Citrus Sinensis ID: 012004

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470---
MALNLQIPAEIKALSFLETTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGPPPAWPGRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIGYLDIFKVVELTCDKHKADLVTSPSLEDIIHYDAWAREYAAGLQFSSGRSPVPA
ccccccccccccEEEEEccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccEEEEccccHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHccccccCEEEcHHHHHHHHccccccEEEEHHHccccHHHHHHHHHHcccEEEccHHHHHcccHHHHHHHHHcccEEEcccccHHHHHHHccccccccccEEEEEEcccccccccHHHHHcccHHHHcccccccccccccccccccccHHHHHHHHHHccccccccEEEEEcccccccccEEcccccEEEcccccccHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccc
********AEIKALSFLET*R******KLSGGFPLKRK**ATATFGRIVQCSAQG**PAWPGRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIGYLDIFKVVELTCDKHKADLVTSPSLEDIIHYDAWAREYAAGLQFS********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALNLQIPAEIKALSFLETTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGPPPAWPGRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVxxxxxxxxxxxxxxxxxxxxxPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIGYLDIFKVVELTCDKHKADLVTSPSLEDIIHYDAWAREYAAGLQFSSGRSPVPA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that catalyzes the NADP-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4-phosphate (MEP). Required for chloroplast development.confidentQ9XFS9
1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that catalyzes the NADP-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4-phosphate (MEP). Required for chloroplast development.confidentQ8W250
1-deoxy-D-xylulose 5-phosphate reductoisomerase Catalyzes the NADP-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4-phosphate (MEP).probableQ7NID1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.1.-.-Acting on the CH-OH group of donors.probable
1.1.1.-15-hydroxyprostaglandin dehydrogenase (NAD(+)).probable
1.1.1.2671-deoxy-D-xylulose-5-phosphate reductoisomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AU8, chain A
Confidence level:very confident
Coverage over the Query: 76-465
View the alignment between query and template
View the model in PyMOL