Citrus Sinensis ID: 012130

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470

MASSCSFTSPLCTWLVAACMSFTCGSRDPHQPPSVLRRYTNNKREGLSAARRRKLSAKCGVGGEVVNGSLVSSFSGSSHSIQSLMASCLPFEPCNEYYSSVSSLGFFGDNGFSSFFGSNNSTATLNRRQRRLRLNRVTRSGEAMAVAVQPDEEVTTKKKPHMKQKRVVVTGMGLVSPLGHEPDVFYNNLLEGVSGISEIETFDCTSFPTKIAAEIKSFSTDGWVAPKLSKRMDKFMLYLLTAGKKALADGGITEDVMNELDKSKCGVLIGSGLGGMKVFYDAIEALRISYKKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNFCILNAANHIIRGEANVMLCGGSDAAVIPIGLGGFVACRALSQRNNDPTKASRPWDINRDGFVMGEGAGVLLLEELEHAKKRGAKIYAEFRGGSFTSDAYHMTEPHPDGKSAMSLRLNFSVQMKSLNGFGKFYFISRNR

ccccccccccHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccHHHHHHHcccccccccHHcccccccccccccccccccccccccccHHHHHHHHccccccccccccEEECccccccccccccccccccEEEEcccccccccccHHHHHHHHHcccccccccccccccccccEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccHHHccHHHHHHcHHHHHHHHHHcccccEEEEcccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEccccHHHHcccEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHccccccccccccccccc

********SPLCTWLVAACMSFTCG********************************KCGVGGEVVNGSLVS*****SHSIQSLMASCLPFEPCNEYYSSVSSLGFFGDNGFSSFFG************************************************RVVVTGMGLVSPLGHEPDVFYNNLLEGVSGISEIETFDCTSFPTKIAAEIKSFSTDGWVAPKLSKRMDKFMLYLLTAGKKALADGGITEDVMNELDKSKCGVLIGSGLGGMKVFYDAIEALRISYKKMNPFCVPFATTNMGSAMLAMDLGWMGPNYSISTACATSNFCILNAANHIIRGEANVMLCGGSDAAVIPIGLGGFVACRALSQRNNDPTKASRPWDINRDGFVMGEGAGVLLLEELEHAKKRGAKIYAEFRGGSFTSDAYHMTEPHPDGKSAMSLRLNFSVQMKSLNGFGKFYFI****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic	Essential protein that catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Specific for elongation from C-16 and C-16 to unsaturated C-18 fatty acids. Confers resistance to low temperatures by maintaining chloroplast membranes integrity. Involved in the regulation of fatty acids ratios during seed metabolism. Required for embryo development, especially at the transition from the globular to the heart stage.	probable	Q9C9P4

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1E5M, chain A
Confidence level:very confident
Coverage over the Query: 164-464
View the alignment between query and template
View the model in PyMOL

Template: 2L22, chain A
Confidence level:probable
Coverage over the Query: 74-126
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
2uv9, chain A		very confident	Alignment \| Template Structure