Citrus Sinensis ID: 012095

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-
MANSLHSSTSFISNPVNFGHSKIPAQIPGSVSFPSRYLHNFNLNKSDRRVLRVMACSGVEEVQVDVSLSPRVNAVKPSKTVAITDQATALAQAGVSVIRLAAGEPDFDTPVLIAEAGINAIREGFTRYTPNAGTLELRSAICHKLKEENGLSYTPDQILVSNGAKQSILQAVLAVCSPGDEVIIPAPFWVSYPEMARIADATPVILPTRISENFLLDPKVLESKLTEKSRLLILCSPSNPTGSVYPKNLLDEIARIVAKHPRLLVLSDEIYEHIIYAPATHTSFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQFTSGASSISQKAGVAALGLGYAGGEVVSKMVKAFRERRDFLVKSFGELEGVKMSEPQGAFYLFIDFSTYYGSEAEGFGKIENSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLTTLQAAVERIKKGLLTLRPGVPV
cccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccHHHHccccccHHHHHHHHHHHHHHccccEEEcccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccccEEEccccHHHHHHHHHHHcccccEEEEcccccccHHHHHHHcccEEEEEcccccccccccHHHHHHHccccccEEEEccccccccccccHHHHHHHHHHHHHcccEEEEEccccccccccccccccccccccccccEEEEccccccccccccccHcccccHHHHHHHHHHHccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccCEEEccccccccccccccccccccHHHHHHHHHHcccEEEEccccccccccEEEEEcccHHHHHHHHHHHHHHHHHccccccc
*************************QIPGSVSFPSRYLHNFNLNKSDRRVLRVMACSGVEEVQ**VSLSPRVNAVKPSKTVAITDQATALAQAGVSVIRLAAGEPDFDTPVLIAEAGINAIREGFTRYTPNAGTLELRSAICHKLKEENGLSYTPDQILVSNGAKQSILQAVLAVCSPGDEVIIPAPFWVSYPEMARIADATPVILPTRISENFLLDPKVLESKLTEKSRLLILCSPSNPTGSVYPKNLLDEIARIVAKHPRLLVLSDEIYEHIIYAPATHTSFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQFTSGASSISQKAGVAALGLGYAGGEVVSKMVKAFRERRDFLVKSFGELEGVKMSEPQGAFYLFIDFSTYYGSEAEGFGKIENSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLTTLQAAVERIKKGLLTLRPG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANSLHSSTSFISNPVNFGHSKIPAQIPGSVSFPSRYLHNFNLNKSDRRVLRVMACSGVEEVQVDVSLSPRVNAVKPSKTVAITDQATALAQAGVSVIRLAAGEPDFDTPVLIAEAGINAIREGFTRYTPNAGTLELRSAICHKLKEENGLSYTPDQILVSNGAKQSILQAVLAVCSPGDEVIIPAPFWVSYPEMARIADATPVILPTRISENFLLDPKVLESKLTEKSRLLILCSPSNPTGSVYPKNLLDEIARIVAKHPRLLVLSDEIYEHIIYAPATHTSFASLPGMWERTLTVNGFSKAFAMTGWRLGYIAGPKHFVAACNKIQSQFTSGASSISQKAGVAALGLGYAGGEVVSKMVKAFRERRDFLVKSFGELEGVKMSEPQGAFYLFIDFSTYYGSEAEGFGKIENSESLCRYLLDKAQVALVPGDAFGDDTCIRISYAASLTTLQAAVERIKKGLLTLRPGVPV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase Prokaryotic-type aspartate aminotransferase. Has also a prenate transaminase activity. Involved in the aromatic amino acids biosynthesis pathway via the arogenate route. Required for the transamination of prephenate into arogenate. Required for early development of the embryo.confidentQ9SIE1
Aspartate aminotransferase Prokaryotic-type aspartate aminotransferase. Specific for aspartate and no activity with glutamine, asparagine, alanine, histidine, leucine, methionine, lysine, arginine, tryptophan, tyrosine, phenylalanine or kynureine.probableQ5F4K8
Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase Prokaryotic-type aspartate aminotransferase. Has also a prenate transaminase activity. Involved in the aromatic amino acids biosynthesis pathway via the arogenate route. Required for the transamination of prephenate into arogenate. Can use 2-oxoglutarate, oxaloacetate and prephenate as substrates, but not phenylpyruvate or 4-hydroxyphenylpyruvate.probableE9L7A5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.6.-.-Transferring nitrogenous groups.probable
2.6.1.-Transaminases (aminotransferases).probable
2.6.1.1Aspartate transaminase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J32, chain A
Confidence level:very confident
Coverage over the Query: 68-465
View the alignment between query and template
View the model in PyMOL