEE93592.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356515826|ref|XP_003526599.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Glycine max] Back     alignment and taxonomy information
>gi|255545612|ref|XP_002513866.1| conserved hypothetical protein [Ricinus communis] gi|223546952|gb|EEF48449.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356548407|ref|XP_003542593.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Glycine max] Back     alignment and taxonomy information
>gi|297845212|ref|XP_002890487.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297336329|gb|EFH66746.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356551628|ref|XP_003544176.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Glycine max] Back     alignment and taxonomy information
>gi|225447858|ref|XP_002271882.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449438171|ref|XP_004136863.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Cucumis sativus] gi|449478907|ref|XP_004155450.1| PREDICTED: F-box/kelch-repeat protein At1g22040-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query475
TAIR|locus:2030601475 AT1G22040 "AT1G22040" [Arabido 0.995 0.995 0.649 4e-170
TAIR|locus:2035696434 AT1G55270 "AT1G55270" [Arabido 0.442 0.483 0.308 8.5e-30
TAIR|locus:2095138422 AT3G27150 "AT3G27150" [Arabido 0.492 0.554 0.297 1.3e-19
TAIR|locus:2008773376 AT1G67480 "AT1G67480" [Arabido 0.463 0.585 0.319 1.8e-19
TAIR|locus:2098926358 SKIP4 "AT3G61350" [Arabidopsis 0.454 0.603 0.283 4.9e-19
TAIR|locus:2122501375 AT4G39580 "AT4G39580" [Arabido 0.170 0.216 0.352 1.2e-18
TAIR|locus:2012547441 AT1G14330 "AT1G14330" [Arabido 0.547 0.589 0.242 2.3e-18
TAIR|locus:2198304398 AT1G30090 "AT1G30090" [Arabido 0.258 0.309 0.331 3.2e-18
TAIR|locus:2175143393 AT5G60570 "AT5G60570" [Arabido 0.469 0.567 0.290 4.4e-18
TAIR|locus:2077299352 AT3G63220 "AT3G63220" [Arabido 0.24 0.323 0.322 2.7e-17
TAIR|locus:2030601 AT1G22040 "AT1G22040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1654 (587.3 bits), Expect = 4.0e-170, P = 4.0e-170
 Identities = 310/477 (64%), Positives = 379/477 (79%)

Query:     1 MGAVLSLAGPRCRKRDYIDTS-QNESCKKQKLSPSNYEDGL-RLIPSLPDELSIQILARV 58
             MG+V+SL+  + RK    D    +ES K++K+S  N E+   RLIPSLPDELSIQILAR+
Sbjct:     1 MGSVMSLSCSK-RKATSQDVECSSESRKRRKISSENDEEECCRLIPSLPDELSIQILARL 59

Query:    59 PRIFYLNLRAVSRKWKATVTSPELFEVRKELGTTEEWLYILTKVSDDRLLWHALDPLSKR 118
             PRI Y ++R VSR+W++ V++ E++ +RKELG TEEWLY+LTK  +D+LLW+ALDP+S +
Sbjct:    60 PRICYSSVRLVSRRWRSAVSTSEVYSLRKELGRTEEWLYVLTKGHEDKLLWYALDPVSTK 119

Query:   119 WQRLPPLPNVVDEEESRKSSSGLWNMVGSGIKIAEVVRGWLGWNDTLPQMPFCGCAIGAV 178
             WQRLPP+P VV EEESRKS SGLWNM+     +  +VR +LG  D+  QMPFCGCAIGAV
Sbjct:   120 WQRLPPMPVVVYEEESRKSLSGLWNMITPSFNVGAIVRSFLGRRDSSEQMPFCGCAIGAV 179

Query:   179 DGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGGVSRA 238
             DG LYV+GG SR+  + CV R+DPI N+W+E +SM   RAY KTG+LN KLYVVGGV R 
Sbjct:   180 DGGLYVIGGLSRSKTVSCVWRFDPILNSWSEVSSMLASRAYSKTGVLNKKLYVVGGVDRG 239

Query:   239 RGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVP 298
             RGGL+PLQSAEV+DP+TDAWSEVPSMPFS+AQ LPNAF AD+LKPIATGMT Y GRLCVP
Sbjct:   240 RGGLSPLQSAEVYDPSTDAWSEVPSMPFSKAQVLPNAFLADLLKPIATGMTCYNGRLCVP 299

Query:   299 QSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELYAFDPSSS 358
             QSLYSWPFFVDVGGE+YDP+TN WVEMP GMGEGWPARQAGTKLSVV+DGELYAFDPSSS
Sbjct:   300 QSLYSWPFFVDVGGEVYDPETNLWVEMPSGMGEGWPARQAGTKLSVVVDGELYAFDPSSS 359

Query:   359 LNSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISILRA 418
             + + KIKVYDQKEDTWKVVIG+VP+ D  DSESPYLL+ FHGKLH +T+D + N+++LRA
Sbjct:   360 MENGKIKVYDQKEDTWKVVIGEVPVYDLTDSESPYLLAGFHGKLHFITRDPNHNVTVLRA 419

Query:   419 DPRDHXXXXXXXXXXXXXXXXHEHSDSLAESDTVVWKAIATRNFGSAELVSCQVLDV 475
             D   +                H  +++  +SDTV WK IAT++FG+AELVSCQV+D+
Sbjct:   420 DV-PNIPVSSSSSSSSSVSIPHLKTNAPNKSDTVTWKLIATKDFGAAELVSCQVIDI 475
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
TAIR|locus:2035696 AT1G55270 "AT1G55270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095138 AT3G27150 "AT3G27150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008773 AT1G67480 "AT1G67480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098926 SKIP4 "AT3G61350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122501 AT4G39580 "AT4G39580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012547 AT1G14330 "AT1G14330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198304 AT1G30090 "AT1G30090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175143 AT5G60570 "AT5G60570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077299 AT3G63220 "AT3G63220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LM55FBK8_ARATHNo assigned EC number0.66110.98730.9873yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00015284001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (477 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query475
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-11
pfam0134446 pfam01344, Kelch_1, Kelch motif 8e-10
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-09
pfam0134446 pfam01344, Kelch_1, Kelch motif 1e-09
smart0061247 smart00612, Kelch, Kelch domain 4e-09
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 6e-09
smart0061247 smart00612, Kelch, Kelch domain 5e-08
pfam0064648 pfam00646, F-box, F-box domain 7e-07
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 7e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 1e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 7e-05
pfam1293747 pfam12937, F-box-like, F-box-like 3e-04
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 5e-04
PRK14131376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 0.003
TIGR03547346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 0.004
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 65.2 bits (159), Expect = 2e-11
 Identities = 49/227 (21%), Positives = 89/227 (39%), Gaps = 29/227 (12%)

Query: 161 WNDTLPQM--PFCGCAIGAVDGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGRA 218
           WN   P++  P     +   +  +YV+GG   + ++  V  + P  + W E   +   R 
Sbjct: 323 WNKV-PELIYPRKNPGVTVFNNRIYVIGGIYNSISLNTVESWKPGESKWREEPPLIFPRY 381

Query: 219 YCKTGILNDKLYVVGGVSRARGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFA 278
                 +N+ +YV+GG+S+       L++ E F   T+ WS+   +P S   G    +  
Sbjct: 382 NPCVVNVNNLIYVIGGISK---NDELLKTVECFSLNTNKWSKGSPLPISHYGG-CAIYHD 437

Query: 279 DMLKPIATGMTSYMGRLCVPQSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQA 338
             +  I  G  SY+  + V   + S           Y+P TN W E+             
Sbjct: 438 GKIYVI--GGISYIDNIKVYNIVES-----------YNPVTNKWTELS-------SLNFP 477

Query: 339 GTKLSV-VLDGELYAF-DPSSSLNSAKIKVYDQKEDTWKVVIGKVPI 383
               S+ + + ++Y            +I+VYD K +TW +      +
Sbjct: 478 RINASLCIFNNKIYVVGGDKYEYYINEIEVYDDKTNTWTLFCKFPKV 524

Length = 534
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 475
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PLN02153341 epithiospecifier protein 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
PLN02153341 epithiospecifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
KOG4693392 consensus Uncharacterized conserved protein, conta 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.97
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.96
KOG1230 521 consensus Protein containing repeated kelch motifs 99.95
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.95
KOG0379482 consensus Kelch repeat-containing proteins [Genera 99.95
KOG1230521 consensus Protein containing repeated kelch motifs 99.93
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.91
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.78
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.64
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.36
PF1396450 Kelch_6: Kelch motif 99.34
PF1396450 Kelch_6: Kelch motif 99.26
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.2
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.07
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.04
PF1341549 Kelch_3: Galactose oxidase, central domain 99.0
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.94
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.91
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.87
smart0061247 Kelch Kelch domain. 98.84
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.82
PF1341549 Kelch_3: Galactose oxidase, central domain 98.77
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.7
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.67
smart0061247 Kelch Kelch domain. 98.63
PLN02772398 guanylate kinase 98.5
PF1385442 Kelch_5: Kelch motif 98.38
PF1385442 Kelch_5: Kelch motif 98.35
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.32
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.32
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 98.24
PLN02772 398 guanylate kinase 98.18
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.03
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.01
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 97.92
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.81
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.64
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.53
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.22
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.22
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.2
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.12
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.02
KOG0281499 consensus Beta-TrCP (transducin repeats containing 96.91
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 96.57
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.16
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 95.9
PF12768281 Rax2: Cortical protein marker for cell polarity 95.83
PF03089337 RAG2: Recombination activating protein 2; InterPro 95.18
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.13
PF12768281 Rax2: Cortical protein marker for cell polarity 94.85
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.62
KOG2997366 consensus F-box protein FBX9 [General function pre 94.56
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 94.22
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 93.89
PF09910339 DUF2139: Uncharacterized protein conserved in arch 93.82
PRK00178430 tolB translocation protein TolB; Provisional 93.41
smart00284255 OLF Olfactomedin-like domains. 93.37
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 93.25
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 92.89
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 92.02
KOG2055514 consensus WD40 repeat protein [General function pr 92.01
KOG2055514 consensus WD40 repeat protein [General function pr 91.56
PRK13684334 Ycf48-like protein; Provisional 91.46
PRK04922433 tolB translocation protein TolB; Provisional 90.83
KOG0310 487 consensus Conserved WD40 repeat-containing protein 90.61
PRK13684334 Ycf48-like protein; Provisional 90.21
PRK04792448 tolB translocation protein TolB; Provisional 90.11
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 90.05
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 89.6
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 89.53
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 89.41
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 89.37
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 88.67
PRK04043419 tolB translocation protein TolB; Provisional 88.64
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 88.31
PRK04792448 tolB translocation protein TolB; Provisional 87.29
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 86.43
PTZ00421 493 coronin; Provisional 86.18
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 86.02
smart00284255 OLF Olfactomedin-like domains. 85.84
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 85.66
PRK04922433 tolB translocation protein TolB; Provisional 85.22
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 84.3
PRK05137435 tolB translocation protein TolB; Provisional 84.29
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 83.71
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 83.43
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 83.43
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 83.0
PRK05137435 tolB translocation protein TolB; Provisional 82.93
PRK11028330 6-phosphogluconolactonase; Provisional 82.72
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 82.33
PF12217367 End_beta_propel: Catalytic beta propeller domain o 82.15
PRK11028330 6-phosphogluconolactonase; Provisional 81.32
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 81.11
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 80.87
KOG3545249 consensus Olfactomedin and related extracellular m 80.34
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-44  Score=372.26  Aligned_cols=317  Identities=26%  Similarity=0.479  Sum_probs=255.2

Q ss_pred             CCCCCHHHHHHHhccCChh-h---hHHHHHhhhhhhhhcCCh-hhHHhhhccC-CCccEEEEEEeecC-C--ceeeEEec
Q 011881           43 IPSLPDELSIQILARVPRI-F---YLNLRAVSRKWKATVTSP-ELFEVRKELG-TTEEWLYILTKVSD-D--RLLWHALD  113 (475)
Q Consensus        43 ~~~LP~dl~~~iL~~lp~~-~---l~~l~~vck~W~~l~~s~-~~~~~r~~~~-~~~~~lyv~gg~~~-~--~~~~~~yd  113 (475)
                      .|.||+..+.++....+.. .   ...+-.-.++|..+.... ..+..|.... ...+.||++||... .  ...+.+||
T Consensus       228 ~~ll~~~~l~~~v~~~~~~~~~~~c~~~l~ea~~~~~~~~~~~~~~~~~t~~r~~~~~~l~~vGG~~~~~~~~~~ve~yd  307 (571)
T KOG4441|consen  228 LPLLPPQFLVEIVESEPLIKRDSACRDLLDEAKKYHLLPQRRPVMQSPRTRPRRSVSGKLVAVGGYNRQGQSLRSVECYD  307 (571)
T ss_pred             ccCCCHHHHHHHHhhhhhhccCHHHHHHHHHHHHHhhCcccCccccCCCcccCcCCCCeEEEECCCCCCCcccceeEEec
Confidence            3677777776666555411 1   111112223454443321 1333333333 45689999999875 2  23789999


Q ss_pred             CCCCceeeCCCCCCCcchhhhcccccccceeeccceeeeeEeeecccCCCCCCCCCccceeEEEeCCEEEEEcCCC-CCC
Q 011881          114 PLSKRWQRLPPLPNVVDEEESRKSSSGLWNMVGSGIKIAEVVRGWLGWNDTLPQMPFCGCAIGAVDGCLYVLGGFS-RTS  192 (475)
Q Consensus       114 ~~~~~W~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~pr~~~~~~~~~~~lyv~GG~~-~~~  192 (475)
                      |.++.|..+++|+.+                                         |..+++++++|.||++||.+ +..
T Consensus       308 ~~~~~w~~~a~m~~~-----------------------------------------r~~~~~~~~~~~lYv~GG~~~~~~  346 (571)
T KOG4441|consen  308 PKTNEWSSLAPMPSP-----------------------------------------RCRVGVAVLNGKLYVVGGYDSGSD  346 (571)
T ss_pred             CCcCcEeecCCCCcc-----------------------------------------cccccEEEECCEEEEEccccCCCc
Confidence            999999999999864                                         88999999999999999999 688


Q ss_pred             CcceEEEEeCCCCcEEeCCCCCCccceeeeEEECCEEEEEeceecCCCCcccCCeEEEEeCCCCCeEecCCCCccccCCC
Q 011881          193 AMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGGVSRARGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGL  272 (475)
Q Consensus       193 ~~~~~~~yd~~t~~W~~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~  272 (475)
                      .++++++||+.+++|+.+++|+.+|..+++++++|+||++||.+    +...++++|+|||.+++|+.+++|+.+|++  
T Consensus       347 ~l~~ve~YD~~~~~W~~~a~M~~~R~~~~v~~l~g~iYavGG~d----g~~~l~svE~YDp~~~~W~~va~m~~~r~~--  420 (571)
T KOG4441|consen  347 RLSSVERYDPRTNQWTPVAPMNTKRSDFGVAVLDGKLYAVGGFD----GEKSLNSVECYDPVTNKWTPVAPMLTRRSG--  420 (571)
T ss_pred             ccceEEEecCCCCceeccCCccCccccceeEEECCEEEEEeccc----cccccccEEEecCCCCcccccCCCCcceee--
Confidence            89999999999999999999999999999999999999999984    566789999999999999999999999998  


Q ss_pred             CccccccccccceeeEEEeCCEEEEeccCCCCC-ceeccceEEEeCCCCceEEcCCCCCCCCCCccCCCeEEEEECCeEE
Q 011881          273 PNAFFADMLKPIATGMTSYMGRLCVPQSLYSWP-FFVDVGGEIYDPDTNSWVEMPIGMGEGWPARQAGTKLSVVLDGELY  351 (475)
Q Consensus       273 ~~~~~~~~~~~~~~~~~~~~~~iyv~GG~~~~~-~~~~~~~~~yd~~~~~W~~~~~~~~~~~p~~~~~~~~~~~~~~~ly  351 (475)
                                   +++++++|+||++||.++.. .+..+  ++|||.+++|+.+++ |..    +|.+++ +++++++||
T Consensus       421 -------------~gv~~~~g~iYi~GG~~~~~~~l~sv--e~YDP~t~~W~~~~~-M~~----~R~~~g-~a~~~~~iY  479 (571)
T KOG4441|consen  421 -------------HGVAVLGGKLYIIGGGDGSSNCLNSV--ECYDPETNTWTLIAP-MNT----RRSGFG-VAVLNGKIY  479 (571)
T ss_pred             -------------eEEEEECCEEEEEcCcCCCccccceE--EEEcCCCCceeecCC-ccc----ccccce-EEEECCEEE
Confidence                         99999999999999998877 55444  999999999999998 654    555555 899999999


Q ss_pred             EEcCCCCC-CCCeEEEEeCCCCcEEEcCCcCccccCCCCCCCeEEEEeCCeEEEEeecCCCCeeEEEecCCCCCCCCccc
Q 011881          352 AFDPSSSL-NSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVLTKDASRNISILRADPRDHLGSTSSS  430 (475)
Q Consensus       352 v~GG~~~~-~~~~v~~yd~~~~~W~~v~~~~p~~~~~~~r~~~~~~~~~~~l~v~GG~~~~~~~v~~~d~~~~~~~~~~~  430 (475)
                      ++||.+.. ....+++|||++++|+.+.      .+..+|..+++++.++++|++||..++.          .+.     
T Consensus       480 vvGG~~~~~~~~~VE~ydp~~~~W~~v~------~m~~~rs~~g~~~~~~~ly~vGG~~~~~----------~l~-----  538 (571)
T KOG4441|consen  480 VVGGFDGTSALSSVERYDPETNQWTMVA------PMTSPRSAVGVVVLGGKLYAVGGFDGNN----------NLN-----  538 (571)
T ss_pred             EECCccCCCccceEEEEcCCCCceeEcc------cCccccccccEEEECCEEEEEecccCcc----------ccc-----
Confidence            99998762 2357999999999999985      3677889999999999999999966653          222     


Q ss_pred             cccCCcccccccccccccccceeeeeeecc
Q 011881          431 SVSLSADSLHEHSDSLAESDTVVWKAIATR  460 (475)
Q Consensus       431 ~~~~~~~~~~~~~~~~~d~~~~~W~~~~~~  460 (475)
                              .+|    .|||.+++|+..+.+
T Consensus       539 --------~ve----~ydp~~d~W~~~~~~  556 (571)
T KOG4441|consen  539 --------TVE----CYDPETDTWTEVTEP  556 (571)
T ss_pred             --------eeE----EcCCCCCceeeCCCc
Confidence                    233    679999999999994

>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG3545 consensus Olfactomedin and related extracellular matrix glycoproteins [Extracellular structures] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query475
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 4e-11
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-07
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 4e-10
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 2e-08
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 4e-10
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 2e-08
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 7e-10
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 8e-10
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-09
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 9e-09
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 4e-06
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 2e-05
4asc_A315 Crystal Structure Of The Kelch Domain Of Human Kbtb 4e-05
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-04
2uvk_A357 Structure Of Yjht Length = 357 6e-04
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure 
Iteration: 1

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 64/159 (40%), Gaps = 22/159 (13%)
Query: 172 GCAIGAVDGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYV 231
           G  +    G +Y LGG+   + +  V +YDP    W   T M+  R+     +LND +YV
Sbjct: 152 GAGLVVASGVIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYV 211
Query: 232 VGGVSRARGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSY 291
           VGG      G   L S E ++  TD+W+ V SM   R                  G T  
Sbjct: 212 VGGFD----GTAHLSSVEAYNIRTDSWTTVTSMTTPRCY---------------VGATVL 252
Query: 292 MGRLCVPQSLYSWPFFVDVGGEIYDPDTNSWVEMPIGMG 330
            GRL              +  E YDP  +SW E+   MG
Sbjct: 253 RGRLYAIAGYDGNSLLSSI--ECYDPIIDSW-EVVTSMG 288
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|4ASC|A Chain A, Crystal Structure Of The Kelch Domain Of Human Kbtbd5 Length = 315 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|2UVK|A Chain A, Structure Of Yjht Length = 357 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query475
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 7e-40
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-32
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-29
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 5e-29
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-12
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 8e-40
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-32
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 5e-32
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-28
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 4e-11
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 4e-39
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 9e-33
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-27
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-27
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-10
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 8e-39
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 6e-32
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-29
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-16
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-35
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-34
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-32
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 8e-23
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 7e-35
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 7e-35
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 5e-32
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 8e-24
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-12
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-21
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-16
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-14
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 1e-14
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 7e-14
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-09
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 2e-04
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
 Score =  144 bits (366), Expect = 7e-40
 Identities = 66/301 (21%), Positives = 100/301 (33%), Gaps = 83/301 (27%)

Query: 110 HALDPLSKRWQRLPPLPNVVDEEESRKSSSG---LWNMV--------GSGIKIAEV---- 154
              DP ++ W  LP +         ++       L + +         S +   E     
Sbjct: 34  EKYDPKTQEWSFLPSIT-------RKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYT 86

Query: 155 VRGWLGWNDTLPQMPF--CGCAIGAVDGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATS 212
                 W  ++  M           +   +YV GGF  +     + RYDP  + W+    
Sbjct: 87  ADEDGVWY-SVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGD 145

Query: 213 MSVGRAYCKTGILNDKLYVVGGVSRARGGLTPLQSAEVFDPTTDAWSEVPSMPFSRAQGL 272
           M   R      + +  +Y +GG      GL  L S E +DP T  W+ V  M   R+   
Sbjct: 146 MQTAREGAGLVVASGVIYCLGG----YDGLNILNSVEKYDPHTGHWTNVTPMATKRS--- 198

Query: 273 PNAFFADMLKPIATGMTSYMGRLCVPQSLYSWPFFVDVGG----------EIYDPDTNSW 322
                         G+      + V            VGG          E Y+  T+SW
Sbjct: 199 ------------GAGVALLNDHIYV------------VGGFDGTAHLSSVEAYNIRTDSW 234

Query: 323 VE---MPIGMGEGWPARQAGTKLSVVLDGELYA---FDPSSSLNSAKIKVYDQKEDTWKV 376
                M          R      + VL G LYA   +D +S L+S  I+ YD   D+W+V
Sbjct: 235 TTVTSMTT-------PRCYVG--ATVLRGRLYAIAGYDGNSLLSS--IECYDPIIDSWEV 283

Query: 377 V 377
           V
Sbjct: 284 V 284
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query475
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 100.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.96
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.7
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.64
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.59
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.48
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.45
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.01
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.81
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.59
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.58
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.57
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.47
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.4
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.25
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.98
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.95
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.6
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.48
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.47
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.47
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 96.45
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.39
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.18
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 96.15
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.13
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.11
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.1
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.05
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 95.83
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.7
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.68
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.61
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 95.59
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 95.59
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 95.46
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.36
3jrp_A379 Fusion protein of protein transport protein SEC13 95.26
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.26
4a2l_A795 BT_4663, two-component system sensor histidine kin 95.25
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.24
1itv_A195 MMP9; adaptive molecular recognition, beta propell 95.17
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 95.16
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.09
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.09
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.08
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.06
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 94.95
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 94.92
3jrp_A379 Fusion protein of protein transport protein SEC13 94.89
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 94.72
3v9f_A 781 Two-component system sensor histidine kinase/RESP 94.69
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.6
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 94.59
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.52
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 94.49
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 94.4
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 94.31
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 94.22
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 94.22
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 94.22
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 94.17
4a2l_A 795 BT_4663, two-component system sensor histidine kin 94.16
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 94.14
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 94.07
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 94.04
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 94.03
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 93.86
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 93.85
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 93.78
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 93.65
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 93.64
3ow8_A321 WD repeat-containing protein 61; structural genomi 93.64
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 93.39
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 93.33
3jro_A 753 Fusion protein of protein transport protein SEC13 93.25
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 93.23
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 93.22
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 93.21
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 93.2
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 93.14
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 93.1
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 93.09
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 93.07
3ow8_A321 WD repeat-containing protein 61; structural genomi 93.01
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 92.94
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 92.9
4g56_B357 MGC81050 protein; protein arginine methyltransfera 92.86
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 92.86
3jro_A 753 Fusion protein of protein transport protein SEC13 92.81
4e54_B435 DNA damage-binding protein 2; beta barrel, double 92.69
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 92.69
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.67
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 92.64
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 92.57
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 92.53
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 92.48
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 92.42
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 92.24
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 92.17
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 92.07
1itv_A195 MMP9; adaptive molecular recognition, beta propell 92.0
3ott_A758 Two-component system sensor histidine kinase; beta 91.94
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 91.86
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 91.79
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 91.7
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 91.58
2fp8_A322 Strictosidine synthase; six bladed beta propeller 91.54
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 91.54
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 91.49
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 91.37
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 91.3
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 91.14
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 91.13
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 91.07
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 91.07
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 90.8
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 90.58
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 90.44
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 90.38
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 90.27
4e54_B435 DNA damage-binding protein 2; beta barrel, double 90.05
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 89.93
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 89.91
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 89.86
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 89.86
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 89.85
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 89.38
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 89.37
4g56_B357 MGC81050 protein; protein arginine methyltransfera 89.17
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 89.12
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 88.99
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 88.8
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 88.75
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 88.71
3p5b_L400 Low density lipoprotein receptor variant; B-propel 88.69
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 88.69
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 88.65
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 88.52
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 88.49
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 88.49
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 88.39
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 88.26
3v65_B386 Low-density lipoprotein receptor-related protein; 88.18
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 87.9
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 87.76
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 87.7
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 87.57
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 87.57
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 87.5
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 87.46
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 87.17
3ott_A 758 Two-component system sensor histidine kinase; beta 86.84
2pm7_B297 Protein transport protein SEC13, protein transport 86.77
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 86.46
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 86.44
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 86.28
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 86.16
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 86.11
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 86.09
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 85.95
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 85.35
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 85.27
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 85.26
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 85.03
1ck7_A631 Protein (gelatinase A); hydrolase (metalloprotease 85.01
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 84.96
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 84.95
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 84.95
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 84.87
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 84.29
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 84.03
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 83.87
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 83.84
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 83.65
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 83.61
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 83.52
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 83.38
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 82.96
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 82.45
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 81.95
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 81.93
2ymu_A577 WD-40 repeat protein; unknown function, two domain 81.85
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 81.56
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 81.48
2fp8_A322 Strictosidine synthase; six bladed beta propeller 81.2
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 81.14
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 80.88
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 80.84
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 80.73
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 80.64
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 80.47
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=6.1e-44  Score=346.22  Aligned_cols=279  Identities=23%  Similarity=0.380  Sum_probs=232.5

Q ss_pred             hccCCCccEEEEEEeecCC-ceeeEEecCCCCceeeCCCCCCCcchhhhcccccccceeeccceeeeeEeeecccCCCCC
Q 011881           87 KELGTTEEWLYILTKVSDD-RLLWHALDPLSKRWQRLPPLPNVVDEEESRKSSSGLWNMVGSGIKIAEVVRGWLGWNDTL  165 (475)
Q Consensus        87 ~~~~~~~~~lyv~gg~~~~-~~~~~~yd~~~~~W~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (475)
                      +.....++.||++||.... ...+++||+.+++|..++++|.                                      
T Consensus        18 ~~~~~~~~~i~v~GG~~~~~~~~~~~~d~~~~~W~~~~~~p~--------------------------------------   59 (308)
T 1zgk_A           18 SHAPKVGRLIYTAGGYFRQSLSYLEAYNPSNGTWLRLADLQV--------------------------------------   59 (308)
T ss_dssp             ---CCCCCCEEEECCBSSSBCCCEEEEETTTTEEEECCCCSS--------------------------------------
T ss_pred             ccccCCCCEEEEEeCcCCCCcceEEEEcCCCCeEeECCCCCc--------------------------------------
Confidence            3344567899999997322 2378999999999999987775                                      


Q ss_pred             CCCCccceeEEEeCCEEEEEcCC----CCCCCcceEEEEeCCCCcEEeCCCCCCccceeeeEEECCEEEEEeceecCCCC
Q 011881          166 PQMPFCGCAIGAVDGCLYVLGGF----SRTSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGGVSRARGG  241 (475)
Q Consensus       166 ~p~pr~~~~~~~~~~~lyv~GG~----~~~~~~~~~~~yd~~t~~W~~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~  241 (475)
                         ||..|++++++++||++||.    ++....+++++||+.+++|+.+++||.+|..|++++++++|||+||...    
T Consensus        60 ---~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~----  132 (308)
T 1zgk_A           60 ---PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHG----  132 (308)
T ss_dssp             ---CCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEET----
T ss_pred             ---ccccceEEEECCEEEEECCCcCCCCCCeecceEEEECCCCCeEeECCCCCcCccccEEEEECCEEEEEcCCCC----
Confidence               48889999999999999998    5556678999999999999999999999999999999999999999853    


Q ss_pred             cccCCeEEEEeCCCCCeEecCCCCccccCCCCccccccccccceeeEEEeCCEEEEeccCCCCCceeccceEEEeCCCCc
Q 011881          242 LTPLQSAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVPQSLYSWPFFVDVGGEIYDPDTNS  321 (475)
Q Consensus       242 ~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~~~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~yd~~~~~  321 (475)
                      ...++++++||+.+++|+.++++|.+|..               +++++++++|||+||.+......++  ++||+.+++
T Consensus       133 ~~~~~~~~~yd~~~~~W~~~~~~p~~r~~---------------~~~~~~~~~iyv~GG~~~~~~~~~~--~~yd~~~~~  195 (308)
T 1zgk_A          133 CIHHNSVERYEPERDEWHLVAPMLTRRIG---------------VGVAVLNRLLYAVGGFDGTNRLNSA--ECYYPERNE  195 (308)
T ss_dssp             TEECCCEEEEETTTTEEEECCCCSSCCBS---------------CEEEEETTEEEEECCBCSSCBCCCE--EEEETTTTE
T ss_pred             CcccccEEEECCCCCeEeECCCCCccccc---------------eEEEEECCEEEEEeCCCCCCcCceE--EEEeCCCCe
Confidence            23578999999999999999999999998               8999999999999998876555444  999999999


Q ss_pred             eEEcCCCCCCCCCCccCCCeEEEEECCeEEEEcCCCCC-CCCeEEEEeCCCCcEEEcCCcCccccCCCCCCCeEEEEeCC
Q 011881          322 WVEMPIGMGEGWPARQAGTKLSVVLDGELYAFDPSSSL-NSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHG  400 (475)
Q Consensus       322 W~~~~~~~~~~~p~~~~~~~~~~~~~~~lyv~GG~~~~-~~~~v~~yd~~~~~W~~v~~~~p~~~~~~~r~~~~~~~~~~  400 (475)
                      |+.+++ +    |.++.+++ +++++++|||+||.+.. ..+++++||+++++|+++.      .++.+|..++++.+++
T Consensus       196 W~~~~~-~----p~~r~~~~-~~~~~~~iyv~GG~~~~~~~~~v~~yd~~~~~W~~~~------~~p~~r~~~~~~~~~~  263 (308)
T 1zgk_A          196 WRMITA-M----NTIRSGAG-VCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVA------PMKHRRSALGITVHQG  263 (308)
T ss_dssp             EEECCC-C----SSCCBSCE-EEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECC------CCSSCCBSCEEEEETT
T ss_pred             EeeCCC-C----CCccccce-EEEECCEEEEEeCCCCCCccceEEEEeCCCCcEEECC------CCCCCccceEEEEECC
Confidence            999875 4    44566665 67889999999997543 2479999999999999985      3567788999999999


Q ss_pred             eEEEEeecCCCCeeEEEecCCCCCCCCccccccCCcccccccccccccccceeeeeeecccCCCcc
Q 011881          401 KLHVLTKDASRNISILRADPRDHLGSTSSSSVSLSADSLHEHSDSLAESDTVVWKAIATRNFGSAE  466 (475)
Q Consensus       401 ~l~v~GG~~~~~~~v~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~  466 (475)
                      +|||+||.....                           .....+.||+++++|+.++.++.++..
T Consensus       264 ~i~v~GG~~~~~---------------------------~~~~v~~yd~~~~~W~~~~~~p~~r~~  302 (308)
T 1zgk_A          264 RIYVLGGYDGHT---------------------------FLDSVECYDPDTDTWSEVTRMTSGRSG  302 (308)
T ss_dssp             EEEEECCBCSSC---------------------------BCCEEEEEETTTTEEEEEEECSSCCBS
T ss_pred             EEEEEcCcCCCc---------------------------ccceEEEEcCCCCEEeecCCCCCCccc
Confidence            999999976532                           111234789999999999988776664
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 475
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-14
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-10
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-10
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-06
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-06
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 3e-05
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-11
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 6e-09
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-08
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 6e-08
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-07
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 5e-04
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 6e-04
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 71.5 bits (173), Expect = 2e-14
 Identities = 33/112 (29%), Positives = 45/112 (40%), Gaps = 4/112 (3%)

Query: 158 WLGWNDTLPQMPFCGCAIGAVDGCLYVLGGFSRTSAMRCVRRYDPIANTWNEATSMSVGR 217
                 T       G  +  +  C+Y  GG+     +  V RYD    TW     M   R
Sbjct: 174 NEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRR 233

Query: 218 AYCKTGILNDKLYVVGGVSRARGGLTPLQSAEVFDPTTDAWSEVPSMPFSRA 269
           +     +   ++YV+GG      G T L S E +DP TD WSEV  M   R+
Sbjct: 234 SALGITVHQGRIYVLGG----YDGHTFLDSVECYDPDTDTWSEVTRMTSGRS 281
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query475
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.96
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.93
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 98.68
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.74
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 97.54
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.29
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 96.8
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 96.29
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 95.63
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 94.9
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 94.4
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 94.38
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 93.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.75
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 93.67
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 93.5
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 93.2
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 93.06
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.02
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 92.69
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 92.5
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 92.07
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 91.85
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 91.03
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 90.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 90.18
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 90.11
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 90.06
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 89.93
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.84
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 89.47
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 89.46
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 89.17
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 88.82
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 88.76
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 88.7
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 86.89
d1hxna_210 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 86.07
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 86.03
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 85.68
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 83.12
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 80.66
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=6.7e-39  Score=304.56  Aligned_cols=274  Identities=24%  Similarity=0.411  Sum_probs=229.1

Q ss_pred             CccEEEEEEeecCCce-eeEEecCCCCceeeCCCCCCCcchhhhcccccccceeeccceeeeeEeeecccCCCCCCCCCc
Q 011881           92 TEEWLYILTKVSDDRL-LWHALDPLSKRWQRLPPLPNVVDEEESRKSSSGLWNMVGSGIKIAEVVRGWLGWNDTLPQMPF  170 (475)
Q Consensus        92 ~~~~lyv~gg~~~~~~-~~~~yd~~~~~W~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~pr  170 (475)
                      .+..|||+||...... .+++||+.+++|.+++++|.                                         ||
T Consensus         3 ~g~~iyv~GG~~~~~~~~~~~yd~~t~~W~~~~~~p~-----------------------------------------~R   41 (288)
T d1zgka1           3 VGRLIYTAGGYFRQSLSYLEAYNPSNGTWLRLADLQV-----------------------------------------PR   41 (288)
T ss_dssp             CCCCEEEECCBSSSBCCCEEEEETTTTEEEECCCCSS-----------------------------------------CC
T ss_pred             cCCEEEEECCcCCCCCceEEEEECCCCeEEECCCCCC-----------------------------------------cc
Confidence            4578999999865433 78899999999999988876                                         48


Q ss_pred             cceeEEEeCCEEEEEcCCCC----CCCcceEEEEeCCCCcEEeCCCCCCccceeeeEEECCEEEEEeceecCCCCcccCC
Q 011881          171 CGCAIGAVDGCLYVLGGFSR----TSAMRCVRRYDPIANTWNEATSMSVGRAYCKTGILNDKLYVVGGVSRARGGLTPLQ  246 (475)
Q Consensus       171 ~~~~~~~~~~~lyv~GG~~~----~~~~~~~~~yd~~t~~W~~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~  246 (475)
                      .+|++++++++|||+||.+.    ...++++++||+.+++|+.+++||.+|.+|++++++++||++||..    +...++
T Consensus        42 ~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~w~~~~~~p~~r~~~~~~~~~~~i~~~gg~~----~~~~~~  117 (288)
T d1zgka1          42 SGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSH----GCIHHN  117 (288)
T ss_dssp             BSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCCCSSCCBTCEEEEETTEEEEECCEE----TTEECC
T ss_pred             ceeEEEEECCEEEEEeCcccCCCCccccchhhhcccccccccccccccceecceeccccceeeEEeccee----cccccc
Confidence            99999999999999999742    3457899999999999999999999999999999999999999985    334578


Q ss_pred             eEEEEeCCCCCeEecCCCCccccCCCCccccccccccceeeEEEeCCEEEEeccCCCCCceeccceEEEeCCCCceEEcC
Q 011881          247 SAEVFDPTTDAWSEVPSMPFSRAQGLPNAFFADMLKPIATGMTSYMGRLCVPQSLYSWPFFVDVGGEIYDPDTNSWVEMP  326 (475)
Q Consensus       247 ~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~~~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~yd~~~~~W~~~~  326 (475)
                      ..+.||+.++.|...+.++.+|..               ++++..++++|++||........+.  +.||+.+++|...+
T Consensus       118 ~~~~~~~~~~~~~~~~~~~~~r~~---------------~~~~~~~~~~~~~GG~~~~~~~~~~--~~~d~~~~~~~~~~  180 (288)
T d1zgka1         118 SVERYEPERDEWHLVAPMLTRRIG---------------VGVAVLNRLLYAVGGFDGTNRLNSA--ECYYPERNEWRMIT  180 (288)
T ss_dssp             CEEEEETTTTEEEECCCCSSCCBS---------------CEEEEETTEEEEECCBCSSCBCCCE--EEEETTTTEEEECC
T ss_pred             eeeeeccccCcccccccccccccc---------------ceeeeeeecceEecCcccccccceE--EEeecccccccccc
Confidence            899999999999999999999998               8899999999999998776655544  99999999999887


Q ss_pred             CCCCCCCCCccCCCeEEEEECCeEEEEcCCCCC-CCCeEEEEeCCCCcEEEcCCcCccccCCCCCCCeEEEEeCCeEEEE
Q 011881          327 IGMGEGWPARQAGTKLSVVLDGELYAFDPSSSL-NSAKIKVYDQKEDTWKVVIGKVPIRDFADSESPYLLSAFHGKLHVL  405 (475)
Q Consensus       327 ~~~~~~~p~~~~~~~~~~~~~~~lyv~GG~~~~-~~~~v~~yd~~~~~W~~v~~~~p~~~~~~~r~~~~~~~~~~~l~v~  405 (475)
                      . .    +..+..++ +++.+++||++||.... ..++.+.||..+++|+.+.      ..+.+|..|+++.++|+||||
T Consensus       181 ~-~----~~~~~~~~-~~~~~~~i~i~GG~~~~~~~~~~~~~~~~~~~~~~~~------~~p~~r~~~~~~~~~~~l~v~  248 (288)
T d1zgka1         181 A-M----NTIRSGAG-VCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVA------PMKHRRSALGITVHQGRIYVL  248 (288)
T ss_dssp             C-C----SSCCBSCE-EEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECC------CCSSCCBSCEEEEETTEEEEE
T ss_pred             c-c----cccccccc-ccceeeeEEEecCccccccccceeeeeecceeeeccc------CccCcccceEEEEECCEEEEE
Confidence            5 2    22333333 78899999999997543 3468999999999999985      256789999999999999999


Q ss_pred             eecCCCCeeEEEecCCCCCCCCccccccCCcccccccccccccccceeeeeeecccCCCcc
Q 011881          406 TKDASRNISILRADPRDHLGSTSSSSVSLSADSLHEHSDSLAESDTVVWKAIATRNFGSAE  466 (475)
Q Consensus       406 GG~~~~~~~v~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~  466 (475)
                      ||..++.                           ....+|+||+.+++|+++++++.+++.
T Consensus       249 GG~~~~~---------------------------~~~~v~~yd~~~~~W~~~~~~p~~R~~  282 (288)
T d1zgka1         249 GGYDGHT---------------------------FLDSVECYDPDTDTWSEVTRMTSGRSG  282 (288)
T ss_dssp             CCBCSSC---------------------------BCCEEEEEETTTTEEEEEEECSSCCBS
T ss_pred             ecCCCCe---------------------------ecceEEEEECCCCEEEECCCCCCCcEe
Confidence            9975442                           111245889999999999997777653
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1hxna_ b.66.1.1 (A:) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure