Citrus Sinensis ID: 012004
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 473 | 2.2.26 [Sep-21-2011] | |||||||
| Q9XFS9 | 477 | 1-deoxy-D-xylulose 5-phos | yes | no | 0.995 | 0.987 | 0.809 | 0.0 | |
| Q8W250 | 473 | 1-deoxy-D-xylulose 5-phos | yes | no | 0.995 | 0.995 | 0.797 | 0.0 | |
| Q9XES0 | 470 | 1-deoxy-D-xylulose 5-phos | N/A | no | 0.974 | 0.980 | 0.802 | 0.0 | |
| B0CD21 | 401 | 1-deoxy-D-xylulose 5-phos | yes | no | 0.824 | 0.972 | 0.653 | 1e-154 | |
| Q8YP49 | 399 | 1-deoxy-D-xylulose 5-phos | yes | no | 0.799 | 0.947 | 0.656 | 1e-152 | |
| Q3MDL2 | 398 | 1-deoxy-D-xylulose 5-phos | yes | no | 0.799 | 0.949 | 0.658 | 1e-152 | |
| B2ITX3 | 398 | 1-deoxy-D-xylulose 5-phos | yes | no | 0.799 | 0.949 | 0.658 | 1e-152 | |
| B8HVK1 | 387 | 1-deoxy-D-xylulose 5-phos | yes | no | 0.799 | 0.976 | 0.664 | 1e-151 | |
| B7K5G6 | 398 | 1-deoxy-D-xylulose 5-phos | yes | no | 0.799 | 0.949 | 0.661 | 1e-151 | |
| B1WNP5 | 398 | 1-deoxy-D-xylulose 5-phos | yes | no | 0.799 | 0.949 | 0.692 | 1e-148 |
| >sp|Q9XFS9|DXR_ARATH 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic OS=Arabidopsis thaliana GN=DXR PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 785 bits (2028), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 387/478 (80%), Positives = 432/478 (90%), Gaps = 7/478 (1%)
Query: 1 MALNLQIPAEIKALSFLETTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQ-----G 55
M LN PAE KA+SFL+T+R N +PKLSGGF L+R++ FG+ V+CS +
Sbjct: 2 MTLNSLSPAESKAISFLDTSRFNP-IPKLSGGFSLRRRNQGRG-FGKGVKCSVKVQQQQQ 59
Query: 56 PPPAWPGRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNIT 115
PPPAWPGRAV E R++WDGPKPIS++GSTGSIGTQTLDIVAE+ DKFRVVALAAGSN+T
Sbjct: 60 PPPAWPGRAVPEAPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVT 119
Query: 116 LLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTG 175
LLADQV+RFKP +VAVRNESL++E+KEALA+++ K EI+ GEQGVIE ARHP+AVTVVTG
Sbjct: 120 LLADQVRRFKPALVAVRNESLINELKEALADLDYKLEIIPGEQGVIEVARHPEAVTVVTG 179
Query: 176 IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCI 235
IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA+KHN+KILPADSEHSAIFQCI
Sbjct: 180 IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSAIFQCI 239
Query: 236 QGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGL 295
QGLPEGALR+IILTASGGAFRDWPVEKLKEVKVADALKHPNW+MGKKITVDSATLFNKGL
Sbjct: 240 QGLPEGALRKIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGL 299
Query: 296 EVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERI 355
EVIEAHYLFGAEYD+IEI+IHPQSIIHSM+ETQDSSV+ QLGWPDMRLPI+YTMSWP+R+
Sbjct: 300 EVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPDRV 359
Query: 356 YCSELTWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFI 415
CSE+TWPRLDL KLGSLTF PD KYPS++LAYAAGRAGGTMTGVLSAANEKAVEMFI
Sbjct: 360 PCSEVTWPRLDLCKLGSLTFKKPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFI 419
Query: 416 DEKIGYLDIFKVVELTCDKHKADLVTSPSLEDIIHYDAWAREYAAGLQFSSGRSPVPA 473
DEKI YLDIFKVVELTCDKH+ +LVTSPSLE+I+HYD WAREYAA +Q SSG PV A
Sbjct: 420 DEKISYLDIFKVVELTCDKHRNELVTSPSLEEIVHYDLWAREYAANVQLSSGARPVHA 477
|
Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that catalyzes the NADP-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4-phosphate (MEP). Required for chloroplast development. Arabidopsis thaliana (taxid: 3702) EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 6EC: 7 |
| >sp|Q8W250|DXR_ORYSJ 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic OS=Oryza sativa subsp. japonica GN=DXR PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9XES0|DXR_MENPI 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic OS=Mentha piperita GN=DXR PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|B0CD21|DXR_ACAM1 1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Acaryochloris marina (strain MBIC 11017) GN=dxr PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8YP49|DXR_NOSS1 1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dxr PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q3MDL2|DXR_ANAVT 1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dxr PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|B2ITX3|DXR_NOSP7 1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=dxr PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|B8HVK1|DXR_CYAP4 1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=dxr PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|B7K5G6|DXR_CYAP8 1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Cyanothece sp. (strain PCC 8801) GN=dxr PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|B1WNP5|DXR_CYAA5 1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Cyanothece sp. (strain ATCC 51142) GN=dxr PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 473 | ||||||
| 91241600 | 471 | 1-deoxy-D-xylulose 5-phosphate reductois | 0.995 | 1.0 | 0.849 | 0.0 | |
| 255540669 | 467 | 1-deoxy-D-xylulose 5-phosphate reductois | 0.987 | 1.0 | 0.843 | 0.0 | |
| 225457034 | 471 | PREDICTED: 1-deoxy-D-xylulose 5-phosphat | 0.995 | 1.0 | 0.849 | 0.0 | |
| 224119346 | 471 | predicted protein [Populus trichocarpa] | 0.985 | 0.989 | 0.843 | 0.0 | |
| 164604988 | 471 | 1-deoxy-D-xylulose-5-phosphate reductois | 0.995 | 1.0 | 0.843 | 0.0 | |
| 46410854 | 471 | putative 1-deoxy-D-xylulose 5-phosphate | 0.991 | 0.995 | 0.847 | 0.0 | |
| 224133538 | 471 | predicted protein [Populus trichocarpa] | 0.989 | 0.993 | 0.838 | 0.0 | |
| 133753347 | 467 | 1-deoxy-D-xylulose 5-phosphate reductois | 0.985 | 0.997 | 0.827 | 0.0 | |
| 149944267 | 474 | 1-deoxy-D-xylulose 5-phosphate reductois | 0.991 | 0.989 | 0.822 | 0.0 | |
| 399514684 | 473 | 1-deoxy-D-xylulose-5-phosphate reductois | 0.997 | 0.997 | 0.827 | 0.0 |
| >gi|91241600|gb|ABD92702.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hevea brasiliensis] gi|94421688|gb|ABF18928.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hevea brasiliensis] | Back alignment and taxonomy information |
|---|
Score = 828 bits (2138), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 402/473 (84%), Positives = 440/473 (93%), Gaps = 2/473 (0%)
Query: 1 MALNLQIPAEIKALSFLETTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGPPPAW 60
MALNL PAEIKA+SFL++T+S+H L KL GGF LKRKD A FG+ VQCSAQ PPPAW
Sbjct: 1 MALNLLSPAEIKAISFLDSTKSSH-LTKLPGGFSLKRKDFGAA-FGKKVQCSAQPPPPAW 58
Query: 61 PGRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQ 120
PGRA + RKTWDGPKPISV+GSTGSIGTQTLDIVAE+ DKFRVVALAAGSN+TLLADQ
Sbjct: 59 PGRAFPDLGRKTWDGPKPISVVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQ 118
Query: 121 VKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCA 180
VK FKPQ+VAVRNESL+ E++EALA+VEEKPEI+ GEQGV+E ARHPDAV+VVTGIVGCA
Sbjct: 119 VKTFKPQLVAVRNESLVHELREALADVEEKPEIIPGEQGVVEVARHPDAVSVVTGIVGCA 178
Query: 181 GLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPE 240
GLKPTVAAIEAGKDI LANKETLIAGGPFVLPLAHK+N+KILPADSEHSAIFQCIQGLP+
Sbjct: 179 GLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAIFQCIQGLPD 238
Query: 241 GALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEA 300
GALRRIILTASGGAFRDWPV+KLKEVKVADALKHPNW+MGKKITVDSATLFNKGLEVIEA
Sbjct: 239 GALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEA 298
Query: 301 HYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSEL 360
HYLFGAEYDNIEI+IHPQSIIHSMVETQDSSV+ QLGWPDMRLPI+YTMSWP+RIYCSE+
Sbjct: 299 HYLFGAEYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPDRIYCSEI 358
Query: 361 TWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIG 420
TWPRLDL KLGSLTF APD KYPS++LAYAAGRAGGTMTGVLSAANEKAVEMFI+EKIG
Sbjct: 359 TWPRLDLCKLGSLTFKAPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFINEKIG 418
Query: 421 YLDIFKVVELTCDKHKADLVTSPSLEDIIHYDAWAREYAAGLQFSSGRSPVPA 473
YLDIFK+VELTCDKH+++LV SPSLE+IIHYD WAR+YAA LQ +SG SPV A
Sbjct: 419 YLDIFKIVELTCDKHRSELVASPSLEEIIHYDLWARDYAASLQPTSGLSPVLA 471
|
Source: Hevea brasiliensis Species: Hevea brasiliensis Genus: Hevea Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255540669|ref|XP_002511399.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplast precursor, putative [Ricinus communis] gi|223550514|gb|EEF52001.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplast precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225457034|ref|XP_002282761.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic [Vitis vinifera] gi|297733784|emb|CBI15031.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224119346|ref|XP_002318048.1| predicted protein [Populus trichocarpa] gi|222858721|gb|EEE96268.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|164604988|dbj|BAF98290.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Hevea brasiliensis] | Back alignment and taxonomy information |
|---|
| >gi|46410854|gb|AAS94121.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hevea brasiliensis] | Back alignment and taxonomy information |
|---|
| >gi|224133538|ref|XP_002321599.1| predicted protein [Populus trichocarpa] gi|222868595|gb|EEF05726.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|133753347|gb|ABO38177.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Croton stellatopilosus] | Back alignment and taxonomy information |
|---|
| >gi|149944267|gb|AAY87151.2| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rauvolfia verticillata] | Back alignment and taxonomy information |
|---|
| >gi|399514684|gb|AFP43697.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Eriobotrya japonica] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 473 | ||||||
| TIGR_CMR|BA_3959 | 380 | BA_3959 "1-deoxy-D-xylulose 5- | 0.790 | 0.984 | 0.471 | 1.1e-89 | |
| TIGR_CMR|GSU_1915 | 386 | GSU_1915 "1-deoxy-D-xylulose 5 | 0.801 | 0.981 | 0.481 | 4.1e-88 | |
| TIGR_CMR|BA_3409 | 385 | BA_3409 "1-deoxy-D-xylulose 5- | 0.792 | 0.974 | 0.451 | 8e-85 | |
| TIGR_CMR|SPO_1667 | 395 | SPO_1667 "1-deoxy-D-xylulose 5 | 0.792 | 0.949 | 0.421 | 3.5e-75 | |
| TIGR_CMR|CHY_1778 | 384 | CHY_1778 "1-deoxy-D-xylulose 5 | 0.778 | 0.958 | 0.449 | 2.5e-72 | |
| TIGR_CMR|DET_0371 | 377 | DET_0371 "1-deoxy-D-xylulose 5 | 0.765 | 0.960 | 0.436 | 1.1e-71 | |
| UNIPROTKB|P45568 | 398 | dxr "Dxr" [Escherichia coli K- | 0.799 | 0.949 | 0.422 | 9.9e-71 | |
| TIGR_CMR|CPS_1559 | 411 | CPS_1559 "1-deoxy-D-xylulose 5 | 0.801 | 0.922 | 0.406 | 1.9e-67 | |
| UNIPROTKB|Q9KPV8 | 402 | dxr "1-deoxy-D-xylulose 5-phos | 0.803 | 0.945 | 0.392 | 9.4e-66 | |
| TIGR_CMR|VC_2254 | 402 | VC_2254 "1-deoxy-D-xylulose 5- | 0.803 | 0.945 | 0.392 | 9.4e-66 |
| TIGR_CMR|BA_3959 BA_3959 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
Score = 895 (320.1 bits), Expect = 1.1e-89, P = 1.1e-89
Identities = 180/382 (47%), Positives = 254/382 (66%)
Query: 77 KPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESL 136
K IS+LG++GSIGTQTLD++ H D+FR+VA + G NI ++ F PQ+V+V+ E
Sbjct: 2 KNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREE- 60
Query: 137 LDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIA 196
D +K L V +I+ G +G++E A HPDA VV +VG GL PT+ AIEA K I
Sbjct: 61 -DVLK--LQAVSGNTKIVYGSEGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEAKKTIG 117
Query: 197 LANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR 256
+ANKETL+ G V+ A KHN+ +LP DSEHSAIFQC+ G E + R+I+TASGG+FR
Sbjct: 118 IANKETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFR 177
Query: 257 DWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNXXXXXX 316
D ++L V V DAL+HPNWSMG KIT+DSAT+ NKGLEVIEAH+LFG Y+
Sbjct: 178 DKTRDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLH 237
Query: 317 XXXXXXXMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFV 376
MVE +D SV+ QLG PDMR+PI Y +++P+R+ S+ +L+L ++G+L F
Sbjct: 238 KESIIHSMVEFEDRSVMAQLGSPDMRVPIQYALTYPDRLPLSDTK--QLNLWEIGTLHFE 295
Query: 377 APDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIGYLDIFKVVELTCDKHK 436
+ ++ + AY AG+AGG+M V++AANE AVE F+ ++IG+L + ++E + H
Sbjct: 296 KMNQERFRCLRFAYEAGKAGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMNHH- 354
Query: 437 ADLVTSPSLEDIIHYDAWAREY 458
+++ PSLE+I+ DA R +
Sbjct: 355 -NVIARPSLEEILEIDAATRRF 375
|
|
| TIGR_CMR|GSU_1915 GSU_1915 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_3409 BA_3409 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_1667 SPO_1667 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1778 CHY_1778 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0371 DET_0371 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P45568 dxr "Dxr" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_1559 CPS_1559 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KPV8 dxr "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_2254 VC_2254 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q8DK30 | DXR_THEEB | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6552 | 0.7970 | 0.9128 | yes | no |
| Q46JT6 | DXR_PROMT | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5939 | 0.7991 | 0.9174 | yes | no |
| A5D2U3 | DXR_PELTS | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5210 | 0.7906 | 0.9664 | yes | no |
| Q7NID1 | DXR_GLOVI | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5939 | 0.8160 | 0.9846 | yes | no |
| B3E7B0 | DXR_GEOLS | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5169 | 0.7949 | 0.9641 | yes | no |
| A8MHH5 | DXR_ALKOO | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5065 | 0.7885 | 0.9790 | yes | no |
| Q319Z8 | DXR_PROM9 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6035 | 0.8012 | 0.9289 | yes | no |
| Q7V6J8 | DXR_PROMM | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5859 | 0.8224 | 0.9441 | yes | no |
| A4SCF3 | DXR_PROVI | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5026 | 0.7991 | 0.9843 | yes | no |
| Q3MDL2 | DXR_ANAVT | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6587 | 0.7991 | 0.9497 | yes | no |
| Q3AZ20 | DXR_SYNS9 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5869 | 0.8287 | 0.9400 | yes | no |
| B7KAT5 | DXR_CYAP7 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6657 | 0.7970 | 0.9472 | yes | no |
| Q31N26 | DXR_SYNE7 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6301 | 0.8012 | 0.9427 | yes | no |
| B7K5G6 | DXR_CYAP8 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6614 | 0.7991 | 0.9497 | yes | no |
| B0CD21 | DXR_ACAM1 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6531 | 0.8245 | 0.9725 | yes | no |
| B3QXY0 | DXR_CHLT3 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5052 | 0.7928 | 0.9689 | yes | no |
| Q0IBN9 | DXR_SYNS3 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6065 | 0.7991 | 0.9086 | yes | no |
| A2C3T8 | DXR_PROM1 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5964 | 0.7991 | 0.9174 | yes | no |
| A2BXK2 | DXR_PROM5 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5782 | 0.8012 | 0.9266 | yes | no |
| Q8YP49 | DXR_NOSS1 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6561 | 0.7991 | 0.9473 | yes | no |
| Q2JM39 | DXR_SYNJB | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6246 | 0.7949 | 0.9591 | yes | no |
| C0ZF60 | DXR_BREBN | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5326 | 0.7970 | 0.9869 | yes | no |
| Q7V0W0 | DXR_PROMP | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5790 | 0.7928 | 0.9282 | yes | no |
| Q9XFS9 | DXR_ARATH | 1, ., 1, ., 1, ., 2, 6, 7 | 0.8096 | 0.9957 | 0.9874 | yes | no |
| Q9XES0 | DXR_MENPI | 1, ., 1, ., 1, ., 2, 6, 7 | 0.8029 | 0.9746 | 0.9808 | N/A | no |
| Q7U8C3 | DXR_SYNPX | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5921 | 0.8202 | 0.9486 | yes | no |
| B2ITX3 | DXR_NOSP7 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6587 | 0.7991 | 0.9497 | yes | no |
| Q7VB62 | DXR_PROMA | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5939 | 0.7885 | 0.9053 | yes | no |
| Q185R8 | DXR_CLOD6 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.4987 | 0.8012 | 0.9869 | yes | no |
| Q3AI71 | DXR_SYNSC | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5873 | 0.8287 | 0.9445 | yes | no |
| Q9RCT1 | DXR_SYNP6 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6301 | 0.8012 | 0.9427 | yes | no |
| B4S387 | DXR_PROA2 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5180 | 0.8054 | 0.9973 | yes | no |
| B8HVK1 | DXR_CYAP4 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6640 | 0.7991 | 0.9767 | yes | no |
| Q9KA69 | DXR_BACHD | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5116 | 0.7991 | 0.9895 | yes | no |
| A4J5Y5 | DXR_DESRM | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5143 | 0.7991 | 0.9767 | yes | no |
| B0THN7 | DXR_HELMI | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5143 | 0.7970 | 0.9641 | yes | no |
| Q8KG43 | DXR_CHLTE | 1, ., 1, ., 1, ., 2, 6, 7 | 0.5336 | 0.8012 | 0.9921 | yes | no |
| Q2JXQ9 | DXR_SYNJA | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6325 | 0.7949 | 0.9591 | yes | no |
| Q8W250 | DXR_ORYSJ | 1, ., 1, ., 1, ., 2, 6, 7 | 0.7970 | 0.9957 | 0.9957 | yes | no |
| B1WNP5 | DXR_CYAA5 | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6929 | 0.7991 | 0.9497 | yes | no |
| B0JWW6 | DXR_MICAN | 1, ., 1, ., 1, ., 2, 6, 7 | 0.6666 | 0.7991 | 0.9692 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 1.1.1 | 0.998 |
| 4th Layer | 1.1.1.267 | 0.994 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 473 | |||
| PLN02696 | 454 | PLN02696, PLN02696, 1-deoxy-D-xylulose-5-phosphate | 0.0 | |
| PRK05447 | 385 | PRK05447, PRK05447, 1-deoxy-D-xylulose 5-phosphate | 0.0 | |
| COG0743 | 385 | COG0743, Dxr, 1-deoxy-D-xylulose 5-phosphate reduc | 0.0 | |
| TIGR00243 | 389 | TIGR00243, Dxr, 1-deoxy-D-xylulose 5-phosphate red | 0.0 | |
| PRK12464 | 383 | PRK12464, PRK12464, 1-deoxy-D-xylulose 5-phosphate | 0.0 | |
| pfam02670 | 129 | pfam02670, DXP_reductoisom, 1-deoxy-D-xylulose 5-p | 3e-66 | |
| pfam13288 | 118 | pfam13288, DXPR_C, DXP reductoisomerase C-terminal | 3e-56 | |
| pfam08436 | 84 | pfam08436, DXP_redisom_C, 1-deoxy-D-xylulose 5-pho | 2e-54 | |
| COG0460 | 333 | COG0460, ThrA, Homoserine dehydrogenase [Amino aci | 0.002 |
| >gnl|CDD|215374 PLN02696, PLN02696, 1-deoxy-D-xylulose-5-phosphate reductoisomerase | Back alignment and domain information |
|---|
Score = 877 bits (2269), Expect = 0.0
Identities = 370/454 (81%), Positives = 408/454 (89%), Gaps = 6/454 (1%)
Query: 25 RLPKLSGGFPLKRKDNATATFGRIVQCS-----AQGPPPAWPGRAVTETFRKTWDGPKPI 79
LPKL GGF KR + + GR +CS PPPAWPGRAV E RK WDGPKPI
Sbjct: 2 PLPKLPGGFTTKRSS-SRQSRGRRAKCSVAGWSQNSPPPAWPGRAVVEPGRKGWDGPKPI 60
Query: 80 SVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESLLDE 139
S+LGSTGSIGTQTLDIVAE+ DKF+VVALAAGSN+TLLADQV++FKP++VAVRNESL+DE
Sbjct: 61 SLLGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVTLLADQVRKFKPKLVAVRNESLVDE 120
Query: 140 IKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALAN 199
+KEALA++++KPEI+ GE+G++E ARHP+AVTVVTGIVGCAGLKPTVAAIEAGKDIALAN
Sbjct: 121 LKEALADLDDKPEIIPGEEGIVEVARHPEAVTVVTGIVGCAGLKPTVAAIEAGKDIALAN 180
Query: 200 KETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWP 259
KETLIAGGPFVLPLA KH +KILPADSEHSAIFQCIQGLPEG LRRIILTASGGAFRDWP
Sbjct: 181 KETLIAGGPFVLPLAKKHGVKILPADSEHSAIFQCIQGLPEGGLRRIILTASGGAFRDWP 240
Query: 260 VEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQS 319
VEKLKEVKVADALKHPNWSMGKKITVDSATL NKGLEVIEAHYLFGA+YD+I+I+IHPQS
Sbjct: 241 VEKLKEVKVADALKHPNWSMGKKITVDSATLMNKGLEVIEAHYLFGADYDDIDIVIHPQS 300
Query: 320 IIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPD 379
IIHSMVETQDSSV+ QLGWPDMRLPI+YTMSWP+R+ CSE+TWPRLDL KLGSLTF APD
Sbjct: 301 IIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPDRVPCSEITWPRLDLCKLGSLTFKAPD 360
Query: 380 TAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIGYLDIFKVVELTCDKHKADL 439
KYPS++LAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIGYLDIFKV+ELTC+ HK +L
Sbjct: 361 NVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIGYLDIFKVIELTCEAHKEEL 420
Query: 440 VTSPSLEDIIHYDAWAREYAAGLQFSSGRSPVPA 473
VTSPSLEDI+HYD WAREYAA L S G SPV A
Sbjct: 421 VTSPSLEDILHYDLWAREYAAELVESGGLSPVVA 454
|
Length = 454 |
| >gnl|CDD|235472 PRK05447, PRK05447, 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223814 COG0743, Dxr, 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|161787 TIGR00243, Dxr, 1-deoxy-D-xylulose 5-phosphate reductoisomerase | Back alignment and domain information |
|---|
| >gnl|CDD|237107 PRK12464, PRK12464, 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217176 pfam02670, DXP_reductoisom, 1-deoxy-D-xylulose 5-phosphate reductoisomerase | Back alignment and domain information |
|---|
| >gnl|CDD|222027 pfam13288, DXPR_C, DXP reductoisomerase C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|203943 pfam08436, DXP_redisom_C, 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|223536 COG0460, ThrA, Homoserine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 473 | |||
| PLN02696 | 454 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | 100.0 | |
| COG0743 | 385 | Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras | 100.0 | |
| TIGR00243 | 389 | Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras | 100.0 | |
| PRK12464 | 383 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P | 100.0 | |
| PRK05447 | 385 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P | 100.0 | |
| PF08436 | 84 | DXP_redisom_C: 1-deoxy-D-xylulose 5-phosphate redu | 100.0 | |
| PF02670 | 129 | DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re | 100.0 | |
| PF13288 | 121 | DXPR_C: DXP reductoisomerase C-terminal domain; PD | 100.0 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 98.17 | |
| PF03447 | 117 | NAD_binding_3: Homoserine dehydrogenase, NAD bindi | 97.9 | |
| PRK06270 | 341 | homoserine dehydrogenase; Provisional | 97.87 | |
| PRK11579 | 346 | putative oxidoreductase; Provisional | 97.81 | |
| PRK13303 | 265 | L-aspartate dehydrogenase; Provisional | 97.74 | |
| PRK13302 | 271 | putative L-aspartate dehydrogenase; Provisional | 97.67 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 97.48 | |
| PRK08374 | 336 | homoserine dehydrogenase; Provisional | 97.48 | |
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 97.44 | |
| PRK06392 | 326 | homoserine dehydrogenase; Provisional | 97.4 | |
| PRK13304 | 265 | L-aspartate dehydrogenase; Reviewed | 97.37 | |
| PRK06813 | 346 | homoserine dehydrogenase; Validated | 97.3 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 97.2 | |
| TIGR03215 | 285 | ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati | 97.06 | |
| COG0673 | 342 | MviM Predicted dehydrogenases and related proteins | 96.98 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 96.96 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 96.78 | |
| PRK08300 | 302 | acetaldehyde dehydrogenase; Validated | 96.76 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 96.73 | |
| TIGR01761 | 343 | thiaz-red thiazolinyl imide reductase. This reduct | 96.68 | |
| PRK00436 | 343 | argC N-acetyl-gamma-glutamyl-phosphate reductase; | 96.67 | |
| PRK10206 | 344 | putative oxidoreductase; Provisional | 96.57 | |
| PRK09466 | 810 | metL bifunctional aspartate kinase II/homoserine d | 96.55 | |
| COG0460 | 333 | ThrA Homoserine dehydrogenase [Amino acid transpor | 96.52 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 96.5 | |
| PRK04207 | 341 | glyceraldehyde-3-phosphate dehydrogenase; Provisio | 96.4 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 96.02 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 95.86 | |
| TIGR01850 | 346 | argC N-acetyl-gamma-glutamyl-phosphate reductase, | 95.74 | |
| COG4091 | 438 | Predicted homoserine dehydrogenase [Amino acid tra | 95.66 | |
| TIGR00036 | 266 | dapB dihydrodipicolinate reductase. | 95.61 | |
| PLN02700 | 377 | homoserine dehydrogenase family protein | 95.34 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 95.21 | |
| PF01370 | 236 | Epimerase: NAD dependent epimerase/dehydratase fam | 95.21 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 95.13 | |
| PRK08219 | 227 | short chain dehydrogenase; Provisional | 95.04 | |
| PLN02778 | 298 | 3,5-epimerase/4-reductase | 94.81 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 94.77 | |
| PRK11863 | 313 | N-acetyl-gamma-glutamyl-phosphate reductase; Provi | 94.77 | |
| PRK08040 | 336 | putative semialdehyde dehydrogenase; Provisional | 94.72 | |
| PLN02968 | 381 | Probable N-acetyl-gamma-glutamyl-phosphate reducta | 94.66 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 94.59 | |
| PRK10538 | 248 | malonic semialdehyde reductase; Provisional | 94.59 | |
| PF04321 | 286 | RmlD_sub_bind: RmlD substrate binding domain; Inte | 94.47 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 94.42 | |
| PRK06947 | 248 | glucose-1-dehydrogenase; Provisional | 94.4 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 94.25 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 94.25 | |
| PRK12825 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.22 | |
| PRK06728 | 347 | aspartate-semialdehyde dehydrogenase; Provisional | 94.14 | |
| TIGR01214 | 287 | rmlD dTDP-4-dehydrorhamnose reductase. This enzyme | 94.04 | |
| PRK06101 | 240 | short chain dehydrogenase; Provisional | 93.97 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 93.92 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 93.92 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 93.91 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 93.85 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 93.84 | |
| PRK08063 | 250 | enoyl-(acyl carrier protein) reductase; Provisiona | 93.81 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.78 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 93.76 | |
| PRK12743 | 256 | oxidoreductase; Provisional | 93.76 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 93.75 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 93.72 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.64 | |
| PRK08664 | 349 | aspartate-semialdehyde dehydrogenase; Reviewed | 93.62 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 93.6 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 93.56 | |
| TIGR03855 | 229 | NAD_NadX aspartate dehydrogenase. Members of this | 93.51 | |
| PLN02583 | 297 | cinnamoyl-CoA reductase | 93.47 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 93.46 | |
| TIGR01851 | 310 | argC_other N-acetyl-gamma-glutamyl-phosphate reduc | 93.45 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 93.39 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 93.39 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.38 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 93.35 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 93.32 | |
| PRK05717 | 255 | oxidoreductase; Validated | 93.21 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 93.19 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 93.16 | |
| PRK08643 | 256 | acetoin reductase; Validated | 93.16 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 93.14 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 93.14 | |
| PRK09987 | 299 | dTDP-4-dehydrorhamnose reductase; Provisional | 93.13 | |
| COG0604 | 326 | Qor NADPH:quinone reductase and related Zn-depende | 93.08 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 93.07 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 93.05 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 92.99 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 92.93 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 92.86 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 92.8 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 92.78 | |
| PRK09730 | 247 | putative NAD(P)-binding oxidoreductase; Provisiona | 92.7 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 92.69 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 92.68 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 92.63 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 92.61 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 92.61 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 92.6 | |
| PRK12745 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 92.59 | |
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 92.58 | |
| cd05294 | 309 | LDH-like_MDH_nadp A lactate dehydrogenases-like st | 92.55 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 92.55 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 92.54 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 92.54 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 92.52 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 92.5 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 92.46 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 92.46 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 92.42 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 92.4 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 92.29 | |
| PRK14874 | 334 | aspartate-semialdehyde dehydrogenase; Provisional | 92.28 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 92.27 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 92.27 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 92.24 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 92.23 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 92.22 | |
| COG1091 | 281 | RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo | 92.18 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 92.09 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 92.08 | |
| PRK06598 | 369 | aspartate-semialdehyde dehydrogenase; Reviewed | 92.07 | |
| COG1712 | 255 | Predicted dinucleotide-utilizing enzyme [General f | 92.04 | |
| PLN02383 | 344 | aspartate semialdehyde dehydrogenase | 92.01 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 92.0 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 92.0 | |
| TIGR01532 | 325 | E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas | 91.97 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 91.9 | |
| PRK12935 | 247 | acetoacetyl-CoA reductase; Provisional | 91.87 | |
| PRK13301 | 267 | putative L-aspartate dehydrogenase; Provisional | 91.84 | |
| COG2910 | 211 | Putative NADH-flavin reductase [General function p | 91.84 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 91.83 | |
| PRK09134 | 258 | short chain dehydrogenase; Provisional | 91.77 | |
| PRK07102 | 243 | short chain dehydrogenase; Provisional | 91.74 | |
| PRK06924 | 251 | short chain dehydrogenase; Provisional | 91.71 | |
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 91.7 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 91.7 | |
| PRK05671 | 336 | aspartate-semialdehyde dehydrogenase; Reviewed | 91.7 | |
| PRK12744 | 257 | short chain dehydrogenase; Provisional | 91.69 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 91.69 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 91.66 | |
| TIGR01472 | 343 | gmd GDP-mannose 4,6-dehydratase. Excluded from thi | 91.63 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 91.62 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 91.6 | |
| PRK06483 | 236 | dihydromonapterin reductase; Provisional | 91.56 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 91.46 | |
| KOG1502 | 327 | consensus Flavonol reductase/cinnamoyl-CoA reducta | 91.45 | |
| COG0702 | 275 | Predicted nucleoside-diphosphate-sugar epimerases | 91.37 | |
| PRK10217 | 355 | dTDP-glucose 4,6-dehydratase; Provisional | 91.27 | |
| PRK07453 | 322 | protochlorophyllide oxidoreductase; Validated | 91.22 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 91.21 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 91.15 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 91.12 | |
| PRK08017 | 256 | oxidoreductase; Provisional | 91.12 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 90.97 | |
| TIGR01921 | 324 | DAP-DH diaminopimelate dehydrogenase. This model r | 90.87 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 90.82 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 90.81 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 90.81 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 90.74 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 90.73 | |
| PRK07904 | 253 | short chain dehydrogenase; Provisional | 90.7 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 90.63 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 90.63 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 90.57 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 90.56 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 90.54 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 90.48 | |
| PRK12938 | 246 | acetyacetyl-CoA reductase; Provisional | 90.47 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 90.39 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 90.35 | |
| cd05286 | 320 | QOR2 Quinone oxidoreductase (QOR). Quinone oxidore | 90.26 | |
| TIGR02415 | 254 | 23BDH acetoin reductases. One member of this famil | 90.26 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 90.21 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 90.19 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 90.19 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 90.17 | |
| PRK07832 | 272 | short chain dehydrogenase; Provisional | 90.14 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 90.13 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 90.08 | |
| PRK10675 | 338 | UDP-galactose-4-epimerase; Provisional | 90.07 | |
| smart00846 | 149 | Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, | 89.91 | |
| PLN00112 | 444 | malate dehydrogenase (NADP); Provisional | 89.88 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 89.87 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 89.84 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 89.77 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 89.77 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 89.76 | |
| PLN02725 | 306 | GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas | 89.76 | |
| cd08294 | 329 | leukotriene_B4_DH_like 13-PGR is a bifunctional en | 89.7 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 89.62 | |
| PRK05650 | 270 | short chain dehydrogenase; Provisional | 89.58 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 89.54 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 89.51 | |
| PRK12824 | 245 | acetoacetyl-CoA reductase; Provisional | 89.49 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 89.48 | |
| PRK06077 | 252 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 89.48 | |
| cd08250 | 329 | Mgc45594_like Mgc45594 gene product and other MDR | 89.46 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 89.41 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 89.31 | |
| PF02719 | 293 | Polysacc_synt_2: Polysaccharide biosynthesis prote | 89.3 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 89.28 | |
| cd08293 | 345 | PTGR2 Prostaglandin reductase. Prostaglandins and | 89.24 | |
| TIGR01829 | 242 | AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy | 89.22 | |
| cd08239 | 339 | THR_DH_like L-threonine dehydrogenase (TDH)-like. | 89.19 | |
| PF00551 | 181 | Formyl_trans_N: Formyl transferase; InterPro: IPR0 | 89.08 | |
| TIGR00978 | 341 | asd_EA aspartate-semialdehyde dehydrogenase (non-p | 89.06 | |
| COG0136 | 334 | Asd Aspartate-semialdehyde dehydrogenase [Amino ac | 89.01 | |
| COG4221 | 246 | Short-chain alcohol dehydrogenase of unknown speci | 88.93 | |
| TIGR01746 | 367 | Thioester-redct thioester reductase domain. It has | 88.91 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 88.84 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 88.82 | |
| PRK06463 | 255 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 88.73 | |
| KOG1198 | 347 | consensus Zinc-binding oxidoreductase [Energy prod | 88.63 | |
| TIGR03201 | 349 | dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co | 88.59 | |
| PRK08340 | 259 | glucose-1-dehydrogenase; Provisional | 88.58 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 88.57 | |
| TIGR03649 | 285 | ergot_EASG ergot alkaloid biosynthesis protein, AF | 88.56 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 88.49 | |
| PRK07023 | 243 | short chain dehydrogenase; Provisional | 88.47 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 88.44 | |
| TIGR01777 | 292 | yfcH conserved hypothetical protein TIGR01777. Thi | 88.43 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 88.42 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 88.41 | |
| cd08274 | 350 | MDR9 Medium chain dehydrogenases/reductase (MDR)/z | 88.37 | |
| TIGR01546 | 333 | GAPDH-II_archae glyceraldehyde-3-phosphate dehydro | 88.18 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 88.14 | |
| smart00859 | 122 | Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin | 88.12 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 88.1 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 88.09 | |
| PLN03154 | 348 | putative allyl alcohol dehydrogenase; Provisional | 88.09 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 88.06 | |
| TIGR01179 | 328 | galE UDP-glucose-4-epimerase. This enzyme intercon | 88.02 | |
| cd08289 | 326 | MDR_yhfp_like Yhfp putative quinone oxidoreductase | 87.89 | |
| COG1088 | 340 | RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope | 87.89 | |
| PRK08177 | 225 | short chain dehydrogenase; Provisional | 87.86 | |
| PLN02503 | 605 | fatty acyl-CoA reductase 2 | 87.81 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 87.78 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 87.73 | |
| PRK13535 | 336 | erythrose 4-phosphate dehydrogenase; Provisional | 87.63 | |
| PRK06123 | 248 | short chain dehydrogenase; Provisional | 87.61 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 87.6 | |
| cd08243 | 320 | quinone_oxidoreductase_like_1 Quinone oxidoreducta | 87.59 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 87.54 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 87.33 | |
| PLN00016 | 378 | RNA-binding protein; Provisional | 87.31 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 87.18 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 87.11 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 87.08 | |
| cd08295 | 338 | double_bond_reductase_like Arabidopsis alkenal dou | 87.07 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 87.05 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 87.02 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 86.91 | |
| TIGR01289 | 314 | LPOR light-dependent protochlorophyllide reductase | 86.91 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 86.85 | |
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism asso | 86.69 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 86.62 | |
| cd08238 | 410 | sorbose_phosphate_red L-sorbose-1-phosphate reduct | 86.59 | |
| PRK07677 | 252 | short chain dehydrogenase; Provisional | 86.53 | |
| PRK08125 | 660 | bifunctional UDP-glucuronic acid decarboxylase/UDP | 86.53 | |
| COG3320 | 382 | Putative dehydrogenase domain of multifunctional n | 86.5 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 86.47 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 86.44 | |
| TIGR02825 | 325 | B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 | 86.42 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 86.41 | |
| COG2201 | 350 | CheB Chemotaxis response regulator containing a Ch | 86.3 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 86.27 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 86.18 | |
| KOG4777 | 361 | consensus Aspartate-semialdehyde dehydrogenase [Am | 86.12 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 85.98 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 85.9 | |
| PRK05884 | 223 | short chain dehydrogenase; Provisional | 85.66 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 85.58 | |
| PRK07889 | 256 | enoyl-(acyl carrier protein) reductase; Provisiona | 85.53 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 85.51 | |
| cd08259 | 332 | Zn_ADH5 Alcohol dehydrogenases of the MDR family. | 85.44 | |
| PRK07775 | 274 | short chain dehydrogenase; Provisional | 85.26 | |
| PRK10309 | 347 | galactitol-1-phosphate dehydrogenase; Provisional | 85.23 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 85.19 | |
| cd08231 | 361 | MDR_TM0436_like Hypothetical enzyme TM0436 resembl | 85.19 | |
| TIGR02685 | 267 | pter_reduc_Leis pteridine reductase. Pteridine red | 85.14 | |
| PLN00198 | 338 | anthocyanidin reductase; Provisional | 85.07 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 85.05 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 84.99 | |
| PRK12747 | 252 | short chain dehydrogenase; Provisional | 84.89 | |
| TIGR03451 | 358 | mycoS_dep_FDH mycothiol-dependent formaldehyde deh | 84.8 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 84.69 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 84.66 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 84.54 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 84.53 | |
| cd05284 | 340 | arabinose_DH_like D-arabinose dehydrogenase. This | 84.51 | |
| cd08292 | 324 | ETR_like_2 2-enoyl thioester reductase (ETR) like | 84.27 | |
| TIGR01296 | 339 | asd_B aspartate-semialdehyde dehydrogenase (peptid | 84.24 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 84.17 | |
| PF07993 | 249 | NAD_binding_4: Male sterility protein; InterPro: I | 84.09 | |
| PRK07069 | 251 | short chain dehydrogenase; Validated | 83.97 | |
| TIGR00639 | 190 | PurN phosphoribosylglycinamide formyltransferase, | 83.91 | |
| TIGR01745 | 366 | asd_gamma aspartate-semialdehyde dehydrogenase, ga | 83.84 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 83.83 | |
| cd08290 | 341 | ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi | 83.8 | |
| PRK07791 | 286 | short chain dehydrogenase; Provisional | 83.79 | |
| COG0451 | 314 | WcaG Nucleoside-diphosphate-sugar epimerases [Cell | 83.74 | |
| cd08244 | 324 | MDR_enoyl_red Possible enoyl reductase. Member ide | 83.73 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 83.51 | |
| smart00822 | 180 | PKS_KR This enzymatic domain is part of bacterial | 83.38 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 83.27 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 83.23 | |
| cd08268 | 328 | MDR2 Medium chain dehydrogenases/reductase (MDR)/z | 83.21 | |
| cd05282 | 323 | ETR_like 2-enoyl thioester reductase-like. 2-enoyl | 83.11 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 82.67 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 82.63 | |
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisiona | 82.5 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 82.49 | |
| PRK12859 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 82.23 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 82.11 | |
| PLN03096 | 395 | glyceraldehyde-3-phosphate dehydrogenase A; Provis | 82.05 | |
| cd08264 | 325 | Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam | 82.04 | |
| PRK11150 | 308 | rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro | 81.81 | |
| cd08249 | 339 | enoyl_reductase_like enoyl_reductase_like. Member | 81.66 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 81.26 | |
| cd08301 | 369 | alcohol_DH_plants Plant alcohol dehydrogenase. NAD | 81.26 | |
| PRK06953 | 222 | short chain dehydrogenase; Provisional | 81.14 | |
| cd08233 | 351 | butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog | 81.05 | |
| TIGR01830 | 239 | 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re | 80.99 | |
| TIGR03025 | 445 | EPS_sugtrans exopolysaccharide biosynthesis polypr | 80.85 | |
| KOG2741 | 351 | consensus Dimeric dihydrodiol dehydrogenase [Carbo | 80.83 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 80.66 | |
| PRK12748 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 80.6 | |
| PF01073 | 280 | 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso | 80.54 | |
| cd08261 | 337 | Zn_ADH7 Alcohol dehydrogenases of the MDR family. | 80.46 | |
| PLN02514 | 357 | cinnamyl-alcohol dehydrogenase | 80.19 | |
| cd05276 | 323 | p53_inducible_oxidoreductase PIG3 p53-inducible qu | 80.09 | |
| PRK05396 | 341 | tdh L-threonine 3-dehydrogenase; Validated | 80.02 |
| >PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.1e-169 Score=1308.69 Aligned_cols=446 Identities=83% Similarity=1.307 Sum_probs=422.2
Q ss_pred CCCCCCccccccccccccccceeeeec-----CCCCCCCCCccccccccCCCCCCeeEEEEccCChHhHHHHHHHHhCCC
Q 012004 27 PKLSGGFPLKRKDNATATFGRIVQCSA-----QGPPPAWPGRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHED 101 (473)
Q Consensus 27 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~k~I~ILGSTGSIG~qtLdVi~~~pd 101 (473)
++++++...++++. ....++|.+|+. +.||++|||++..++..+.|+++|||+|||||||||+||||||++|||
T Consensus 4 ~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KkI~ILGSTGSIGtqtLdVI~~~pd 82 (454)
T PLN02696 4 PKLPGGFTTKRSSS-RQSRGRRAKCSVAGWSQNSPPPAWPGRAVVEPGRKGWDGPKPISLLGSTGSIGTQTLDIVAENPD 82 (454)
T ss_pred ccCCCcceeccccc-cccccccccccccccccCCCCccCccccccCCcccccCCccEEEEecCCcHhhHHHHHHHHhCcc
Confidence 47899999999988 677789999994 458999999998778889999999999999999999999999999999
Q ss_pred ceEEEEEeccCCHHHHHHHHHhhCCCEEEEeCcccHHHHHHHHhcCCCCcEEEechhhHHHhhcCCCCCEEEEecccccC
Q 012004 102 KFRVVALAAGSNITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAG 181 (473)
Q Consensus 102 ~f~VvaLaa~~Nv~~L~~q~~~f~P~~v~v~de~~~~~l~~~l~~~~~~~~v~~G~egl~~la~~~~~D~Vv~AIvG~aG 181 (473)
+|+|+||++|+|+++|++|+++|+|++|++.|++.+.+|++.|.+.+.+++++.|++|++++++.+++|+||+||||++|
T Consensus 83 ~f~vvaLaag~Ni~lL~~q~~~f~p~~v~v~d~~~~~~l~~~l~~~~~~~~vl~G~egl~~la~~~evDiVV~AIvG~aG 162 (454)
T PLN02696 83 KFKVVALAAGSNVTLLADQVRKFKPKLVAVRNESLVDELKEALADLDDKPEIIPGEEGIVEVARHPEAVTVVTGIVGCAG 162 (454)
T ss_pred ccEEEEEECCCCHHHHHHHHHHhCCCEEEEcCHHHHHHHHHhhcCCCCCcEEEECHHHHHHHHcCCCCCEEEEeCccccc
Confidence 99999999999999999999999999999999999999999885422357899999999999999999999999999999
Q ss_pred cHHHHHHHHcCCcccccccceeeeccccchHHHhhcCCeEeecccchhhHHHhhcCCCCCccceEEEEecCCCCCCCChh
Q 012004 182 LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVE 261 (473)
Q Consensus 182 L~ptl~Ai~~GK~IaLANKESLV~aG~li~~~a~~~~~~IlPVDSEHsAIfQcL~g~~~~~v~kiiLTASGGPFr~~~~e 261 (473)
|.||++||++||+|||||||||||||++|+++++++|++|+|||||||||||||+|+++++|+||||||||||||+||+|
T Consensus 163 L~pTl~AIkaGK~VALANKESLV~aG~lI~~~ak~~~~~IlPVDSEHsAIfQ~L~g~~~~~v~kiiLTASGGpFr~~~~e 242 (454)
T PLN02696 163 LKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHGVKILPADSEHSAIFQCIQGLPEGGLRRIILTASGGAFRDWPVE 242 (454)
T ss_pred hHHHHHHHHCCCcEEEecHHHHHhhHHHHHHHHHHcCCeEeecchhhHHHHHHccCCCccCccEEEEECCchhccCCCHH
Confidence 99999999999999999999999999999999999999999999999999999999877789999999999999999999
Q ss_pred hhhcCCHHHHhcCCCCCCCcccccchhhhhhhhHHHHHHhhhcCCCCCceeEEEcCCcceeEEEEecCCcEEEecCCCCc
Q 012004 262 KLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDM 341 (473)
Q Consensus 262 ~L~~vT~~~ALkHPnW~MG~KITIDSATmmNKgLEvIEA~~LF~i~~d~I~VvIHPQSiIHsmVef~DGSv~Aqlg~PDM 341 (473)
+|++||++|||+||||+||+||||||||||||||||||||||||+|||+|||||||||||||||||+|||++||||+|||
T Consensus 243 ~l~~vT~~~ALkHP~W~MG~KITIDSATmmNKglEvIEA~~LF~~~~d~I~vvIHPqSiIHsmVef~DGS~~Aql~~pDM 322 (454)
T PLN02696 243 KLKEVKVADALKHPNWSMGKKITVDSATLMNKGLEVIEAHYLFGADYDDIDIVIHPQSIIHSMVETQDSSVLAQLGWPDM 322 (454)
T ss_pred HHhCCCHHHHhhCCCCcCCCeeeeehHhhhhhhHHHHHHHHHcCCCHHHeEEEECcCCeeeEEEEEcCCcEEEEecCCCc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hHHHHhcCCCCCccccCCCCCCCCCcCCCCCceecCCCCCCCchHHHHHHHHHcCCCceeeeehhhHHHHHHHHhCCCCC
Q 012004 342 RLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIGY 421 (473)
Q Consensus 342 rlPI~yAL~yP~R~~~~~~~~~~ldl~~~~~LtF~~pD~~rFP~l~LA~~a~~~Gg~~~~vlNAANEvAV~aFL~~kI~F 421 (473)
|+||+|||+||+|.++++..+++|||.++++|||++||++|||||+|||+|+++||++|+|||||||+||++||+|||+|
T Consensus 323 rlPI~yAL~yP~R~~~~~~~~~~ldl~~~~~LtF~~pD~~rfP~l~La~~a~~~gg~~~~vlNAANEvAV~~FL~~kI~F 402 (454)
T PLN02696 323 RLPILYTMSWPDRVPCSEITWPRLDLCKLGSLTFKAPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIGY 402 (454)
T ss_pred HHHHHHHcCCccccccccCCCCCcCccccCCCeeeCCChhhCcHHHHHHHHHHhCCCceEEEEhhhHHHHHHHHcCCCCc
Confidence 99999999999999643367899999999999999999999999999999999999999999999999999999999999
Q ss_pred ccHHHHHHHHHHccccCCCCCCCHHHHHHHHHHHHHHHHHHHHhcCCCCCCC
Q 012004 422 LDIFKVVELTCDKHKADLVTSPSLEDIIHYDAWAREYAAGLQFSSGRSPVPA 473 (473)
Q Consensus 422 ~dI~~ii~~~l~~~~~~~~~~~sledIl~~D~~aR~~a~~~~~~~~~~~~~~ 473 (473)
+||+++|+++|++|+......+|||||+++|.|+|+++++++.+.+.+|+.+
T Consensus 403 ~dI~~~i~~~l~~~~~~~~~~~sl~~i~~~d~~aR~~a~~~~~~~~~~~~~~ 454 (454)
T PLN02696 403 LDIFKVIELTCEAHKEELVTSPSLEDILHYDLWAREYAAELVESGGLSPVVA 454 (454)
T ss_pred hhHHHHHHHHHHhhhhccCCCCCHHHHHHHHHHHHHHHHHHHHhcCCCCCCC
Confidence 9999999999999963111335999999999999999999999999998764
|
|
| >COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase | Back alignment and domain information |
|---|
| >PRK12464 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PF08436 DXP_redisom_C: 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal; InterPro: IPR013644 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] | Back alignment and domain information |
|---|
| >PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] | Back alignment and domain information |
|---|
| >PF13288 DXPR_C: DXP reductoisomerase C-terminal domain; PDB: 3A14_A 3A06_A 3IIE_A 2Y1D_B 4AIC_A 2JD0_B 2Y1C_B 2JD1_A 2JCX_A 2Y1G_A | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway | Back alignment and domain information |
|---|
| >PRK06270 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11579 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK13303 L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13302 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08374 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >PRK06392 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13304 L-aspartate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06813 homoserine dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) | Back alignment and domain information |
|---|
| >COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >PRK08300 acetaldehyde dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >TIGR01761 thiaz-red thiazolinyl imide reductase | Back alignment and domain information |
|---|
| >PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated | Back alignment and domain information |
|---|
| >PRK10206 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional | Back alignment and domain information |
|---|
| >COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form | Back alignment and domain information |
|---|
| >COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00036 dapB dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >PLN02700 homoserine dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >PRK08219 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02778 3,5-epimerase/4-reductase | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08040 putative semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10538 malonic semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06947 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06728 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase | Back alignment and domain information |
|---|
| >PRK06101 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08063 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12743 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >TIGR03855 NAD_NadX aspartate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02583 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional | Back alignment and domain information |
|---|
| >COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05693 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09730 putative NAD(P)-binding oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06181 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14874 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02383 aspartate semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK12935 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK13301 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG2910 Putative NADH-flavin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09134 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07102 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06924 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12744 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01472 gmd GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06483 dihydromonapterin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10217 dTDP-glucose 4,6-dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07453 protochlorophyllide oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK08017 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01921 DAP-DH diaminopimelate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07904 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12938 acetyacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05286 QOR2 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >TIGR02415 23BDH acetoin reductases | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07832 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10675 UDP-galactose-4-epimerase; Provisional | Back alignment and domain information |
|---|
| >smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >PLN00112 malate dehydrogenase (NADP); Provisional | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase | Back alignment and domain information |
|---|
| >cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05650 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK12824 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >cd08293 PTGR2 Prostaglandin reductase | Back alignment and domain information |
|---|
| >TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase | Back alignment and domain information |
|---|
| >cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >PF00551 Formyl_trans_N: Formyl transferase; InterPro: IPR002376 A number of formyl transferases belong to this group | Back alignment and domain information |
|---|
| >TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) | Back alignment and domain information |
|---|
| >COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01746 Thioester-redct thioester reductase domain | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12746 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK08340 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK07023 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01777 yfcH conserved hypothetical protein TIGR01777 | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03154 putative allyl alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01179 galE UDP-glucose-4-epimerase | Back alignment and domain information |
|---|
| >cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK08177 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02503 fatty acyl-CoA reductase 2 | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK13535 erythrose 4-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06123 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00016 RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >TIGR01289 LPOR light-dependent protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase | Back alignment and domain information |
|---|
| >PRK07677 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated | Back alignment and domain information |
|---|
| >COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK05884 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07889 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >PRK07775 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10309 galactitol-1-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08936 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) | Back alignment and domain information |
|---|
| >TIGR02685 pter_reduc_Leis pteridine reductase | Back alignment and domain information |
|---|
| >PLN00198 anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12747 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >cd05284 arabinose_DH_like D-arabinose dehydrogenase | Back alignment and domain information |
|---|
| >cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 | Back alignment and domain information |
|---|
| >TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila | Back alignment and domain information |
|---|
| >PRK07069 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR00639 PurN phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent | Back alignment and domain information |
|---|
| >TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08290 ETR 2-enoyl thioester reductase (ETR) | Back alignment and domain information |
|---|
| >PRK07791 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd08244 MDR_enoyl_red Possible enoyl reductase | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd05282 ETR_like 2-enoyl thioester reductase-like | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08303 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional | Back alignment and domain information |
|---|
| >cd08249 enoyl_reductase_like enoyl_reductase_like | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08301 alcohol_DH_plants Plant alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK06953 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase | Back alignment and domain information |
|---|
| >TIGR03025 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones | Back alignment and domain information |
|---|
| >cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >PLN02514 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase | Back alignment and domain information |
|---|
| >PRK05396 tdh L-threonine 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 473 | ||||
| 1r0k_A | 388 | Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate | 6e-84 | ||
| 3au8_A | 488 | Crystal Structure Of The Ternary Complex Of An Isom | 1e-77 | ||
| 4gae_A | 426 | Crystal Structure Of Plasmodium Dxr In Complex With | 3e-77 | ||
| 1q0l_A | 406 | Crystal Structure Of Dxr In Complex With Fosmidomyc | 1e-75 | ||
| 1k5h_A | 398 | 1-Deoxy-D-Xylulose-5-Phosphate Reductoisomerase Len | 4e-75 | ||
| 3anl_A | 420 | Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate | 4e-75 | ||
| 2egh_A | 424 | Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate | 4e-75 | ||
| 3r0i_A | 410 | Ispc In Complex With An N-Methyl-Substituted Hydrox | 4e-75 | ||
| 1t1r_A | 398 | Crystal Structure Of The Reductoisomerase Complexed | 5e-75 | ||
| 3iie_A | 401 | 1-deoxy-d-xylulose 5-phosphate Reductoisomerase Fro | 2e-71 | ||
| 1q0h_A | 406 | Crystal Structure Of Selenomethionine-Labelled Dxr | 9e-70 | ||
| 1jvs_A | 400 | Crystal Structure Of 1-deoxy-d-xylulose 5-phosphate | 3e-69 | ||
| 2jcv_A | 398 | X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate R | 1e-61 | ||
| 2c82_A | 413 | X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate R | 1e-61 | ||
| 2jcx_A | 398 | X-Ray Structure Of Mutant 1-Deoxy-D-Xylulose 5-Phos | 6e-61 | ||
| 3a06_A | 376 | Crystal Structure Of Dxr From Thermooga Maritia, In | 3e-49 |
| >pdb|1R0K|A Chain A, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase From Zymomonas Mobilis Length = 388 | Back alignment and structure |
|
| >pdb|3AU8|A Chain A, Crystal Structure Of The Ternary Complex Of An Isomerase Length = 488 | Back alignment and structure |
| >pdb|4GAE|A Chain A, Crystal Structure Of Plasmodium Dxr In Complex With A Pyridine- Containing Inhibitor Length = 426 | Back alignment and structure |
| >pdb|1Q0L|A Chain A, Crystal Structure Of Dxr In Complex With Fosmidomycin Length = 406 | Back alignment and structure |
| >pdb|1K5H|A Chain A, 1-Deoxy-D-Xylulose-5-Phosphate Reductoisomerase Length = 398 | Back alignment and structure |
| >pdb|3ANL|A Chain A, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase (Dxr) Complexed With Pyridin-2-Ylmethylphosphonic Acid Length = 420 | Back alignment and structure |
| >pdb|2EGH|A Chain A, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase Complexed With A Magnesium Ion, Nadph And Fosmidomycin Length = 424 | Back alignment and structure |
| >pdb|3R0I|A Chain A, Ispc In Complex With An N-Methyl-Substituted Hydroxamic Acid Length = 410 | Back alignment and structure |
| >pdb|1T1R|A Chain A, Crystal Structure Of The Reductoisomerase Complexed With A Bisphosphonate Length = 398 | Back alignment and structure |
| >pdb|3IIE|A Chain A, 1-deoxy-d-xylulose 5-phosphate Reductoisomerase From Yersinia Pestis. Length = 401 | Back alignment and structure |
| >pdb|1Q0H|A Chain A, Crystal Structure Of Selenomethionine-Labelled Dxr In Complex With Fosmidomycin Length = 406 | Back alignment and structure |
| >pdb|1JVS|A Chain A, Crystal Structure Of 1-deoxy-d-xylulose 5-phosphate Reductoisomerase; A Target Enzyme For Antimalarial Drugs Length = 400 | Back alignment and structure |
| >pdb|2JCV|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase, Dxr, Rv2870c, From Mycobacterium Tuberculosis, In Complex With Fosmidomycin And Nadph Length = 398 | Back alignment and structure |
| >pdb|2C82|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase, Dxr, Rv2870c, From Mycobacterium Tuberculosis Length = 413 | Back alignment and structure |
| >pdb|2JCX|A Chain A, X-Ray Structure Of Mutant 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase, Dxr, Rv2870c, From Mycobacterium Tuberculosis, In Complex With Fosmidomycin And Nadph Length = 398 | Back alignment and structure |
| >pdb|3A06|A Chain A, Crystal Structure Of Dxr From Thermooga Maritia, In Complex Fosmidomycin And Nadph Length = 376 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1q0q_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase; HET: DXP NDP; 1.90A {Escherichia coli} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1q0l_A* 1q0h_A* 3r0i_A* 1k5h_A 1onn_A 1ono_A 1onp_A* 1jvs_A* 1t1r_A* 1t1s_A* 2egh_A* 3anm_A* 3anl_A* 3ann_A* 3iie_A Length = 406 | Back alignment and structure |
|---|
Score = 680 bits (1758), Expect = 0.0
Identities = 171/400 (42%), Positives = 234/400 (58%), Gaps = 15/400 (3%)
Query: 71 KTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVA 130
G K +++LGSTGSIG TLD+V + + FRVVAL AG N+T + +Q F P+
Sbjct: 4 HHHSGMKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAV 63
Query: 131 VRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIE 190
+ +E+ +K L + E+L+G+Q + A D V+ IVG AGL PT+AAI
Sbjct: 64 MDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIR 123
Query: 191 AGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQG----------LPE 240
AGK I LANKE+L+ G + + ++LP DSEH+AIFQ + L +
Sbjct: 124 AGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQ 183
Query: 241 GALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEA 300
+ I+LT SGG FR+ P+ L + A +HPNWSMG+KI+VDSAT+ NKGLE IEA
Sbjct: 184 NGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEA 243
Query: 301 HYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSEL 360
+LF A +E++IHPQS+IHSMV QD SV+ QLG PDMR PI +TM+WP R+
Sbjct: 244 RWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSG-- 301
Query: 361 TWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIG 420
LD KL +LTF APD +YP + LA A G T L+AANE V F+ ++I
Sbjct: 302 -VKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIR 360
Query: 421 YLDIFKVVELTCDKHKADLVTSPSLEDIIHYDAWAREYAA 460
+ DI + +K D+ ++D++ DA ARE A
Sbjct: 361 FTDIAALNLSVLEKM--DMREPQCVDDVLSVDANAREVAR 398
|
| >1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Length = 388 | Back alignment and structure |
|---|
| >3au8_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH binding; HET: NDP; 1.86A {Plasmodium falciparum} PDB: 3au9_A* 3aua_A* Length = 488 | Back alignment and structure |
|---|
| >2y1e_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase, DOXP/MEP pathway; 1.65A {Mycobacterium tuberculosis} PDB: 2jcv_A* 2jcz_A* 2jd2_A 2jd1_A 2y1d_A* 2y1c_A 2y1f_A* 2y1g_A* 3ras_A* 4a03_A* 4aic_A* 2jcx_A* 2jcy_A 2jd0_A* 2c82_A Length = 398 | Back alignment and structure |
|---|
| >3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Length = 376 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Length = 446 | Back alignment and structure |
|---|
| >3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Length = 331 | Back alignment and structure |
|---|
| >3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Length = 327 | Back alignment and structure |
|---|
| >3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Length = 325 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 473 | |||
| 1q0q_A | 406 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o | 100.0 | |
| 2y1e_A | 398 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o | 100.0 | |
| 3au8_A | 488 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N | 100.0 | |
| 3a06_A | 376 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M | 100.0 | |
| 1r0k_A | 388 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N | 100.0 | |
| 3upl_A | 446 | Oxidoreductase; rossmann fold, NADPH binding; 1.50 | 98.79 | |
| 3ing_A | 325 | Homoserine dehydrogenase; NP_394635.1, structural | 98.64 | |
| 3do5_A | 327 | HOM, homoserine dehydrogenase; NP_069768.1, putati | 98.58 | |
| 3mz0_A | 344 | Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; | 98.53 | |
| 3ohs_X | 334 | Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d | 98.52 | |
| 3euw_A | 344 | MYO-inositol dehydrogenase; protein structure init | 98.51 | |
| 3oqb_A | 383 | Oxidoreductase; structural genomics, protein struc | 98.45 | |
| 3mtj_A | 444 | Homoserine dehydrogenase; rossmann-fold, PSI, MCSG | 98.42 | |
| 4hkt_A | 331 | Inositol 2-dehydrogenase; structural genomics, nys | 98.4 | |
| 3o9z_A | 312 | Lipopolysaccaride biosynthesis protein WBPB; oxido | 98.39 | |
| 3q2i_A | 354 | Dehydrogenase; rossmann fold, UDP-sugar binding, N | 98.37 | |
| 3ec7_A | 357 | Putative dehydrogenase; alpha-beta, structural gen | 98.34 | |
| 3e9m_A | 330 | Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, | 98.34 | |
| 3i23_A | 349 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 98.34 | |
| 3btv_A | 438 | Galactose/lactose metabolism regulatory protein GA | 98.32 | |
| 3cea_A | 346 | MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore | 98.28 | |
| 1zh8_A | 340 | Oxidoreductase; TM0312, structural genomics, JO ce | 98.23 | |
| 2glx_A | 332 | 1,5-anhydro-D-fructose reductase; NADP(H) dependen | 98.22 | |
| 2nvw_A | 479 | Galactose/lactose metabolism regulatory protein GA | 98.21 | |
| 3rc1_A | 350 | Sugar 3-ketoreductase; sugar biosynthesis, TDP bin | 98.18 | |
| 3ezy_A | 344 | Dehydrogenase; structural genomics, unknown functi | 98.15 | |
| 3evn_A | 329 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 98.13 | |
| 2ho3_A | 325 | Oxidoreductase, GFO/IDH/MOCA family; streptococcus | 98.11 | |
| 3dty_A | 398 | Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram | 98.09 | |
| 3moi_A | 387 | Probable dehydrogenase; structural genomics, PSI2, | 98.08 | |
| 3db2_A | 354 | Putative NADPH-dependent oxidoreductase; two domai | 98.06 | |
| 1xea_A | 323 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 98.05 | |
| 4gqa_A | 412 | NAD binding oxidoreductase; structural genomics, P | 98.04 | |
| 3kux_A | 352 | Putative oxidoreductase; oxidoreductase family, cs | 98.04 | |
| 3m2t_A | 359 | Probable dehydrogenase; PSI, SGXNY, structural gen | 98.02 | |
| 3v5n_A | 417 | Oxidoreductase; structural genomics, PSI-biology, | 98.01 | |
| 3e82_A | 364 | Putative oxidoreductase; NAD, GFO/IDH/MOCA family, | 98.0 | |
| 3c8m_A | 331 | Homoserine dehydrogenase; structural genomics, APC | 97.96 | |
| 3u3x_A | 361 | Oxidoreductase; structural genomics, PSI-biology, | 97.92 | |
| 3e18_A | 359 | Oxidoreductase; dehydrogenase, NAD-binding, struct | 97.9 | |
| 3ip3_A | 337 | Oxidoreductase, putative; structural genomics, PSI | 97.85 | |
| 1ydw_A | 362 | AX110P-like protein; structural genomics, protein | 97.85 | |
| 2p2s_A | 336 | Putative oxidoreductase; YP_050235.1, structural g | 97.82 | |
| 3oa2_A | 318 | WBPB; oxidoreductase, sugar biosynthesis, dehydrog | 97.78 | |
| 3gdo_A | 358 | Uncharacterized oxidoreductase YVAA; structural ge | 97.77 | |
| 1h6d_A | 433 | Precursor form of glucose-fructose oxidoreductase; | 97.73 | |
| 3f4l_A | 345 | Putative oxidoreductase YHHX; structural genomics, | 97.71 | |
| 3c1a_A | 315 | Putative oxidoreductase; ZP_00056571.1, oxidoreduc | 97.7 | |
| 3fhl_A | 362 | Putative oxidoreductase; NAD-binding domain, PSI-2 | 97.69 | |
| 1tlt_A | 319 | Putative oxidoreductase (virulence factor MVIM HO; | 97.46 | |
| 1ebf_A | 358 | Homoserine dehydrogenase; dinucleotide, NAD, dimer | 97.45 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 97.44 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 97.43 | |
| 4had_A | 350 | Probable oxidoreductase protein; structural genomi | 97.38 | |
| 4h3v_A | 390 | Oxidoreductase domain protein; structural genomics | 97.37 | |
| 2ixa_A | 444 | Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver | 97.27 | |
| 4fb5_A | 393 | Probable oxidoreductase protein; PSI-biology, nysg | 97.25 | |
| 2ejw_A | 332 | HDH, homoserine dehydrogenase; NAD-dependent, oxid | 97.12 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 97.06 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 97.01 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 96.86 | |
| 2czc_A | 334 | Glyceraldehyde-3-phosphate dehydrogenase; glycolys | 96.7 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 96.56 | |
| 4gmf_A | 372 | Yersiniabactin biosynthetic protein YBTU; rossmann | 96.52 | |
| 3uuw_A | 308 | Putative oxidoreductase with NAD(P)-binding rossm | 96.5 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 96.49 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 96.49 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 96.32 | |
| 1nvm_B | 312 | Acetaldehyde dehydrogenase (acylating), 4-hydroxy- | 96.23 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 96.13 | |
| 4ew6_A | 330 | D-galactose-1-dehydrogenase protein; nysgrc, PSI-b | 96.1 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 96.09 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 96.06 | |
| 1u8f_O | 335 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l | 96.0 | |
| 2ep5_A | 350 | 350AA long hypothetical aspartate-semialdehyde deh | 95.98 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 95.98 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 95.76 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 95.64 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 95.6 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 95.6 | |
| 1cf2_P | 337 | Protein (glyceraldehyde-3-phosphate dehydrogenase) | 95.41 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 95.32 | |
| 1lc0_A | 294 | Biliverdin reductase A; oxidoreductase, tetrapyrro | 95.23 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 95.22 | |
| 3bio_A | 304 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 95.22 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 95.21 | |
| 2yyy_A | 343 | Glyceraldehyde-3-phosphate dehydrogenase; glyceral | 95.17 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 95.16 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 95.12 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 95.09 | |
| 1b7g_O | 340 | Protein (glyceraldehyde 3-phosphate dehydrogenase; | 95.08 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 95.01 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 94.98 | |
| 3hsk_A | 381 | Aspartate-semialdehyde dehydrogenase; candida albi | 94.97 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 94.9 | |
| 1vkn_A | 351 | N-acetyl-gamma-glutamyl-phosphate reductase; TM178 | 94.89 | |
| 3dr3_A | 337 | N-acetyl-gamma-glutamyl-phosphate reductase; csgid | 94.88 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 94.87 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 94.86 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 94.86 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 94.84 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 94.81 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 94.78 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 94.77 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 94.77 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 94.75 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 94.67 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 94.67 | |
| 3tz6_A | 344 | Aspartate-semialdehyde dehydrogenase; asadh, ASD, | 94.63 | |
| 1edo_A | 244 | Beta-keto acyl carrier protein reductase; nucleoti | 94.6 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 94.54 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 94.53 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 94.51 | |
| 3e5r_O | 337 | PP38, glyceraldehyde-3-phosphate dehydrogenase, cy | 94.49 | |
| 3nkl_A | 141 | UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo | 94.45 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 94.42 | |
| 4dpk_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 94.38 | |
| 4dpl_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 94.38 | |
| 2nqt_A | 352 | N-acetyl-gamma-glutamyl-phosphate reductase; apopr | 94.37 | |
| 2nu8_A | 288 | Succinyl-COA ligase [ADP-forming] subunit alpha; c | 94.37 | |
| 3pwk_A | 366 | Aspartate-semialdehyde dehydrogenase; NADP binding | 94.31 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 94.31 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 94.27 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 94.27 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 94.26 | |
| 2r00_A | 336 | Aspartate-semialdehyde dehydrogenase; conformation | 94.25 | |
| 2ozp_A | 345 | N-acetyl-gamma-glutamyl-phosphate reductase; amino | 94.19 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 94.18 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 94.18 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 94.1 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 94.06 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 94.06 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 94.05 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 94.04 | |
| 2ph3_A | 245 | 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 | 94.03 | |
| 1ys4_A | 354 | Aspartate-semialdehyde dehydrogenase; oxidoreducta | 94.01 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 94.01 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 93.99 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 93.97 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 93.94 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 93.93 | |
| 3b1j_A | 339 | Glyceraldehyde 3-phosphate dehydrogenase (NADP+); | 93.93 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 93.87 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 93.85 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 93.83 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 93.79 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 93.79 | |
| 3krt_A | 456 | Crotonyl COA reductase; structural genomics, prote | 93.78 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 93.77 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 93.74 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 93.72 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 93.71 | |
| 1gu7_A | 364 | Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s | 93.7 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 93.69 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 93.68 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 93.67 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 93.66 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 93.66 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 93.63 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 93.63 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 93.63 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 93.62 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 93.62 | |
| 1db3_A | 372 | GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya | 93.57 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 93.57 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 93.56 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 93.54 | |
| 1i24_A | 404 | Sulfolipid biosynthesis protein SQD1; SDR, short-c | 93.5 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 93.5 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 93.5 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 93.48 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 93.46 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 93.46 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 93.46 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 93.44 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 93.42 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 93.4 | |
| 3gaz_A | 343 | Alcohol dehydrogenase superfamily protein; oxidore | 93.4 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 93.36 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 93.33 | |
| 1rm4_O | 337 | Glyceraldehyde 3-phosphate dehydrogenase A; rossma | 93.28 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 93.26 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 93.25 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 93.24 | |
| 1xyg_A | 359 | Putative N-acetyl-gamma-glutamyl-phosphate reduct; | 93.22 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 93.22 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 93.22 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 93.21 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 93.2 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 93.2 | |
| 3cps_A | 354 | Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g | 93.19 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 93.18 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 93.15 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 93.15 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 93.12 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 93.12 | |
| 2x5j_O | 339 | E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid | 93.09 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 93.09 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 93.07 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 93.05 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 93.04 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 93.04 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 93.02 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 93.01 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 93.0 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 92.94 | |
| 4f3y_A | 272 | DHPR, dihydrodipicolinate reductase; structural ge | 92.91 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 92.91 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 92.9 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 92.89 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 92.86 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 92.86 | |
| 2zb4_A | 357 | Prostaglandin reductase 2; rossmann fold, alternat | 92.86 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 92.84 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 92.83 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 92.83 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 92.83 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 92.8 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 92.79 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 92.79 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 92.77 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 92.69 | |
| 2d2i_A | 380 | Glyceraldehyde 3-phosphate dehydrogenase; rossmann | 92.65 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 92.58 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 92.57 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 92.56 | |
| 1zsy_A | 357 | Mitochondrial 2-enoyl thioester reductase; medium- | 92.52 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 92.51 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 92.51 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 92.49 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 92.49 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 92.45 | |
| 4b8w_A | 319 | GDP-L-fucose synthase; oxidoreductase; HET: NAP GD | 92.44 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 92.43 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 92.38 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 92.34 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 92.32 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 92.32 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 92.31 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 92.3 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 92.3 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 92.29 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 92.27 | |
| 2d59_A | 144 | Hypothetical protein PH1109; COA binding, structur | 92.25 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 92.24 | |
| 4a0s_A | 447 | Octenoyl-COA reductase/carboxylase; oxidoreductase | 92.23 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 92.23 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 92.2 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 92.19 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 92.17 | |
| 1f06_A | 320 | MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH | 92.16 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 92.16 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 92.15 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 92.14 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 92.14 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 92.12 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 92.12 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 92.1 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 92.08 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 91.98 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 91.97 | |
| 4dvj_A | 363 | Putative zinc-dependent alcohol dehydrogenase Pro; | 91.97 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 91.96 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 91.96 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 91.95 | |
| 3ijp_A | 288 | DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, | 91.94 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 91.93 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 91.87 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 91.84 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 91.84 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 91.8 | |
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 91.79 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 91.79 | |
| 1dih_A | 273 | Dihydrodipicolinate reductase; oxidoreductase; HET | 91.75 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 91.74 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 91.73 | |
| 1obf_O | 335 | Glyceraldehyde 3-phosphate dehydrogenase; glycolyt | 91.72 | |
| 4a2c_A | 346 | Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc | 91.69 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 91.66 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 91.65 | |
| 1hdg_O | 332 | Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o | 91.65 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 91.65 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 91.61 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 91.6 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 91.53 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 91.51 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 91.5 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 91.47 | |
| 2hjs_A | 340 | USG-1 protein homolog; aspartate-semialdehyde dehy | 91.47 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 91.45 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 91.44 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 91.41 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 91.4 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 91.4 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 91.38 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 91.37 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 91.29 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 91.25 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 91.25 | |
| 4f6l_B | 508 | AUSA reductase domain protein; thioester reductase | 91.16 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 91.11 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 91.11 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 91.1 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 91.1 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 91.07 | |
| 2ggs_A | 273 | 273AA long hypothetical DTDP-4-dehydrorhamnose red | 91.06 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 91.06 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 91.05 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 91.03 | |
| 1t4b_A | 367 | Aspartate-semialdehyde dehydrogenase; asadh, HOSR, | 91.03 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 91.02 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 91.0 | |
| 3m6i_A | 363 | L-arabinitol 4-dehydrogenase; medium chain dehydro | 90.9 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 90.9 | |
| 3uw3_A | 377 | Aspartate-semialdehyde dehydrogenase; structural g | 90.9 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 90.89 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 90.88 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 90.87 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 90.85 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 90.85 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 90.84 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 90.82 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 90.82 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 90.75 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 90.74 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 90.73 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 90.73 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 90.73 | |
| 2b5w_A | 357 | Glucose dehydrogenase; nucleotide binding motif, o | 90.69 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 90.68 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 90.68 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 90.64 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 90.63 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 90.63 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 90.62 | |
| 2ph5_A | 480 | Homospermidine synthase; alpha-beta protein, struc | 90.62 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 90.62 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 90.6 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 90.58 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 90.53 | |
| 3pzr_A | 370 | Aspartate-semialdehyde dehydrogenase; NADP, oxidor | 90.53 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 90.52 | |
| 3da8_A | 215 | Probable 5'-phosphoribosylglycinamide formyltransf | 90.46 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 90.42 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 90.35 | |
| 1gy8_A | 397 | UDP-galactose 4-epimerase; oxidoreductase; HET: NA | 90.34 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 90.22 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 90.21 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 90.21 | |
| 1gad_O | 330 | D-glyceraldehyde-3-phosphate dehydrogenase; oxidor | 90.18 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 90.14 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 90.0 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 89.98 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 89.97 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 89.97 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 89.96 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 89.94 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 89.9 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 89.89 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 89.86 | |
| 2g82_O | 331 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G | 89.85 | |
| 3auf_A | 229 | Glycinamide ribonucleotide transformylase 1; struc | 89.79 | |
| 1xa0_A | 328 | Putative NADPH dependent oxidoreductases; structur | 89.76 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 89.74 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 89.66 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 89.65 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 89.63 | |
| 3icc_A | 255 | Putative 3-oxoacyl-(acyl carrier protein) reducta; | 89.63 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 89.56 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 89.56 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 89.53 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 89.51 | |
| 1vj0_A | 380 | Alcohol dehydrogenase, zinc-containing; TM0436, st | 89.48 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 89.46 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 89.46 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 89.42 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 89.35 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 89.35 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 89.27 | |
| 1udb_A | 338 | Epimerase, UDP-galactose-4-epimerase; isomerase; H | 89.23 | |
| 2p5y_A | 311 | UDP-glucose 4-epimerase; TTHA0591, structural geno | 89.22 | |
| 3ff4_A | 122 | Uncharacterized protein; structural genomics, PSI- | 89.22 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 89.2 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 89.2 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 89.2 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 89.19 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 89.17 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 89.17 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 89.06 | |
| 3cmc_O | 334 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m | 88.97 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 88.88 | |
| 1qsg_A | 265 | Enoyl-[acyl-carrier-protein] reductase; enoyl redu | 88.68 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 88.63 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 88.59 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 88.48 | |
| 1zmo_A | 244 | Halohydrin dehalogenase; haloalcohol dehalogenase, | 88.42 | |
| 3jv7_A | 345 | ADH-A; dehydrogenase, nucleotide binding, rossmann | 88.36 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 88.21 | |
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 88.18 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 87.99 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 87.87 | |
| 1oi7_A | 288 | Succinyl-COA synthetase alpha chain; SCS, ligase, | 87.83 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 87.81 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 87.77 | |
| 1kew_A | 361 | RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo | 87.7 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 87.69 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 87.36 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 87.3 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 87.27 | |
| 2pd4_A | 275 | Enoyl-[acyl-carrier-protein] reductase [NADH]; ant | 87.27 | |
| 3iup_A | 379 | Putative NADPH:quinone oxidoreductase; YP_296108.1 | 87.17 | |
| 2dph_A | 398 | Formaldehyde dismutase; dismutation of aldehydes, | 87.08 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 86.87 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 86.85 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 86.82 | |
| 1r6d_A | 337 | TDP-glucose-4,6-dehydratase; rossmann fold, short- | 86.8 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 86.76 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 86.71 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 86.64 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 86.63 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 86.56 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 86.51 | |
| 4e7p_A | 150 | Response regulator; DNA binding, cytosol, transcri | 86.45 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 86.45 | |
| 1hye_A | 313 | L-lactate/malate dehydrogenase; nucleotide binding | 86.33 | |
| 2z5l_A | 511 | Tylkr1, tylactone synthase starter module and modu | 86.31 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 86.21 | |
| 1y81_A | 138 | Conserved hypothetical protein; hyperthermophIle, | 86.06 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 86.01 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 85.98 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 85.96 | |
| 2wyu_A | 261 | Enoyl-[acyl carrier protein] reductase; oxidoreduc | 85.9 | |
| 2duw_A | 145 | Putative COA-binding protein; ligand binding prote | 85.88 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 85.83 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 85.79 | |
| 2fr1_A | 486 | Erythromycin synthase, eryai; short chain dehydrog | 85.63 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 85.58 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 85.51 | |
| 3av3_A | 212 | Phosphoribosylglycinamide formyltransferase; struc | 85.44 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 85.22 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 85.2 | |
| 2ywr_A | 216 | Phosphoribosylglycinamide formyltransferase; rossm | 85.05 | |
| 1jkx_A | 212 | GART;, phosphoribosylglycinamide formyltransferase | 85.03 | |
| 1iuk_A | 140 | Hypothetical protein TT1466; structural genomics, | 85.02 | |
| 1gz6_A | 319 | Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF | 84.95 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 84.86 | |
| 2h7i_A | 269 | Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi | 84.76 | |
| 2fzw_A | 373 | Alcohol dehydrogenase class III CHI chain; S-nitro | 84.75 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 84.75 | |
| 1z45_A | 699 | GAL10 bifunctional protein; epimerase, mutarotase, | 84.74 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 84.59 | |
| 1eq2_A | 310 | ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin | 84.4 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 84.27 | |
| 3dfu_A | 232 | Uncharacterized protein from 6-phosphogluconate de | 84.23 | |
| 3mje_A | 496 | AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. | 84.2 | |
| 1j5p_A | 253 | Aspartate dehydrogenase; TM1643, structural genomi | 83.97 | |
| 2yv2_A | 297 | Succinyl-COA synthetase alpha chain; COA-binding d | 83.5 | |
| 1kjq_A | 391 | GART 2, phosphoribosylglycinamide formyltransferas | 83.2 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 83.16 | |
| 1jtv_A | 327 | 17 beta-hydroxysteroid dehydrogenase type 1; stero | 83.1 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 83.04 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 82.9 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 82.68 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 82.6 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 82.38 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 82.34 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 82.29 | |
| 2q5c_A | 196 | NTRC family transcriptional regulator; structural | 82.09 | |
| 3u0b_A | 454 | Oxidoreductase, short chain dehydrogenase/reducta | 82.07 | |
| 3tqr_A | 215 | Phosphoribosylglycinamide formyltransferase; purin | 82.05 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 82.0 | |
| 3qy9_A | 243 | DHPR, dihydrodipicolinate reductase; rossmann fold | 81.84 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 81.67 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 81.56 | |
| 4ds3_A | 209 | Phosphoribosylglycinamide formyltransferase; struc | 81.53 | |
| 4a27_A | 349 | Synaptic vesicle membrane protein VAT-1 homolog-L; | 81.52 | |
| 1e7w_A | 291 | Pteridine reductase; dihydrofolate reductase, shor | 81.51 | |
| 1meo_A | 209 | Phosophoribosylglycinamide formyltransferase; puri | 81.38 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 81.11 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 80.88 | |
| 1jfl_A | 228 | Aspartate racemase; alpha-beta structure, HOMO-dim | 80.65 | |
| 1kol_A | 398 | Formaldehyde dehydrogenase; oxidoreductase; HET: N | 80.55 | |
| 3qp9_A | 525 | Type I polyketide synthase pikaii; rossmann fold, | 80.44 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 80.27 |
| >1q0q_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase; HET: DXP NDP; 1.90A {Escherichia coli} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1q0l_A* 1q0h_A* 3r0i_A* 1k5h_A 1onn_A 1ono_A 1onp_A* 1jvs_A* 1t1r_A* 1t1s_A* 2egh_A* 3anm_A* 3anl_A* 3ann_A* 3iie_A | Back alignment and structure |
|---|
Probab=100.00 E-value=5.8e-168 Score=1280.73 Aligned_cols=389 Identities=44% Similarity=0.680 Sum_probs=371.5
Q ss_pred CCCCeeEEEEccCChHhHHHHHHHHhCCCceEEEEEeccCCHHHHHHHHHhhCCCEEEEeCcccHHHHHHHHhcCCCCcE
Q 012004 73 WDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPE 152 (473)
Q Consensus 73 ~~~~k~I~ILGSTGSIG~qtLdVi~~~pd~f~VvaLaa~~Nv~~L~~q~~~f~P~~v~v~de~~~~~l~~~l~~~~~~~~ 152 (473)
..+||+|+|||||||||+||||||++|||+|+|+||+||+|+++|++||++|+|++|++.|++.+.+|++.|...+.+++
T Consensus 6 ~~~~k~i~ILGSTGSIGtqtLdVi~~~pd~f~V~aL~ag~nv~~L~~q~~~f~p~~v~v~d~~~~~~L~~~l~~~~~~~~ 85 (406)
T 1q0q_A 6 HSGMKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSRTE 85 (406)
T ss_dssp ---CEEEEEETTTSHHHHHHHHHHHHCTTTEEEEEEEESSCHHHHHHHHHHHCCSEEEESSHHHHHHHHHHHHHTTCCCE
T ss_pred cCCceeEEEEccCcHHHHHHHHHHHhCCCccEEEEEEcCCCHHHHHHHHHHhCCCEEEEcCHHHHHHHHHHhhcCCCCcE
Confidence 36899999999999999999999999999999999999999999999999999999999999999999998821134589
Q ss_pred EEechhhHHHhhcCCCCCEEEEecccccCcHHHHHHHHcCCcccccccceeeeccccchHHHhhcCCeEeecccchhhHH
Q 012004 153 ILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIF 232 (473)
Q Consensus 153 v~~G~egl~~la~~~~~D~Vv~AIvG~aGL~ptl~Ai~~GK~IaLANKESLV~aG~li~~~a~~~~~~IlPVDSEHsAIf 232 (473)
++.|++|++++++.+++|+||+||||++||.||++||++||+|||||||||||||++||++++++|++|+||||||||||
T Consensus 86 v~~G~~~l~~~a~~~~~D~Vv~AIvG~aGL~PTlaAi~aGK~iaLANKEsLV~aG~lv~~~a~~~~~~ilPVDSEHsAIf 165 (406)
T 1q0q_A 86 VLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIF 165 (406)
T ss_dssp EEESHHHHHHHHTCTTCCEEEECCSSGGGHHHHHHHHHTTCEEEECCHHHHHHHTHHHHHHHHHHTCEEEECSHHHHHHH
T ss_pred EEeCHHHHHHHhcCCCCCEEEEccccHhHHHHHHHHHHCCCeEEEechHHHHhchHHHHHHHHHcCCeEEEecchHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred Hhh----cCC------CCCccceEEEEecCCCCCCCChhhhhcCCHHHHhcCCCCCCCcccccchhhhhhhhHHHHHHhh
Q 012004 233 QCI----QGL------PEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHY 302 (473)
Q Consensus 233 QcL----~g~------~~~~v~kiiLTASGGPFr~~~~e~L~~vT~~~ALkHPnW~MG~KITIDSATmmNKgLEvIEA~~ 302 (473)
||| +|+ +..+|+||||||||||||+||+|+|++|||+|||+||||+||+|||||||||||||||||||||
T Consensus 166 Q~L~~~~~g~~~~~~~~~~~V~kiiLTASGGPFR~~~~e~L~~vT~eqAl~HPnWsMG~KITIDSATmmNKGLEvIEA~~ 245 (406)
T 1q0q_A 166 QSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARW 245 (406)
T ss_dssp HTSCHHHHTTTTTSCTGGGTEEEEEEEECCCTTTTSCGGGGGGCCHHHHHCCSSCCCCHHHHHHHHHTHHHHHHHHHHHH
T ss_pred HHcccccCCccccccCCcccccEEEEECCCcccCCCCHHHHhCCCHHHHhcCCCccCCCeeeehHHhHHhhhHHHHHHHH
Confidence 999 876 5456999999999999999999999999999999999999999999999999999999999999
Q ss_pred hcCCCCCceeEEEcCCcceeEEEEecCCcEEEecCCCCchHHHHhcCCCCCccccCCCCCCCCCcCCCCCceecCCCCCC
Q 012004 303 LFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPDTAK 382 (473)
Q Consensus 303 LF~i~~d~I~VvIHPQSiIHsmVef~DGSv~Aqlg~PDMrlPI~yAL~yP~R~~~~~~~~~~ldl~~~~~LtF~~pD~~r 382 (473)
|||+|||||||||||||||||||||.|||++||||.||||+||+|||+||+|+ +..+++|||.++++|||++||++|
T Consensus 246 LF~~~~d~I~VvVHPQSiIHSmVef~DGSv~AQlg~PDMrlPIayAL~~P~R~---~~~~~~lDl~~~~~LtF~~pD~~r 322 (406)
T 1q0q_A 246 LFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRV---NSGVKPLDFCKLSALTFAAPDYDR 322 (406)
T ss_dssp HHTCCGGGEEEEECTTCCEEEEEEETTSCEEEEECCSCTHHHHHHHHHTTSCC---CCSCCCCCTTTCCCBCCBCCCTTT
T ss_pred HcCCCHHHeEEEECCCCceeEEEEEcCCcEEEEeCCCCcHHHHHHHcCCccCC---CCCCCCCCCCcCCCcEEeCCChhh
Confidence 99999999999999999999999999999999999999999999999999999 567899999999999999999999
Q ss_pred CchHHHHHHHHHcCCCceeeeehhhHHHHHHHHhCCCCCccHHHHHHHHHHccccCCCCCCCHHHHHHHHHHHHHHHHHH
Q 012004 383 YPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIGYLDIFKVVELTCDKHKADLVTSPSLEDIIHYDAWAREYAAGL 462 (473)
Q Consensus 383 FP~l~LA~~a~~~Gg~~~~vlNAANEvAV~aFL~~kI~F~dI~~ii~~~l~~~~~~~~~~~sledIl~~D~~aR~~a~~~ 462 (473)
||||+|||+|++.||++|+|||||||+||++||+|||+|+||+++|+++|+++. ...++|+|||+++|+|||++|+++
T Consensus 323 FP~L~LA~~a~~~Gg~~p~vlNAANEvAV~aFL~~~I~F~dI~~ii~~~l~~~~--~~~~~sle~il~~D~~aR~~a~~~ 400 (406)
T 1q0q_A 323 YPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSVLEKMD--MREPQCVDDVLSVDANAREVARKE 400 (406)
T ss_dssp CHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHTTSSCTTHHHHHHHHHHHHCC--CCCCSSHHHHHHHHHHHHHHHHHH
T ss_pred CcHHHHHHHHHhcCCCceEeeEHHHHHHHHHHHcCCCCcchHHHHHHHHHHhcc--CCCCCCHHHHHHHHHHHHHHHHHH
Confidence 999999999999999999999999999999999999999999999999999986 334579999999999999999998
Q ss_pred HHhc
Q 012004 463 QFSS 466 (473)
Q Consensus 463 ~~~~ 466 (473)
+..+
T Consensus 401 ~~~~ 404 (406)
T 1q0q_A 401 VMRL 404 (406)
T ss_dssp HHHT
T ss_pred HHHh
Confidence 8654
|
| >2y1e_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase, DOXP/MEP pathway; 1.65A {Mycobacterium tuberculosis} PDB: 2jcv_A* 2jcz_A* 2jd2_A 2jd1_A 2y1d_A* 2y1c_A 2y1f_A* 2y1g_A* 3ras_A* 4a03_A* 4aic_A* 2jcx_A* 2jcy_A 2jd0_A* 2c82_A | Back alignment and structure |
|---|
| >3au8_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH binding; HET: NDP; 1.86A {Plasmodium falciparum} PDB: 3au9_A* 3aua_A* | Back alignment and structure |
|---|
| >3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* | Back alignment and structure |
|---|
| >1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* | Back alignment and structure |
|---|
| >3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* | Back alignment and structure |
|---|
| >3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* | Back alignment and structure |
|---|
| >3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X | Back alignment and structure |
|---|
| >3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} | Back alignment and structure |
|---|
| >3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* | Back alignment and structure |
|---|
| >3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* | Back alignment and structure |
|---|
| >3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A | Back alignment and structure |
|---|
| >3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A | Back alignment and structure |
|---|
| >3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} | Back alignment and structure |
|---|
| >2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A | Back alignment and structure |
|---|
| >3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* | Back alignment and structure |
|---|
| >3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} | Back alignment and structure |
|---|
| >3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} | Back alignment and structure |
|---|
| >1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} | Back alignment and structure |
|---|
| >3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* | Back alignment and structure |
|---|
| >3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} | Back alignment and structure |
|---|
| >3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A | Back alignment and structure |
|---|
| >2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A | Back alignment and structure |
|---|
| >1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* | Back alignment and structure |
|---|
| >3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} | Back alignment and structure |
|---|
| >3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} | Back alignment and structure |
|---|
| >2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* | Back alignment and structure |
|---|
| >4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} | Back alignment and structure |
|---|
| >2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* | Back alignment and structure |
|---|
| >3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 | Back alignment and structure |
|---|
| >2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A | Back alignment and structure |
|---|
| >1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O | Back alignment and structure |
|---|
| >3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* | Back alignment and structure |
|---|
| >4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* | Back alignment and structure |
|---|
| >2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A | Back alignment and structure |
|---|
| >2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* | Back alignment and structure |
|---|
| >3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* | Back alignment and structure |
|---|
| >2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} | Back alignment and structure |
|---|
| >1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* | Back alignment and structure |
|---|
| >2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* | Back alignment and structure |
|---|
| >4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* | Back alignment and structure |
|---|
| >3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} | Back alignment and structure |
|---|
| >1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* | Back alignment and structure |
|---|
| >2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* | Back alignment and structure |
|---|
| >3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* | Back alignment and structure |
|---|
| >3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* | Back alignment and structure |
|---|
| >2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* | Back alignment and structure |
|---|
| >2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* | Back alignment and structure |
|---|
| >2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* | Back alignment and structure |
|---|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3av3_A Phosphoribosylglycinamide formyltransferase; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; HET: MSE; 1.70A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* | Back alignment and structure |
|---|
| >1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A | Back alignment and structure |
|---|
| >1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... | Back alignment and structure |
|---|
| >2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 | Back alignment and structure |
|---|
| >1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* | Back alignment and structure |
|---|
| >3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* | Back alignment and structure |
|---|
| >1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* | Back alignment and structure |
|---|
| >2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A | Back alignment and structure |
|---|
| >3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >4ds3_A Phosphoribosylglycinamide formyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.85A {Brucella melitensis BV} | Back alignment and structure |
|---|
| >4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* | Back alignment and structure |
|---|
| >1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >1jfl_A Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomer; 1.90A {Pyrococcus horikoshii} SCOP: c.78.2.1 c.78.2.1 PDB: 2dx7_A* 1iu9_A | Back alignment and structure |
|---|
| >1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 473 | ||||
| d1q0qa3 | 149 | d.81.1.3 (A:126-274) 1-deoxy-D-xylulose-5-phosphat | 1e-51 | |
| d1r0ka3 | 138 | d.81.1.3 (A:127-264) 1-deoxy-D-xylulose-5-phosphat | 2e-48 | |
| d1q0qa2 | 151 | c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-p | 2e-40 | |
| d1r0ka2 | 150 | c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-p | 1e-34 | |
| d1q0qa1 | 98 | a.69.3.1 (A:301-398) 1-deoxy-D-xylulose-5-phosphat | 6e-30 | |
| d1r0ka1 | 95 | a.69.3.1 (A:291-385) 1-deoxy-D-xylulose-5-phosphat | 1e-29 | |
| d1t1ra3 | 26 | c.2.1.3 (A:275-300) 1-deoxy-D-xylulose-5-phosphate | 2e-04 |
| >d1q0qa3 d.81.1.3 (A:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Length = 149 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FwdE/GAPDH domain-like superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain family: Dihydrodipicolinate reductase-like domain: 1-deoxy-D-xylulose-5-phosphate reductoisomerase species: Escherichia coli [TaxId: 562]
Score = 169 bits (430), Expect = 1e-51
Identities = 69/149 (46%), Positives = 93/149 (62%), Gaps = 10/149 (6%)
Query: 201 ETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQG----------LPEGALRRIILTA 250
E+L+ G + + ++LP DSEH+AIFQ + L + + I+LT
Sbjct: 1 ESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTG 60
Query: 251 SGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDN 310
SGG FR+ P+ L + A +HPNWSMG+KI+VDSAT+ NKGLE IEA +LF A
Sbjct: 61 SGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQ 120
Query: 311 IEIIIHPQSIIHSMVETQDSSVIGQLGWP 339
+E++IHPQS+IHSMV QD SV+ QLG P
Sbjct: 121 MEVLIHPQSVIHSMVRYQDGSVLAQLGEP 149
|
| >d1r0ka3 d.81.1.3 (A:127-264) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Length = 138 | Back information, alignment and structure |
|---|
| >d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Length = 151 | Back information, alignment and structure |
|---|
| >d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Length = 150 | Back information, alignment and structure |
|---|
| >d1q0qa1 a.69.3.1 (A:301-398) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 98 | Back information, alignment and structure |
|---|
| >d1r0ka1 a.69.3.1 (A:291-385) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Zymomonas mobilis [TaxId: 542]} Length = 95 | Back information, alignment and structure |
|---|
| >d1t1ra3 c.2.1.3 (A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Length = 26 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 473 | |||
| d1q0qa3 | 149 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E | 100.0 | |
| d1r0ka3 | 138 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z | 100.0 | |
| d1r0ka2 | 150 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z | 100.0 | |
| d1q0qa2 | 151 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E | 100.0 | |
| d1q0qa1 | 98 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C | 99.97 | |
| d1r0ka1 | 95 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C | 99.97 | |
| d1t1ra3 | 26 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E | 98.74 | |
| d1zh8a1 | 181 | Hypothetical protein TM0312 {Thermotoga maritima [ | 97.76 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 97.65 | |
| d1nvmb1 | 157 | Acetaldehyde dehydrogenase (acylating) {Pseudomona | 97.5 | |
| d2g17a1 | 179 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 97.28 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 97.25 | |
| d2nvwa1 | 237 | Galactose/lactose metabolism regulatory protein GA | 97.25 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 97.07 | |
| d1vkna1 | 176 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 97.05 | |
| d1h6da1 | 221 | Glucose-fructose oxidoreductase, N-terminal domain | 97.05 | |
| d2cvoa1 | 183 | Putative semialdehyde dehydrogenase {Rice (Oryza s | 97.0 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 96.99 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 96.99 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 96.9 | |
| d1tlta1 | 164 | Virulence factor MviM {Escherichia coli [TaxId: 56 | 96.8 | |
| d1t4ba1 | 146 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 96.62 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 96.55 | |
| d1n2sa_ | 298 | dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S | 96.43 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 96.42 | |
| d1ebfa1 | 168 | Homoserine dehydrogenase {Baker's yeast (Saccharom | 96.25 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 96.22 | |
| d2gz1a1 | 154 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 96.14 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 96.08 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 96.08 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 96.08 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 96.06 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 95.99 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 95.96 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 95.72 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 95.7 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 95.68 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 95.56 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 95.53 | |
| d1cf2o1 | 171 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 95.48 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 95.48 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 95.48 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 95.46 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 95.39 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 95.39 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 95.37 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 95.29 | |
| d1b7go1 | 178 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 95.17 | |
| d1gu7a2 | 189 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 95.13 | |
| d1mb4a1 | 147 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 95.05 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 94.88 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 94.86 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 94.68 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 94.49 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 94.43 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 94.32 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 94.29 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 94.19 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 94.19 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 93.71 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 93.69 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 93.64 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 93.49 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 93.48 | |
| d1gy8a_ | 383 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 93.45 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 93.25 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 93.02 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 92.75 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 92.64 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 92.56 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 92.53 | |
| d1vj1a2 | 187 | Putative zinc-binding alcohol dehydrogenase {Mouse | 92.19 | |
| d1snya_ | 248 | Carbonyl reductase sniffer {Fruit fly (Drosophila | 92.17 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 92.09 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 92.06 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 92.04 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 92.03 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 92.02 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 92.0 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 91.91 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 91.88 | |
| d2czca2 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 91.88 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 91.69 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 91.64 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 91.43 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 91.15 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 90.98 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 90.92 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 90.92 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 90.89 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 90.81 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 90.45 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 89.84 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 89.67 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 89.14 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 88.95 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 88.72 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 88.66 | |
| d1lc0a1 | 172 | Biliverdin reductase {Rat (Rattus norvegicus) [Tax | 88.57 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 88.56 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 88.54 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 88.53 | |
| d2fr1a1 | 259 | Erythromycin synthase, eryAI, 1st ketoreductase mo | 88.46 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 88.25 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 88.19 | |
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 87.7 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 87.69 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 87.54 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 87.41 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 87.04 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 86.88 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 86.8 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 86.8 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 86.8 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 86.78 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 86.7 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 86.3 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 85.91 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 85.74 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 85.7 | |
| d1eq2a_ | 307 | ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric | 84.96 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 84.85 | |
| d2d59a1 | 139 | Hypothetical protein PH1109 {Pyrococcus horikoshii | 84.7 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 84.68 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 84.28 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 84.0 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 83.66 | |
| d1y81a1 | 116 | Hypothetical protein PF0725 {Pyrococcus furiosus [ | 83.51 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 83.46 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 83.36 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 83.28 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 82.67 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 82.54 | |
| d1r6da_ | 322 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces | 82.3 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 81.82 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 81.67 | |
| d1neka2 | 330 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 81.65 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 81.62 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 81.39 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 81.06 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 80.93 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 80.61 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 80.48 |
| >d1q0qa3 d.81.1.3 (A:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FwdE/GAPDH domain-like superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain family: Dihydrodipicolinate reductase-like domain: 1-deoxy-D-xylulose-5-phosphate reductoisomerase species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=5.1e-79 Score=551.50 Aligned_cols=139 Identities=49% Similarity=0.823 Sum_probs=135.0
Q ss_pred ceeeeccccchHHHhhcCCeEeecccchhhHHHhhcCC----------CCCccceEEEEecCCCCCCCChhhhhcCCHHH
Q 012004 201 ETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGL----------PEGALRRIILTASGGAFRDWPVEKLKEVKVAD 270 (473)
Q Consensus 201 ESLV~aG~li~~~a~~~~~~IlPVDSEHsAIfQcL~g~----------~~~~v~kiiLTASGGPFr~~~~e~L~~vT~~~ 270 (473)
|||||||+++|+.++++|++|+|||||||||||||++. +.+.|++|+|||||||||++++++|++||++|
T Consensus 1 EslV~aG~li~~~akk~~~~iiPvDSEH~AIfQ~l~~~~~~~~~~~~~~~~~I~ki~LTASGGPF~~~~~~~l~~vt~~~ 80 (149)
T d1q0qa3 1 ESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQ 80 (149)
T ss_dssp HHHHHHTHHHHHHHHHHTCEEEECSHHHHHHHHTSCHHHHTTTTTSCTGGGTEEEEEEEECCCTTTTSCGGGGGGCCHHH
T ss_pred CcEEEcHHHHHHHHHHcCCeEEecChHHHHHHHHhhhhhhcccccccccccceeEEEEEcCCccccccchhhhhccCHHH
Confidence 89999999999999999999999999999999999742 34679999999999999999999999999999
Q ss_pred HhcCCCCCCCcccccchhhhhhhhHHHHHHhhhcCCCCCceeEEEcCCcceeEEEEecCCcEEEecCCC
Q 012004 271 ALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWP 339 (473)
Q Consensus 271 ALkHPnW~MG~KITIDSATmmNKgLEvIEA~~LF~i~~d~I~VvIHPQSiIHsmVef~DGSv~Aqlg~P 339 (473)
||+||||+||+|||||||||||||||+||||||||++++||+|||||||||||||+|.|||++||||.|
T Consensus 81 Al~HP~W~MG~KIsIDSATmmNKglEvIEA~~LF~l~~~kI~v~IHpqSiiHs~V~f~DGs~~a~~~~P 149 (149)
T d1q0qa3 81 ACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEP 149 (149)
T ss_dssp HHCCSSCCCCHHHHHHHHHTHHHHHHHHHHHHHHTCCGGGEEEEECTTCCEEEEEEETTSCEEEEECCS
T ss_pred HhhCCcccccceeeccHHHHHHHHHHHHHHHHHhCCCHHHEEEEECCCCeeeEEEEECCCCEEEeccCC
Confidence 999999999999999999999999999999999999999999999999999999999999999999998
|
| >d1r0ka3 d.81.1.3 (A:127-264) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q0qa1 a.69.3.1 (A:301-398) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0ka1 a.69.3.1 (A:291-385) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1t1ra3 c.2.1.3 (A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|