Citrus Sinensis ID: 012060


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470--
MDNVNSDHTPDRQNGDRVKLNVGGKLFETTLSTIQSGGPDSLLYALSNRQSDEPNPIFIDRDPDVFSVLLSLLRSNRLPSTASRFSKQELADEALYYGIDSQLKSAMSPPPLQGIDASIVSTVRPAADALPSTFTASSDDGSLWIAHGGQISVYDWNLSHSVTVRTHLDNITSIRHVWSDVAAVGSDYSSGIHFYDLSSSRHVASAHWTDPSDPRIYRATVTAIADSPTTVFSSLVCPHKENSVLLIDKSTLQISSEIGRQSGASSKNMAVGKLTWIPATGVVLGSAIAWGAFGYSGYVRMWDPRSGEVVWETNEPGSGRSARFGDSFADVDVDVDELTLFKICSKSGDIAMADLRNLGEDPWVYMEDKNPSMISSSGNNNGENKLIHCYKNQVFVGRGGSLEVWSRVREGRNRSCSEGLFRRNFVDRVEDSGRGAISRIDAGGNRLFVSREDVEGIEVWESSNLSGVVCVL
ccccccccccccccccEEEEECccEEEEEEHHHHHcccccccccccccccccccccEEEccccccHHHHHHcccccccccccccccHHHHHHHHHHcccHHHHHHHccccccccccccEEEECcccccccccEEECccccccEEEECcccEEEECccccccccEEEcccccccccccccccEEEcccccccCEEEEcccccCEEEEEEcccccccccccEEEEECccccCEEEccccccccccEEEEEccccccccECcccccccccccccccEEECcccccEEEEEEEcccccccEEEEEEEcccccEEEEEcccccccccccccccccEEECcccccEEEEEEccccEEEEEEccccccccEEccccccccccccccccccccEEEECccEEEEEcccEEEEEEEEEEccccccccccEEEECcccccccccccEEEEEEcccEEEEEECccccEEEEEcccccccEEEc
*******************LNVGGKLFETTLSTIQSGGPDSLLYALSNRQSDEPNPIFIDRDPDVFSVLLSLLRSNRLPSTASRFSKQELADEALYYGIDSQLKSAM********************************DGSLWIAHGGQISVYDWNLSHSVTVRTHLDNITSIRHVWSDVAAVGSDYSSGIHFYDLSSSRHVASAHWTDPSDPRIYRATVTAIADSPTTVFSSLVCPHKENSVLLIDKSTLQISSEIGRQSGASSKNMAVGKLTWIPATGVVLGSAIAWGAFGYSGYVRMWDPRSGEVVWETNEPGSGRSARFGDSFADVDVDVDELTLFKICSKSGDIAMADLRNLGEDPWVYME****************NKLIHCYKNQVFVGRGGSLEVWSRVREGRNRSCSEGLFRRNFVDRVEDSGRGAISRIDAGGNRLFVSREDVEGIEVWESSNLSGVVCVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNVNSDHTPDRQNGDRVKLNVGGKLFETTLSTIQSGGPDSLLYALSNRQSDEPNPIFIDRDPDVFSVLLSLLRSNRLPSTASRFSKQELADEALYYGIDSQLKSAMSPPPLQGIDASIVSTVRPAADALPSTFTASSDDGSLWIAHGGQISVYDWNLSHSVTVRTHLDNITSIRHVWSDVAAVGSDYSSGIHFYDLSSSRHVASAHWTDPSDPRIYRATVTAIADSPTTVFSSLVCPHKENSVLLIDKSTLQISSEIGRQSGASSKNMAVGKLTWIPATGVVLGSAIAWGAFGYSGYVRMWDPRSGEVVWETNEPGSGRSARFGDSFADVDVDVDELTLFKICSKSGDIAMADLRNLGEDPWVYMEDKNPSMISSSGNNNGENKLIHCYKNQVFVGRGGSLEVWSRVREGRNRSCSEGLFRRNFVDRVEDSGRGAISRIDAGGNRLFVSREDVEGIEVWESSNLSGVVCVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
BTB/POZ domain-containing protein At3g09030 May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.probableQ9S7R7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NZ0, chain B
Confidence level:confident
Coverage over the Query: 11-107
View the alignment between query and template
View the model in PyMOL
Template: 1K3I, chain A
Confidence level:confident
Coverage over the Query: 140-253,266-410
View the alignment between query and template
View the model in PyMOL
Template: 1K8K, chain C
Confidence level:probable
Coverage over the Query: 133-464
View the alignment between query and template
View the model in PyMOL