Citrus Sinensis ID: 012136
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 470 | 2.2.26 [Sep-21-2011] | |||||||
| P61872 | 392 | Lipase OS=Rhizopus oryzae | N/A | no | 0.334 | 0.400 | 0.312 | 2e-11 | |
| P61871 | 392 | Lipase OS=Rhizopus niveus | N/A | no | 0.334 | 0.400 | 0.312 | 2e-11 | |
| P19515 | 363 | Lipase OS=Rhizomucor mieh | N/A | no | 0.457 | 0.592 | 0.263 | 5e-11 | |
| Q9P979 | 281 | Feruloyl esterase A OS=As | N/A | no | 0.295 | 0.494 | 0.28 | 7e-10 | |
| Q0CBM7 | 281 | Probable feruloyl esteras | N/A | no | 0.295 | 0.494 | 0.285 | 4e-09 | |
| O42807 | 281 | Feruloyl esterase A OS=As | no | no | 0.297 | 0.498 | 0.260 | 8e-09 | |
| A2QSY5 | 281 | Probable feruloyl esteras | no | no | 0.276 | 0.462 | 0.260 | 1e-08 | |
| O59952 | 291 | Lipase OS=Thermomyces lan | N/A | no | 0.289 | 0.467 | 0.293 | 2e-08 | |
| B8NIB8 | 281 | Probable feruloyl esteras | N/A | no | 0.389 | 0.651 | 0.225 | 2e-07 | |
| O42815 | 280 | Feruloyl esterase A OS=As | N/A | no | 0.310 | 0.521 | 0.256 | 3e-07 |
| >sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 71.2 bits (173), Expect = 2e-11, Method: Compositional matrix adjust.
Identities = 59/189 (31%), Positives = 92/189 (48%), Gaps = 32/189 (16%)
Query: 185 TQAFVLKENRKDDHDRIVVSFRGTETFDADSWCSDFDLSWYEIDGMGKIHGGFMKALGLQ 244
T +VL R D I + FRGT +F + F+ S Y+ K+H GF+ +
Sbjct: 186 TNGYVL---RSDKQKTIYLVFRGTNSFRSAITDIVFNFSDYKPVKGAKVHAGFLSS---- 238
Query: 245 KCKGWPKELNKQDKRPAPLAYYAIRDMLRELLSKNDRAKYIVTGHSLGGALAILFPAVLA 304
+ + +N Y+ + ++E L+ + K IVTGHSLGGA A+L A +
Sbjct: 239 ----YEQVVND---------YFPV---VQEQLTAHPTYKVIVTGHSLGGAQALL--AGMD 280
Query: 305 LHE-ETFLLERLEGVYTFGQPRVGDEKFAEFMQKKLKDHGVEYIRFVYCNDIVPRLPFDD 363
L++ E L + ++T G PRVG+ FA +++ G+ + R V+ DIVP +P
Sbjct: 281 LYQREPRLSPKNLSIFTVGGPRVGNPTFAYYVEST----GIPFQRTVHKRDIVPHVP--P 334
Query: 364 SDFMFKHFG 372
F F H G
Sbjct: 335 QSFGFLHPG 343
|
Hydrolyzes ester bonds of triglycerides as well as of their derived partial glycerides with a strong 1,3-positional specificity. Rhizopus oryzae (taxid: 64495) EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 3 |
| >sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9P979|FAEA_ASPAW Feruloyl esterase A OS=Aspergillus awamori GN=faeA PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q0CBM7|FAEA_ASPTN Probable feruloyl esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|O42807|FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger GN=faeA PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|O42815|FAEA_ASPTU Feruloyl esterase A OS=Aspergillus tubingensis GN=faeA PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 470 | ||||||
| 118485815 | 471 | unknown [Populus trichocarpa] | 0.985 | 0.983 | 0.646 | 1e-180 | |
| 224094312 | 471 | predicted protein [Populus trichocarpa] | 0.985 | 0.983 | 0.642 | 1e-179 | |
| 296082414 | 501 | unnamed protein product [Vitis vinifera] | 0.970 | 0.910 | 0.633 | 1e-173 | |
| 359480805 | 473 | PREDICTED: uncharacterized protein LOC10 | 0.970 | 0.964 | 0.633 | 1e-173 | |
| 296082415 | 520 | unnamed protein product [Vitis vinifera] | 0.978 | 0.884 | 0.627 | 1e-173 | |
| 225438726 | 473 | PREDICTED: uncharacterized protein LOC10 | 0.978 | 0.972 | 0.627 | 1e-173 | |
| 225438724 | 473 | PREDICTED: uncharacterized protein LOC10 | 0.978 | 0.972 | 0.623 | 1e-170 | |
| 359806059 | 477 | uncharacterized protein LOC100795779 [Gl | 0.982 | 0.968 | 0.565 | 1e-160 | |
| 255565202 | 478 | triacylglycerol lipase, putative [Ricinu | 0.961 | 0.945 | 0.567 | 1e-156 | |
| 357482893 | 469 | Lipase [Medicago truncatula] gi|35551306 | 0.974 | 0.976 | 0.559 | 1e-155 |
| >gi|118485815|gb|ABK94755.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 637 bits (1644), Expect = e-180, Method: Compositional matrix adjust.
Identities = 300/464 (64%), Positives = 369/464 (79%), Gaps = 1/464 (0%)
Query: 1 MACDNSFSSSYMLLKPEEVGLFDLFRILFSTNIEKRNFVDSSEKEEKSFGRRWIMFISVV 60
M CD FSSSYMLLKPEE+ FDL ILFST+IEKR FVDS+E +E+ F RRW++FIS++
Sbjct: 1 MDCDKGFSSSYMLLKPEELTFFDLVNILFSTDIEKRKFVDSAEVKEEDFQRRWLIFISII 60
Query: 61 LQKCLQFVAKPMSKYGSALEFFLNLVPSNGGFVELLLNILRGKVVMPDENAACFLSYIGN 120
+QK LQF +KP+S +GS E +LNL+ SNGGF LLLN + GKVV+P++ +A FLS+ GN
Sbjct: 61 VQKLLQFFSKPISFFGSLTEMWLNLLSSNGGFGSLLLNTMEGKVVIPEKTSASFLSFTGN 120
Query: 121 LDKRMELDGSIKHEDERYYWALSMMASKAAYENNAYITNIVENQWKMDFLGSHDYWNEFQ 180
D R ELD +IKH D RYY LS+MASKA+YEN Y+ IV + W+M+ LGS+D+WN++Q
Sbjct: 121 YDLRTELDRNIKHGDPRYYAELSIMASKASYENKEYLETIVNHHWEMELLGSYDFWNDYQ 180
Query: 181 GKATTQAFVLKENRKDDHDRIVVSFRGTETFDADSWCSDFDLSWYEIDGMGKIHGGFMKA 240
KATTQAF+L++ +KDDHD IV++FRGTE FDAD+WCSDFDLSWYEI +G+IHGGFMKA
Sbjct: 181 DKATTQAFLLRD-KKDDHDTIVLAFRGTEPFDADAWCSDFDLSWYEIPDVGRIHGGFMKA 239
Query: 241 LGLQKCKGWPKELNKQDKRPAPLAYYAIRDMLRELLSKNDRAKYIVTGHSLGGALAILFP 300
LGLQKC GWPKE+ + RPAPLAYYA+RD+L+ +LS+ND+ KYIVTGHSLGGALAILFP
Sbjct: 240 LGLQKCLGWPKEMKQNSSRPAPLAYYALRDILKGILSQNDQTKYIVTGHSLGGALAILFP 299
Query: 301 AVLALHEETFLLERLEGVYTFGQPRVGDEKFAEFMQKKLKDHGVEYIRFVYCNDIVPRLP 360
AVLA H+E LL+RL+G+YTFGQPRVGD F ++M+ L+ + + Y RFVY +DIVPRLP
Sbjct: 300 AVLAFHDEKLLLDRLQGIYTFGQPRVGDGNFGKYMENMLEQNTIPYYRFVYGSDIVPRLP 359
Query: 361 FDDSDFMFKHFGKCLYFDRFYEGKVVSEEPNKNYFSQFLATPMRINAIMELIRSFTLPWT 420
+DD MFKHFG CLY++R YE +VV EEPNKNYFS A PM +NA ELIRSFT+ T
Sbjct: 360 YDDKALMFKHFGTCLYYNRNYEVQVVEEEPNKNYFSLRGAIPMMVNAFFELIRSFTISST 419
Query: 421 KGPDYRETWLLRIQRVIGLVTPGISDHTPQDYVNSTRLGSLDAF 464
KG DY+E W LR RV GLV PG+ H QDYVNSTRLGS + F
Sbjct: 420 KGRDYKERWFLRGFRVTGLVLPGVPAHLIQDYVNSTRLGSANVF 463
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224094312|ref|XP_002310137.1| predicted protein [Populus trichocarpa] gi|222853040|gb|EEE90587.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|296082414|emb|CBI21419.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359480805|ref|XP_002277823.2| PREDICTED: uncharacterized protein LOC100259298 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296082415|emb|CBI21420.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225438726|ref|XP_002277782.1| PREDICTED: uncharacterized protein LOC100242185 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225438724|ref|XP_002282593.1| PREDICTED: uncharacterized protein LOC100242257 [Vitis vinifera] gi|296082417|emb|CBI21422.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359806059|ref|NP_001240924.1| uncharacterized protein LOC100795779 [Glycine max] gi|255648036|gb|ACU24474.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255565202|ref|XP_002523593.1| triacylglycerol lipase, putative [Ricinus communis] gi|223537155|gb|EEF38788.1| triacylglycerol lipase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357482893|ref|XP_003611733.1| Lipase [Medicago truncatula] gi|355513068|gb|AES94691.1| Lipase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 470 | ||||||
| TAIR|locus:2155538 | 477 | AT5G67050 [Arabidopsis thalian | 0.959 | 0.945 | 0.540 | 1e-132 | |
| TAIR|locus:2160016 | 467 | AT5G42930 [Arabidopsis thalian | 0.976 | 0.982 | 0.517 | 1.3e-130 | |
| TAIR|locus:1005716681 | 479 | TLL1 "triacylglycerol lipase-l | 0.957 | 0.939 | 0.513 | 3.9e-124 | |
| TAIR|locus:2027584 | 485 | AT1G56630 [Arabidopsis thalian | 0.955 | 0.925 | 0.520 | 8e-124 | |
| TAIR|locus:2091025 | 518 | AT3G14360 [Arabidopsis thalian | 0.782 | 0.710 | 0.428 | 6.7e-100 | |
| TIGR_CMR|BA_5117 | 240 | BA_5117 "lipase family protein | 0.246 | 0.483 | 0.335 | 2.5e-11 | |
| DICTYBASE|DDB_G0291394 | 278 | DDB_G0291394 "Putative lipase | 0.227 | 0.384 | 0.35 | 1.3e-09 | |
| ASPGD|ASPL0000016880 | 294 | AN8046 [Emericella nidulans (t | 0.138 | 0.221 | 0.434 | 2e-09 | |
| TAIR|locus:2204217 | 529 | DLAH "AT1G30370" [Arabidopsis | 0.478 | 0.425 | 0.289 | 7e-09 | |
| TAIR|locus:2140832 | 715 | AT4G13550 [Arabidopsis thalian | 0.344 | 0.226 | 0.301 | 6.3e-07 |
| TAIR|locus:2155538 AT5G67050 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1301 (463.0 bits), Expect = 1.0e-132, P = 1.0e-132
Identities = 249/461 (54%), Positives = 335/461 (72%)
Query: 4 DNSFSSSYMLLKPEEVGLFDLFRILFSTNIEKRNFVDSSEKEEKSFGRRWIMFISVVLQK 63
D+ Y++L+PEE+ ++L R+LFS +IEK VDSSE EE SF RW++F+S+VL K
Sbjct: 6 DDDEPRGYLILRPEELRPWELVRLLFSGDIEKPRSVDSSETEEHSFRHRWLIFVSLVLLK 65
Query: 64 CLQFVAKPMSKYGSALEFFLNLVPSNGGFVELLLNILRGKVVMPDENAACFLSYIGNLDK 123
L+F +K ++ GSALEF LN + SN F L L RG+VVMP + + S+IG+LD
Sbjct: 66 LLRFFSKLLALVGSALEFSLNFL-SNNSFSGLFL---RGEVVMPQRTSENYQSFIGHLDT 121
Query: 124 RMELDGSIKHED-ERYYWALSMMASKAAYENNAYITNIVENQWKMDFLGSHDYWNEFQGK 182
R+ LD ++ ED E+YY ALS+MASK AYEN A I ++VEN W M +LG DYWNE+Q K
Sbjct: 122 RVSLDMTLNREDGEKYYAALSIMASKIAYENAARIKHVVENHWNMKYLGLVDYWNEYQEK 181
Query: 183 ATTQAFVLKEN----RKDDHDR-IVVSFRGTETFDADSWCSDFDLSWYEIDGMGKIHGGF 237
TTQAF++ + R + + +VV+FRGTE F+++ WCSDFD++W+E+ +G IHGGF
Sbjct: 182 ETTQAFIMSTDETTTRSNGQETTVVVAFRGTELFNSEDWCSDFDITWFELPNIGNIHGGF 241
Query: 238 MKALGLQKCKGWPKELNKQDKRPAPLAYYAIRDMLRELLSKNDRAKYIVTGHSLGGALAI 297
MKALGLQ WPKE R +PLAYY+IRD L+ L+++N K+++TGHSLGGALAI
Sbjct: 242 MKALGLQNNCSWPKEPLSNPDRKSPLAYYSIRDSLKTLIAQNKNTKFVLTGHSLGGALAI 301
Query: 298 LFPAVLALHEETFLLERLEGVYTFGQPRVGDEKFAEFMQKKLKDHGVEYIRFVYCNDIVP 357
LF AVL +H ET LLER++GVYT+GQPRVGD KF EFM+KKL+ + ++Y RFVY NDIVP
Sbjct: 302 LFTAVLVIHHETELLERIQGVYTYGQPRVGDSKFGEFMEKKLEKYNIKYYRFVYNNDIVP 361
Query: 358 RLPFDDSDFMFKHFGKCLYFDRFYEGKVVSEEPNKNYFSQFLATPMRINAIMELIRSFTL 417
RLP+DD D MFKHFG C+Y+D+ Y+ KV+ E+ ++N+F M +AI+E IRSFT+
Sbjct: 362 RLPYDDKDLMFKHFGTCIYYDQNYQAKVMREQSDENFFLLRGIIKMMWSAILEFIRSFTI 421
Query: 418 PWTKGPDYRETWLLRIQRVIGLVTPGISDHTPQDYVNSTRL 458
KG +Y E WLL+ R +G++ PG+S+HTPQDYVN+TRL
Sbjct: 422 VAEKGSEYSEGWLLKGGRALGIIVPGVSNHTPQDYVNATRL 462
|
|
| TAIR|locus:2160016 AT5G42930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1005716681 TLL1 "triacylglycerol lipase-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2027584 AT1G56630 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2091025 AT3G14360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_5117 BA_5117 "lipase family protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0291394 DDB_G0291394 "Putative lipase YJR107W" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000016880 AN8046 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2204217 DLAH "AT1G30370" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140832 AT4G13550 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.1 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | gw1.VII.2974.1 | SubName- Full=Putative uncharacterized protein; (453 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 470 | |||
| PLN00413 | 479 | PLN00413, PLN00413, triacylglycerol lipase | 0.0 | |
| PLN02934 | 515 | PLN02934, PLN02934, triacylglycerol lipase | 1e-167 | |
| PLN02162 | 475 | PLN02162, PLN02162, triacylglycerol lipase | 1e-164 | |
| cd00519 | 229 | cd00519, Lipase_3, Lipase (class 3) | 2e-51 | |
| pfam01764 | 141 | pfam01764, Lipase_3, Lipase (class 3) | 9e-34 | |
| cd00741 | 153 | cd00741, Lipase, Lipase | 3e-27 | |
| PLN02310 | 405 | PLN02310, PLN02310, triacylglycerol lipase | 2e-11 | |
| PLN03037 | 525 | PLN03037, PLN03037, lipase class 3 family protein; | 4e-10 | |
| PLN02802 | 509 | PLN02802, PLN02802, triacylglycerol lipase | 4e-09 | |
| PLN02408 | 365 | PLN02408, PLN02408, phospholipase A1 | 4e-07 | |
| PLN02761 | 527 | PLN02761, PLN02761, lipase class 3 family protein | 9e-07 | |
| PLN02753 | 531 | PLN02753, PLN02753, triacylglycerol lipase | 1e-05 | |
| PLN02324 | 415 | PLN02324, PLN02324, triacylglycerol lipase | 2e-05 | |
| PLN02719 | 518 | PLN02719, PLN02719, triacylglycerol lipase | 7e-05 | |
| PLN02571 | 413 | PLN02571, PLN02571, triacylglycerol lipase | 4e-04 | |
| pfam11187 | 224 | pfam11187, DUF2974, Protein of unknown function (D | 0.002 |
| >gnl|CDD|165792 PLN00413, PLN00413, triacylglycerol lipase | Back alignment and domain information |
|---|
Score = 519 bits (1339), Expect = 0.0
Identities = 240/460 (52%), Positives = 323/460 (70%), Gaps = 10/460 (2%)
Query: 10 SYMLLKPEEVGLFDLFRILFSTNIEKRNFVDSSEKEEKS----FGRRWIMFISVVLQKCL 65
+Y +L P E + DL +LFS+++E R F+DSSE+ + F RWI+F+S+V+QK +
Sbjct: 6 NYFVLDPREATVSDLIHLLFSSDLEDRKFIDSSEENIEDDLCEFRGRWIIFVSIVIQKLI 65
Query: 66 QFVAKPMSKYGSALEFFLNLVPSNGGFVELLLNILRGKVVMPDENAACFLSYIGNLDKRM 125
KP+S G AL +LNL+ SNGGF ++ LN+ +G + P++ +A F S GNLD+++
Sbjct: 66 IIFKKPLSFLGFALACWLNLLSSNGGFFKIFLNLFKGNFIWPEKASATFASINGNLDQKV 125
Query: 126 E--LDGSIKHEDERYYWALSMMASKAAYENNAYITNIVENQWKMDFLGSHDYWNEFQGKA 183
E L I+ DERY LS+MASK AYEN +I +++ + WKMD LG + N+F +
Sbjct: 126 ELGLGPKIEIGDERYKALLSIMASKLAYENEHFIRSVLHDHWKMDLLGFYSCPNDFDKQR 185
Query: 184 TTQAFVLKENRKDDHDRIVVSFRGTETFDADSWCSDFDLSWYEIDGMGKIHGGFMKALGL 243
+T+ V+K+ KDD + I+VSFRGT+ FDAD WC+D DLSW+E+ +GKIHGGFMKALGL
Sbjct: 186 STEVIVIKDT-KDDPNLIIVSFRGTDPFDADDWCTDLDLSWHEVKNVGKIHGGFMKALGL 244
Query: 244 QKCKGWPKELNKQDKRPAP--LAYYAIRDMLRELLSKNDRAKYIVTGHSLGGALAILFPA 301
K +GWP+E+N + + A LAYY I L+E+ +N +K+I++GHSLGGALAILF A
Sbjct: 245 PK-EGWPEEINLDETQNATSLLAYYTILRHLKEIFDQNPTSKFILSGHSLGGALAILFTA 303
Query: 302 VLALHEETFLLERLEGVYTFGQPRVGDEKFAEFMQKKLKDHGVEYIRFVYCNDIVPRLPF 361
VL +H+E +LERLEGVYTFGQPRVGDE F FM+ KLK+ V+Y R+VYCND+VPRLPF
Sbjct: 304 VLIMHDEEEMLERLEGVYTFGQPRVGDEDFGIFMKDKLKEFDVKYERYVYCNDMVPRLPF 363
Query: 362 DDSDFMFKHFGKCLYFDRFYEGKVVSEEPNKNYFSQFLATPMRINAIMELIRSFTLPWTK 421
DD MFKHFG CLY D FY+GKV EEPNKNYF+ F P INA+ ELIRSF +P K
Sbjct: 364 DDKTLMFKHFGACLYCDSFYKGKVEEEEPNKNYFNIFWVIPKIINALWELIRSFIIPCWK 423
Query: 422 GPDYRETWLLRIQRVIGLVTPGISDHTPQDYVNSTRLGSL 461
G ++RE W LR R++ L+ PG+ H P +Y+N LG+
Sbjct: 424 GGEFREGWFLRCFRLVALLIPGLPAHFPNEYINVALLGNF 463
|
Length = 479 |
| >gnl|CDD|215504 PLN02934, PLN02934, triacylglycerol lipase | Back alignment and domain information |
|---|
| >gnl|CDD|177821 PLN02162, PLN02162, triacylglycerol lipase | Back alignment and domain information |
|---|
| >gnl|CDD|238287 cd00519, Lipase_3, Lipase (class 3) | Back alignment and domain information |
|---|
| >gnl|CDD|216688 pfam01764, Lipase_3, Lipase (class 3) | Back alignment and domain information |
|---|
| >gnl|CDD|238382 cd00741, Lipase, Lipase | Back alignment and domain information |
|---|
| >gnl|CDD|215176 PLN02310, PLN02310, triacylglycerol lipase | Back alignment and domain information |
|---|
| >gnl|CDD|215547 PLN03037, PLN03037, lipase class 3 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215432 PLN02802, PLN02802, triacylglycerol lipase | Back alignment and domain information |
|---|
| >gnl|CDD|215228 PLN02408, PLN02408, phospholipase A1 | Back alignment and domain information |
|---|
| >gnl|CDD|215406 PLN02761, PLN02761, lipase class 3 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|178354 PLN02753, PLN02753, triacylglycerol lipase | Back alignment and domain information |
|---|
| >gnl|CDD|177958 PLN02324, PLN02324, triacylglycerol lipase | Back alignment and domain information |
|---|
| >gnl|CDD|178321 PLN02719, PLN02719, triacylglycerol lipase | Back alignment and domain information |
|---|
| >gnl|CDD|215309 PLN02571, PLN02571, triacylglycerol lipase | Back alignment and domain information |
|---|
| >gnl|CDD|221019 pfam11187, DUF2974, Protein of unknown function (DUF2974) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 470 | |||
| PLN02162 | 475 | triacylglycerol lipase | 100.0 | |
| PLN00413 | 479 | triacylglycerol lipase | 100.0 | |
| PLN02934 | 515 | triacylglycerol lipase | 100.0 | |
| KOG4569 | 336 | consensus Predicted lipase [Lipid transport and me | 100.0 | |
| PLN02310 | 405 | triacylglycerol lipase | 100.0 | |
| cd00519 | 229 | Lipase_3 Lipase (class 3). Lipases are esterases t | 100.0 | |
| PLN02324 | 415 | triacylglycerol lipase | 100.0 | |
| PLN02454 | 414 | triacylglycerol lipase | 100.0 | |
| PLN02571 | 413 | triacylglycerol lipase | 100.0 | |
| PLN02802 | 509 | triacylglycerol lipase | 100.0 | |
| PLN02719 | 518 | triacylglycerol lipase | 100.0 | |
| PLN02408 | 365 | phospholipase A1 | 100.0 | |
| PLN02753 | 531 | triacylglycerol lipase | 99.98 | |
| PLN03037 | 525 | lipase class 3 family protein; Provisional | 99.98 | |
| PLN02761 | 527 | lipase class 3 family protein | 99.97 | |
| PF01764 | 140 | Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr | 99.96 | |
| PLN02847 | 633 | triacylglycerol lipase | 99.9 | |
| cd00741 | 153 | Lipase Lipase. Lipases are esterases that can hydr | 99.84 | |
| PF11187 | 224 | DUF2974: Protein of unknown function (DUF2974); In | 99.55 | |
| KOG4540 | 425 | consensus Putative lipase essential for disintegra | 99.07 | |
| COG5153 | 425 | CVT17 Putative lipase essential for disintegration | 99.07 | |
| COG3675 | 332 | Predicted lipase [Lipid metabolism] | 98.96 | |
| COG3675 | 332 | Predicted lipase [Lipid metabolism] | 98.55 | |
| PF01083 | 179 | Cutinase: Cutinase; InterPro: IPR000675 Aerial pla | 97.04 | |
| KOG2088 | 596 | consensus Predicted lipase/calmodulin-binding heat | 96.68 | |
| PF07819 | 225 | PGAP1: PGAP1-like protein; InterPro: IPR012908 The | 96.61 | |
| PF05057 | 217 | DUF676: Putative serine esterase (DUF676); InterPr | 95.8 | |
| PF00561 | 230 | Abhydrolase_1: alpha/beta hydrolase fold A web pag | 95.6 | |
| PLN02733 | 440 | phosphatidylcholine-sterol O-acyltransferase | 95.53 | |
| PF06259 | 177 | Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR | 95.34 | |
| PF12697 | 228 | Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 | 95.25 | |
| KOG2564 | 343 | consensus Predicted acetyltransferases and hydrola | 95.18 | |
| PF00975 | 229 | Thioesterase: Thioesterase domain; InterPro: IPR00 | 94.73 | |
| TIGR02427 | 251 | protocat_pcaD 3-oxoadipate enol-lactonase. Members | 94.71 | |
| PLN02965 | 255 | Probable pheophorbidase | 94.67 | |
| PRK11126 | 242 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl | 94.65 | |
| PRK10985 | 324 | putative hydrolase; Provisional | 94.6 | |
| PLN02824 | 294 | hydrolase, alpha/beta fold family protein | 94.57 | |
| PHA02857 | 276 | monoglyceride lipase; Provisional | 94.49 | |
| PF02450 | 389 | LCAT: Lecithin:cholesterol acyltransferase; InterP | 94.47 | |
| TIGR03695 | 251 | menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene | 94.33 | |
| PRK10673 | 255 | acyl-CoA esterase; Provisional | 94.25 | |
| TIGR03343 | 282 | biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die | 94.12 | |
| TIGR01838 | 532 | PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, | 94.01 | |
| PF05277 | 345 | DUF726: Protein of unknown function (DUF726); Inte | 93.99 | |
| PRK11071 | 190 | esterase YqiA; Provisional | 93.99 | |
| PF11288 | 207 | DUF3089: Protein of unknown function (DUF3089); In | 93.92 | |
| PLN02298 | 330 | hydrolase, alpha/beta fold family protein | 93.82 | |
| PF05990 | 233 | DUF900: Alpha/beta hydrolase of unknown function ( | 93.81 | |
| TIGR01607 | 332 | PST-A Plasmodium subtelomeric family (PST-A). Thes | 93.53 | |
| TIGR03611 | 257 | RutD pyrimidine utilization protein D. This protei | 93.51 | |
| TIGR01836 | 350 | PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth | 93.51 | |
| COG3208 | 244 | GrsT Predicted thioesterase involved in non-riboso | 93.43 | |
| TIGR02240 | 276 | PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer | 93.42 | |
| PRK10749 | 330 | lysophospholipase L2; Provisional | 93.41 | |
| cd00707 | 275 | Pancreat_lipase_like Pancreatic lipase-like enzyme | 93.4 | |
| PLN02511 | 388 | hydrolase | 93.39 | |
| TIGR01250 | 288 | pro_imino_pep_2 proline-specific peptidases, Bacil | 93.28 | |
| PRK03592 | 295 | haloalkane dehalogenase; Provisional | 93.19 | |
| PRK00870 | 302 | haloalkane dehalogenase; Provisional | 93.14 | |
| COG2267 | 298 | PldB Lysophospholipase [Lipid metabolism] | 93.02 | |
| TIGR03056 | 278 | bchO_mg_che_rel putative magnesium chelatase acces | 92.84 | |
| TIGR03101 | 266 | hydr2_PEP hydrolase, ortholog 2, exosortase system | 92.55 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 92.52 | |
| PF06028 | 255 | DUF915: Alpha/beta hydrolase of unknown function ( | 92.34 | |
| PF00326 | 213 | Peptidase_S9: Prolyl oligopeptidase family This fa | 92.1 | |
| PLN02211 | 273 | methyl indole-3-acetate methyltransferase | 91.82 | |
| TIGR01392 | 351 | homoserO_Ac_trn homoserine O-acetyltransferase. Th | 91.79 | |
| PLN02652 | 395 | hydrolase; alpha/beta fold family protein | 91.77 | |
| PLN02385 | 349 | hydrolase; alpha/beta fold family protein | 91.75 | |
| PRK03204 | 286 | haloalkane dehalogenase; Provisional | 91.71 | |
| TIGR03100 | 274 | hydr1_PEP hydrolase, ortholog 1, exosortase system | 91.55 | |
| PF03959 | 212 | FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 | 91.48 | |
| COG4782 | 377 | Uncharacterized protein conserved in bacteria [Fun | 91.42 | |
| PF05728 | 187 | UPF0227: Uncharacterised protein family (UPF0227); | 91.41 | |
| PLN02679 | 360 | hydrolase, alpha/beta fold family protein | 91.38 | |
| TIGR01249 | 306 | pro_imino_pep_1 proline iminopeptidase, Neisseria- | 91.2 | |
| KOG1455 | 313 | consensus Lysophospholipase [Lipid transport and m | 90.94 | |
| PRK10566 | 249 | esterase; Provisional | 90.82 | |
| PLN03087 | 481 | BODYGUARD 1 domain containing hydrolase; Provision | 90.72 | |
| COG3319 | 257 | Thioesterase domains of type I polyketide synthase | 90.66 | |
| PLN02517 | 642 | phosphatidylcholine-sterol O-acyltransferase | 90.62 | |
| PF12695 | 145 | Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 | 90.4 | |
| PF07859 | 211 | Abhydrolase_3: alpha/beta hydrolase fold A web pag | 90.39 | |
| TIGR01840 | 212 | esterase_phb esterase, PHB depolymerase family. Th | 90.33 | |
| TIGR02821 | 275 | fghA_ester_D S-formylglutathione hydrolase. This m | 90.11 | |
| PRK10349 | 256 | carboxylesterase BioH; Provisional | 90.08 | |
| TIGR01738 | 245 | bioH putative pimeloyl-BioC--CoA transferase BioH. | 89.97 | |
| PRK13604 | 307 | luxD acyl transferase; Provisional | 89.71 | |
| PLN02894 | 402 | hydrolase, alpha/beta fold family protein | 89.32 | |
| PF10503 | 220 | Esterase_phd: Esterase PHB depolymerase | 89.25 | |
| PLN02578 | 354 | hydrolase | 88.87 | |
| PRK08775 | 343 | homoserine O-acetyltransferase; Provisional | 88.81 | |
| PLN02442 | 283 | S-formylglutathione hydrolase | 88.8 | |
| PRK06489 | 360 | hypothetical protein; Provisional | 88.37 | |
| KOG3724 | 973 | consensus Negative regulator of COPII vesicle form | 87.89 | |
| KOG1454 | 326 | consensus Predicted hydrolase/acyltransferase (alp | 87.67 | |
| PF05677 | 365 | DUF818: Chlamydia CHLPS protein (DUF818); InterPro | 87.54 | |
| PRK00175 | 379 | metX homoserine O-acetyltransferase; Provisional | 87.09 | |
| PRK11460 | 232 | putative hydrolase; Provisional | 86.9 | |
| KOG2088 | 596 | consensus Predicted lipase/calmodulin-binding heat | 86.79 | |
| KOG4409 | 365 | consensus Predicted hydrolase/acyltransferase (alp | 86.53 | |
| PRK10162 | 318 | acetyl esterase; Provisional | 86.41 | |
| PRK05077 | 414 | frsA fermentation/respiration switch protein; Revi | 86.32 | |
| PLN00021 | 313 | chlorophyllase | 86.32 | |
| PF08237 | 225 | PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum | 85.2 | |
| PRK07581 | 339 | hypothetical protein; Validated | 85.1 | |
| TIGR03230 | 442 | lipo_lipase lipoprotein lipase. Members of this pr | 84.91 | |
| PF06342 | 297 | DUF1057: Alpha/beta hydrolase of unknown function | 84.6 | |
| COG3545 | 181 | Predicted esterase of the alpha/beta hydrolase fol | 84.24 | |
| COG3571 | 213 | Predicted hydrolase of the alpha/beta-hydrolase fo | 84.23 | |
| PF00151 | 331 | Lipase: Lipase; InterPro: IPR013818 Triglyceride l | 84.0 | |
| PLN03084 | 383 | alpha/beta hydrolase fold protein; Provisional | 83.92 | |
| COG0596 | 282 | MhpC Predicted hydrolases or acyltransferases (alp | 83.89 | |
| PRK06765 | 389 | homoserine O-acetyltransferase; Provisional | 83.55 | |
| TIGR01839 | 560 | PHA_synth_II poly(R)-hydroxyalkanoic acid synthase | 83.38 | |
| KOG4372 | 405 | consensus Predicted alpha/beta hydrolase [General | 83.34 | |
| PLN02872 | 395 | triacylglycerol lipase | 82.88 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 82.76 | |
| KOG2369 | 473 | consensus Lecithin:cholesterol acyltransferase (LC | 82.57 | |
| PTZ00472 | 462 | serine carboxypeptidase (CBP1); Provisional | 82.36 | |
| smart00824 | 212 | PKS_TE Thioesterase. Peptide synthetases are invol | 81.9 | |
| PF05448 | 320 | AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 | 81.82 | |
| COG1075 | 336 | LipA Predicted acetyltransferases and hydrolases w | 80.41 |
| >PLN02162 triacylglycerol lipase | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.2e-132 Score=1026.71 Aligned_cols=457 Identities=51% Similarity=0.934 Sum_probs=429.4
Q ss_pred CCCCCceEEeccCCcChhhHHHhhhccCccccccccCCh-hhhcccC----cchhHHHHHHHHHHHHHhhchhHhhhHHH
Q 012136 5 NSFSSSYMLLKPEEVGLFDLFRILFSTNIEKRNFVDSSE-KEEKSFG----RRWIMFISVVLQKCLQFVAKPMSKYGSAL 79 (470)
Q Consensus 5 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~----~~~~~~~~~~~~~~l~~~~~~~~~~g~~~ 79 (470)
.+|++|||||||||++++||+++||++|+++++|||||+ + +++++ +||+||+|+++||+|+++++||+++|.++
T Consensus 1 ~~f~~~~~~~~p~~~~~~~l~~~l~~~~~~~~~~~~~~~~~-~~~~~~~~~~rw~i~~s~~~~~~l~~~~~p~~~~g~~~ 79 (475)
T PLN02162 1 MKFCNSYFLVDPTKASFLDLLLLLFSFNLTSARFIDSPPDT-LKGFRRSFASRWILALAIFLQKVLMLLSKPFAFIGQKL 79 (475)
T ss_pred CCcccCeEEeccCcCCHHHHHHHHhccccCCCceeeCCccc-chhhccCcccchHHHHHHHHHHHHHHHhhHHHHHHHHH
Confidence 379999999999999999999999999999999999999 7 44444 59999999999999999999999999999
Q ss_pred HHHHhhcccCCChHHHHHHhhcceEEecCCCCCcccccccccccccccCCCCCCCCHHHHHHHHHHHHHHhhcChhhhhH
Q 012136 80 EFFLNLVPSNGGFVELLLNILRGKVVMPDENAACFLSYIGNLDKRMELDGSIKHEDERYYWALSMMASKAAYENNAYITN 159 (470)
Q Consensus 80 e~~ln~~~~ngg~~~~~~~~~~g~~~~p~~~s~~f~s~~g~id~r~~l~~~~~~~d~~~~~~l~~maS~lAYe~~~~i~~ 159 (470)
||||||+++|||+++|++|+++||+++|+++|+||+||||++|.|+||+++++++|++|.++||+||||+||||++++++
T Consensus 80 e~~lnl~~~n~g~~~~~~~~l~g~~~~p~~~s~~~~s~ig~~d~r~~l~~~~~~~~~~~~~~l~ima~klayen~~~i~~ 159 (475)
T PLN02162 80 TYWLNLLTANGGFFNLILNLLSGKLVKPDKSSATYTSFIGCSDRRIELDEKIDVGSIEYKSMLSIMASKISYESKPFINS 159 (475)
T ss_pred HHHHHHHHhcCChHHHHHHHhcCceeccCCCCccHHhHhhcccccccccccCCcccchhHHHHHHHHHHHhhcCHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhcccccccccccccccccCCCCCcEEEEEEeCCcCCCCEEEEEEcCCCcCCcccHHhhccccccccCCCceechhHHH
Q 012136 160 IVENQWKMDFLGSHDYWNEFQGKATTQAFVLKENRKDDHDRIVVSFRGTETFDADSWCSDFDLSWYEIDGMGKIHGGFMK 239 (470)
Q Consensus 160 ~v~~~W~m~~~~~~~~~n~~~~~~~t~afv~~d~~~~~~~~IVVaFRGT~~~s~~Dw~tDl~~~~~~~~~~G~VH~GF~~ 239 (470)
+|+++|+|+++++|+|||++|++.+||+|++.| +.++++.||||||||++++..||+||+++.++++++.|+||.||++
T Consensus 160 ~v~~~w~m~~v~~y~~wn~~~~~~~TQafv~~d-~~~d~~~IVVAFRGT~~~~~~DWiTDld~s~~~~~~~GkVH~GF~~ 238 (475)
T PLN02162 160 VVKNTWKMDLVGNYDFYNAFQESKLTQAFVFKT-SSTNPDLIVVSFRGTEPFEAADWCTDLDLSWYELKNVGKVHAGFSR 238 (475)
T ss_pred HHHHhcCccccchhhhhhhhhhhcccceEEEEe-ccCCCceEEEEEccCCCCcHHHHHhhcCcceecCCCCeeeeHHHHH
Confidence 999999999999999999999999999999999 7778899999999999988999999999999999999999999999
Q ss_pred HhhhhhccCCCcccccCCCCCChhHHHHHHHHHHHHHHhCCCCceEEeccChhHHHHHHHHHHHHhchhhhhhcccceEE
Q 012136 240 ALGLQKCKGWPKELNKQDKRPAPLAYYAIRDMLRELLSKNDRAKYIVTGHSLGGALAILFPAVLALHEETFLLERLEGVY 319 (470)
Q Consensus 240 a~~~~~~~~w~~~~~~~~~~~~~~ay~~i~~~l~~ll~~~~~~~l~vTGHSLGGALA~L~aa~L~~~~~~~~~~~~~~vy 319 (470)
|++.+++.+||.+ ..+..+..+|+++++.++++++++|+++++|||||||||||+|+|+.+..+++..+.+++..+|
T Consensus 239 A~~~~~~~~~p~~---~~~~~~~~ay~~I~~~L~~lL~k~p~~kliVTGHSLGGALAtLaAa~L~~~~~~~l~~~~~~vY 315 (475)
T PLN02162 239 ALGLQKDGGWPKE---NISLLHQYAYYTIRQMLRDKLARNKNLKYILTGHSLGGALAALFPAILAIHGEDELLDKLEGIY 315 (475)
T ss_pred HHHhhhccccccc---ccchhhhhhHHHHHHHHHHHHHhCCCceEEEEecChHHHHHHHHHHHHHHccccccccccceEE
Confidence 9998888789875 2233455789999999999999999999999999999999999999998877655555667899
Q ss_pred EecCCccCCHHHHHHHHHhhcCCCceEEEEEeCCCcCCCCCCCCC-CCCeeecceEEEEcCCCCceecccCCCCCccccc
Q 012136 320 TFGQPRVGDEKFAEFMQKKLKDHGVEYIRFVYCNDIVPRLPFDDS-DFMFKHFGKCLYFDRFYEGKVVSEEPNKNYFSQF 398 (470)
Q Consensus 320 TFG~PRVGd~~fa~~~~~~l~~~~~~~~RvV~~~DiVPrlP~~~~-~~~f~H~G~~v~~~~~~~~~~~~e~p~~~y~s~~ 398 (470)
|||||||||++|++++++.++....+++||||++|+|||+|+++. .++|+|+|+|+|+++.|++++++||||+||||+.
T Consensus 316 TFGqPRVGn~~FA~~~~~~~~~~~~~~~RvVn~nDiVPrlP~~~~~~~gY~H~G~c~y~~s~y~~~~~~e~p~~n~f~~~ 395 (475)
T PLN02162 316 TFGQPRVGDEDFGEFMKGVVKKHGIEYERFVYNNDVVPRVPFDDKLLFSYKHYGPCNSFNSLYKGKVREDAPNANYFNLL 395 (475)
T ss_pred EeCCCCccCHHHHHHHHhhhhcCCCceEEEEeCCCcccccCCCCcccceeEECCccceeecccCCeecccCCCCCcccHH
Confidence 999999999999999998766555678999999999999999854 3579999999999999999999999999999999
Q ss_pred cccchhhHHHHHHHHhcccccccCCCcchhHHHHHHHHhhccCCCCCCCChhhhHhhhhcCCCCcccc
Q 012136 399 LATPMRINAIMELIRSFTLPWTKGPDYRETWLLRIQRVIGLVTPGISDHTPQDYVNSTRLGSLDAFSH 466 (470)
Q Consensus 399 ~~i~~~~~a~~e~~rs~~~~~~~g~~~~e~~~~~~~r~~~l~~pgl~~H~p~~Yv~a~~lg~~~~~~~ 466 (470)
++||+++||+||++|||+++|++|++|+|||+++++|++||++|||++|+|+|||||+|||++.+.+.
T Consensus 396 ~~i~~~~~a~wel~r~~~~~~~~g~~y~e~w~~~~~r~~gl~~pg~~~h~p~dyvn~~rlg~~~~~~~ 463 (475)
T PLN02162 396 WLIPQLLTGLWEFIRSFILQFWKGDEYKENWLMRFVRVVGIVFPGGSNHFPFDYVNSTRLGGLVRPPP 463 (475)
T ss_pred HHHHHHHHHHHHHHHHheeecccCcccchhHHHHHHHHHHHhcCCCccCCcchhhcceeecccccCcc
Confidence 99999999999999999999999999999999999999999999999999999999999999877653
|
|
| >PLN00413 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02934 triacylglycerol lipase | Back alignment and domain information |
|---|
| >KOG4569 consensus Predicted lipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02310 triacylglycerol lipase | Back alignment and domain information |
|---|
| >cd00519 Lipase_3 Lipase (class 3) | Back alignment and domain information |
|---|
| >PLN02324 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02454 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02571 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02802 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02719 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02408 phospholipase A1 | Back alignment and domain information |
|---|
| >PLN02753 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN03037 lipase class 3 family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02761 lipase class 3 family protein | Back alignment and domain information |
|---|
| >PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] | Back alignment and domain information |
|---|
| >PLN02847 triacylglycerol lipase | Back alignment and domain information |
|---|
| >cd00741 Lipase Lipase | Back alignment and domain information |
|---|
| >PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] | Back alignment and domain information |
|---|
| >COG3675 Predicted lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG3675 Predicted lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] | Back alignment and domain information |
|---|
| >KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases | Back alignment and domain information |
|---|
| >PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PLN02733 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria | Back alignment and domain information |
|---|
| >PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A | Back alignment and domain information |
|---|
| >KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] | Back alignment and domain information |
|---|
| >TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >PLN02965 Probable pheophorbidase | Back alignment and domain information |
|---|
| >PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK10985 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02824 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PHA02857 monoglyceride lipase; Provisional | Back alignment and domain information |
|---|
| >PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 | Back alignment and domain information |
|---|
| >TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PRK10673 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I | Back alignment and domain information |
|---|
| >PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins | Back alignment and domain information |
|---|
| >PRK11071 esterase YqiA; Provisional | Back alignment and domain information |
|---|
| >PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PLN02298 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) | Back alignment and domain information |
|---|
| >TIGR03611 RutD pyrimidine utilization protein D | Back alignment and domain information |
|---|
| >TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit | Back alignment and domain information |
|---|
| >COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >PRK10749 lysophospholipase L2; Provisional | Back alignment and domain information |
|---|
| >cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes | Back alignment and domain information |
|---|
| >PLN02511 hydrolase | Back alignment and domain information |
|---|
| >TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >PRK03592 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00870 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >COG2267 PldB Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification | Back alignment and domain information |
|---|
| >PLN02211 methyl indole-3-acetate methyltransferase | Back alignment and domain information |
|---|
| >TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase | Back alignment and domain information |
|---|
| >PLN02652 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN02385 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK03204 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family | Back alignment and domain information |
|---|
| >COG4782 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO | Back alignment and domain information |
|---|
| >PLN02679 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily | Back alignment and domain information |
|---|
| >KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10566 esterase; Provisional | Back alignment and domain information |
|---|
| >PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02517 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A | Back alignment and domain information |
|---|
| >PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >TIGR01840 esterase_phb esterase, PHB depolymerase family | Back alignment and domain information |
|---|
| >TIGR02821 fghA_ester_D S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PRK10349 carboxylesterase BioH; Provisional | Back alignment and domain information |
|---|
| >TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH | Back alignment and domain information |
|---|
| >PRK13604 luxD acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02894 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PF10503 Esterase_phd: Esterase PHB depolymerase | Back alignment and domain information |
|---|
| >PLN02578 hydrolase | Back alignment and domain information |
|---|
| >PRK08775 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02442 S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PRK06489 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins | Back alignment and domain information |
|---|
| >PRK00175 metX homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11460 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10162 acetyl esterase; Provisional | Back alignment and domain information |
|---|
| >PRK05077 frsA fermentation/respiration switch protein; Reviewed | Back alignment and domain information |
|---|
| >PLN00021 chlorophyllase | Back alignment and domain information |
|---|
| >PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) | Back alignment and domain information |
|---|
| >PRK07581 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03230 lipo_lipase lipoprotein lipase | Back alignment and domain information |
|---|
| >PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold | Back alignment and domain information |
|---|
| >COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 | Back alignment and domain information |
|---|
| >PLN03084 alpha/beta hydrolase fold protein; Provisional | Back alignment and domain information |
|---|
| >COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06765 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II | Back alignment and domain information |
|---|
| >KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02872 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00472 serine carboxypeptidase (CBP1); Provisional | Back alignment and domain information |
|---|
| >smart00824 PKS_TE Thioesterase | Back alignment and domain information |
|---|
| >PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins | Back alignment and domain information |
|---|
| >COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 470 | ||||
| 1tic_A | 269 | Conformational Lability Of Lipases Observed In The | 2e-12 | ||
| 3tgl_A | 269 | Structure And Molecular Model Refinement Of Rhizomu | 6e-11 | ||
| 1tgl_A | 269 | A Serine Protease Triad Forms The Catalytic Centre | 6e-11 | ||
| 4tgl_A | 269 | Catalysis At The Interface: The Anatomy Of A Confor | 6e-11 | ||
| 5tgl_A | 269 | A Model For Interfacial Activation In Lipases From | 7e-11 | ||
| 1usw_A | 260 | Crystal Structure Of Ferulic Acid Esterase From Asp | 6e-10 | ||
| 2hl6_A | 260 | Structure Of Homologously Expressed Ferrulate Ester | 1e-09 | ||
| 1uwc_A | 261 | Feruloyl Esterase From Aspergillus Niger Length = 2 | 1e-09 | ||
| 2bjh_A | 260 | Crystal Structure Of S133a Anfaea-Ferulic Acid Comp | 1e-09 | ||
| 1dt3_A | 269 | The Structural Origins Of Interfacial Activation In | 2e-09 | ||
| 1gt6_A | 269 | S146a Mutant Of Thermomyces (Humicola) Lanuginosa L | 4e-09 | ||
| 1tia_A | 279 | An Unusual Buried Polar Cluster In A Family Of Fung | 2e-07 | ||
| 3ngm_A | 319 | Crystal Structure Of Lipase From Gibberella Zeae Le | 1e-06 | ||
| 3o0d_A | 301 | Crystal Structure Of Lip2 Lipase From Yarrowia Lipo | 4e-05 | ||
| 2yij_A | 419 | Crystal Structure Of Phospholipase A1 Length = 419 | 2e-04 | ||
| 3uuf_A | 278 | Crystal Structure Of Mono- And Diacylglycerol Lipas | 5e-04 | ||
| 3uue_A | 279 | Crystal Structure Of Mono- And Diacylglycerol Lipas | 5e-04 | ||
| 2ory_A | 346 | Crystal Structure Of M37 Lipase Length = 346 | 9e-04 |
| >pdb|1TIC|A Chain A, Conformational Lability Of Lipases Observed In The Absence Of An Oil-Water Interface: Crystallographic Studies Of Enzymes From The Fungi Humicola Lanuginosa And Rhizopus Delemar Length = 269 | Back alignment and structure |
|
| >pdb|3TGL|A Chain A, Structure And Molecular Model Refinement Of Rhizomucor Miehei Triacylglyceride Lipase: A Case Study Of The Use Of Simulated Annealing In Partial Model Refinement Length = 269 | Back alignment and structure |
| >pdb|1TGL|A Chain A, A Serine Protease Triad Forms The Catalytic Centre Of A Triacylglycerol Lipase Length = 269 | Back alignment and structure |
| >pdb|4TGL|A Chain A, Catalysis At The Interface: The Anatomy Of A Conformational Change In A Triglyceride Lipase Length = 269 | Back alignment and structure |
| >pdb|5TGL|A Chain A, A Model For Interfacial Activation In Lipases From The Structure Of A Fungal Lipase-Inhibitor Complex Length = 269 | Back alignment and structure |
| >pdb|1USW|A Chain A, Crystal Structure Of Ferulic Acid Esterase From Aspergillus Niger Length = 260 | Back alignment and structure |
| >pdb|2HL6|A Chain A, Structure Of Homologously Expressed Ferrulate Esterase Of Aspergillus Niger In Complex With Caps Length = 260 | Back alignment and structure |
| >pdb|1UWC|A Chain A, Feruloyl Esterase From Aspergillus Niger Length = 261 | Back alignment and structure |
| >pdb|2BJH|A Chain A, Crystal Structure Of S133a Anfaea-Ferulic Acid Complex Length = 260 | Back alignment and structure |
| >pdb|1DT3|A Chain A, The Structural Origins Of Interfacial Activation In Thermomyces (Humicola) Lanuginosa Lipase Length = 269 | Back alignment and structure |
| >pdb|1GT6|A Chain A, S146a Mutant Of Thermomyces (Humicola) Lanuginosa Lipase Complex With Oleic Acid Length = 269 | Back alignment and structure |
| >pdb|1TIA|A Chain A, An Unusual Buried Polar Cluster In A Family Of Fungal Lipases Length = 279 | Back alignment and structure |
| >pdb|3NGM|A Chain A, Crystal Structure Of Lipase From Gibberella Zeae Length = 319 | Back alignment and structure |
| >pdb|3O0D|A Chain A, Crystal Structure Of Lip2 Lipase From Yarrowia Lipolytica At 1.7 A Resolution Length = 301 | Back alignment and structure |
| >pdb|2YIJ|A Chain A, Crystal Structure Of Phospholipase A1 Length = 419 | Back alignment and structure |
| >pdb|3UUF|A Chain A, Crystal Structure Of Mono- And Diacylglycerol Lipase From Malassezia Globosa Length = 278 | Back alignment and structure |
| >pdb|3UUE|A Chain A, Crystal Structure Of Mono- And Diacylglycerol Lipase From Malassezia Globosa Length = 279 | Back alignment and structure |
| >pdb|2ORY|A Chain A, Crystal Structure Of M37 Lipase Length = 346 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Length = 346 | Back alignment and structure |
|---|
Score = 182 bits (462), Expect = 1e-53
Identities = 62/321 (19%), Positives = 99/321 (30%), Gaps = 40/321 (12%)
Query: 115 LSYIGNLDKRMELDGSIKHEDERYYWALSMMASKAAYENNAYITNIVENQWKMDFLGSHD 174
SY+ G + L + K A + + W++ + G
Sbjct: 12 FSYMSYY-------GITHTGSAKKNAELILKKMKEALKTWKPFQE---DDWEVVW-GPAV 60
Query: 175 YWNEFQGKATTQAFVLKENRKDDHDRIVVSFRGTETFDADSWCSDF-----DLSWYEI-- 227
Y F +V++ +K V++ RGT W + W
Sbjct: 61 YTMPFTIFNDAMMYVIQ--KKGAEGEYVIAIRGTNPVSISDWLFNDFMVSAMKKWPYASV 118
Query: 228 -DGMGKIHGGFMKALGLQKCKGWPKELNKQDKRPAPLAYYAIRDMLRELLSKNDRAKYIV 286
+ KI L + + K P I L E + +AK V
Sbjct: 119 EGRILKISESTSYGLKTLQ--------KLKPKSHIPGENKTILQFLNEKIGPEGKAKICV 170
Query: 287 TGHSLGGALAILFPAVLALHEETFLLERLE-GVYTFGQPRVGDEKFAEFMQKKLKDHGVE 345
TGHS GGAL+ L + L + ++ F P G+ FA++ L D
Sbjct: 171 TGHSKGGALSSTLALWLKDIQGVKLSQNIDISTIPFAGPTAGNADFADYFDDCLGDQ--- 227
Query: 346 YIRFVYCNDIVPRLPFDDSDFMFKHF-------GKCLYFDRFYEGKVVSEEPNKNYFSQF 398
R DIVP +S K K L + R +++E K Y
Sbjct: 228 CTRIANSLDIVPYAWNTNSLKKLKSIYISEQASVKPLLYQRALIRAMIAETKGKKYKQIK 287
Query: 399 LATPMRINAIMELIRSFTLPW 419
TP I ++ + +
Sbjct: 288 AETPPLEGNINPILIEYLVQA 308
|
| >2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Length = 419 | Back alignment and structure |
|---|
| >3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Length = 279 | Back alignment and structure |
|---|
| >1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Length = 269 | Back alignment and structure |
|---|
| >1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Length = 261 | Back alignment and structure |
|---|
| >1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Length = 269 | Back alignment and structure |
|---|
| >1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Length = 269 | Back alignment and structure |
|---|
| >3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Length = 319 | Back alignment and structure |
|---|
| >3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} Length = 301 | Back alignment and structure |
|---|
| >1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Length = 279 | Back alignment and structure |
|---|
| >3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Length = 258 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 470 | |||
| 3g7n_A | 258 | Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A | 100.0 | |
| 3uue_A | 279 | LIP1, secretory lipase (family 3); LID-domain, hyd | 100.0 | |
| 3o0d_A | 301 | YALI0A20350P, triacylglycerol lipase; alpha/beta-h | 100.0 | |
| 3ngm_A | 319 | Extracellular lipase; secret lipase, hydrolase; 2. | 100.0 | |
| 1uwc_A | 261 | Feruloyl esterase A; hydrolase, serine esterase, x | 100.0 | |
| 1lgy_A | 269 | Lipase, triacylglycerol lipase; hydrolase (carboxy | 100.0 | |
| 1tia_A | 279 | Lipase; hydrolase(carboxylic esterase); 2.10A {Pen | 100.0 | |
| 1tib_A | 269 | Lipase; hydrolase(carboxylic esterase); 1.84A {The | 100.0 | |
| 2yij_A | 419 | Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid | 100.0 | |
| 1tgl_A | 269 | Triacyl-glycerol acylhydrolase; carboxylic esteras | 99.98 | |
| 2ory_A | 346 | Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph | 99.96 | |
| 2qub_A | 615 | Extracellular lipase; beta roll, alpha/beta hydrol | 97.46 | |
| 3qpd_A | 187 | Cutinase 1; alpha-beta hydrolase fold, esterase, h | 96.58 | |
| 3qpa_A | 197 | Cutinase; alpha-beta hydrolase fold, esterase, hyd | 96.53 | |
| 1qoz_A | 207 | AXE, acetyl xylan esterase; hydrolase, xylan degra | 96.4 | |
| 3dcn_A | 201 | Cutinase, cutin hydrolase; catalytic triad, secret | 96.35 | |
| 1g66_A | 207 | Acetyl xylan esterase II; serine hydrolase, acetyl | 96.32 | |
| 2z8x_A | 617 | Lipase; beta roll, calcium binding protein, RTX pr | 96.31 | |
| 3lp5_A | 250 | Putative cell surface hydrolase; structural genom | 96.3 | |
| 2czq_A | 205 | Cutinase-like protein; alpha/beta hydrolase fold, | 96.16 | |
| 3fle_A | 249 | SE_1780 protein; structural genomics, APC61035.1, | 96.05 | |
| 3h04_A | 275 | Uncharacterized protein; protein with unknown func | 96.05 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 95.99 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 95.94 | |
| 3pe6_A | 303 | Monoglyceride lipase; alpha-beta hydrolase fold, 2 | 95.85 | |
| 3u0v_A | 239 | Lysophospholipase-like protein 1; alpha, beta hydr | 95.85 | |
| 3ds8_A | 254 | LIN2722 protein; unkonwn function, structural geno | 95.83 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 95.72 | |
| 3ibt_A | 264 | 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, | 95.71 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 95.7 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 95.68 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 95.64 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 95.63 | |
| 4fle_A | 202 | Esterase; structural genomics, PSI-biology, northe | 95.62 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 95.61 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 95.6 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 95.6 | |
| 3c6x_A | 257 | Hydroxynitrilase; atomic resolution, hydroxynitril | 95.55 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 95.54 | |
| 3bdv_A | 191 | Uncharacterized protein DUF1234; DUF1234 family pr | 95.54 | |
| 3hc7_A | 254 | Gene 12 protein, GP12; alpha/beta sandwich, cell a | 95.52 | |
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 95.5 | |
| 1pja_A | 302 | Palmitoyl-protein thioesterase 2 precursor; hydrol | 95.48 | |
| 2fuk_A | 220 | XC6422 protein; A/B hydrolase, structural genomics | 95.48 | |
| 1azw_A | 313 | Proline iminopeptidase; aminopeptidase, serine pro | 95.47 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 95.47 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 95.47 | |
| 3llc_A | 270 | Putative hydrolase; structural genomics, joint cen | 95.47 | |
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 95.45 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 95.43 | |
| 1wm1_A | 317 | Proline iminopeptidase; complex with inhibitor, hy | 95.43 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 95.41 | |
| 2x5x_A | 342 | PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE | 95.38 | |
| 3sty_A | 267 | Methylketone synthase 1; alpha/beta hydrolase, dec | 95.38 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 95.38 | |
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 95.37 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 95.34 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 95.32 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 95.26 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 95.26 | |
| 3ils_A | 265 | PKS, aflatoxin biosynthesis polyketide synthase; A | 95.26 | |
| 1xkl_A | 273 | SABP2, salicylic acid-binding protein 2; alpha-bet | 95.25 | |
| 2wfl_A | 264 | Polyneuridine-aldehyde esterase; alkaloid metaboli | 95.24 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 95.23 | |
| 3dqz_A | 258 | Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl | 95.19 | |
| 1ex9_A | 285 | Lactonizing lipase; alpha-beta hydrolase fold, pho | 95.18 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 95.17 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 95.17 | |
| 2dst_A | 131 | Hypothetical protein TTHA1544; conserved hypotheti | 95.17 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 95.16 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 95.15 | |
| 4dnp_A | 269 | DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu | 95.09 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 95.08 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 95.01 | |
| 2h1i_A | 226 | Carboxylesterase; structural genomics, PSI-2, prot | 94.98 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 94.96 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 94.95 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 94.95 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 94.93 | |
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 94.91 | |
| 1uxo_A | 192 | YDEN protein; hydrolase, A/B hydrolase, esterase, | 94.88 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 94.83 | |
| 3hju_A | 342 | Monoglyceride lipase; alpha/beta hydrolase, hydrol | 94.83 | |
| 2r8b_A | 251 | AGR_C_4453P, uncharacterized protein ATU2452; APC6 | 94.78 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 94.77 | |
| 3aja_A | 302 | Putative uncharacterized protein; alpha-beta hydro | 94.76 | |
| 1ys1_X | 320 | Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h | 94.76 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 94.74 | |
| 3d7r_A | 326 | Esterase; alpha/beta fold, hydrolase; 2.01A {Staph | 94.73 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 94.73 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 94.7 | |
| 3trd_A | 208 | Alpha/beta hydrolase; cellular processes; 1.50A {C | 94.7 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 94.68 | |
| 4g9e_A | 279 | AHL-lactonase, alpha/beta hydrolase fold protein; | 94.67 | |
| 3fla_A | 267 | RIFR; alpha-beta hydrolase thioesterase, hydrolase | 94.66 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 94.66 | |
| 2pl5_A | 366 | Homoserine O-acetyltransferase; alpha/beta hydrola | 94.63 | |
| 3i1i_A | 377 | Homoserine O-acetyltransferase; structural genomic | 94.62 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 94.59 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 94.59 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 94.58 | |
| 3qmv_A | 280 | Thioesterase, REDJ; alpha/beta hydrolase fold, hyd | 94.54 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 94.54 | |
| 2b61_A | 377 | Homoserine O-acetyltransferase; acyl-enzyme, aspar | 94.54 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 94.53 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 94.46 | |
| 1k8q_A | 377 | Triacylglycerol lipase, gastric; APHA beta hydrola | 94.46 | |
| 3pfb_A | 270 | Cinnamoyl esterase; alpha/beta hydrolase fold, hyd | 94.44 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 94.41 | |
| 2psd_A | 318 | Renilla-luciferin 2-monooxygenase; alpha/beta-hydr | 94.4 | |
| 1vkh_A | 273 | Putative serine hydrolase; structural genomics, jo | 94.36 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 94.35 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 94.29 | |
| 3b5e_A | 223 | MLL8374 protein; NP_108484.1, carboxylesterase, st | 94.25 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 94.2 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 94.2 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 94.19 | |
| 3lcr_A | 319 | Tautomycetin biosynthetic PKS; alpha-beta hydrolas | 94.16 | |
| 1auo_A | 218 | Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl | 94.15 | |
| 2qs9_A | 194 | Retinoblastoma-binding protein 9; B5T overexpresse | 94.07 | |
| 3p2m_A | 330 | Possible hydrolase; alpha/beta hydrolase superfami | 94.01 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 94.01 | |
| 4fbl_A | 281 | LIPS lipolytic enzyme; thermostable, structural ge | 93.96 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 93.85 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 93.83 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 93.74 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 93.7 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 93.56 | |
| 3k6k_A | 322 | Esterase/lipase; alpha/beta hydrolase fold; 2.20A | 93.54 | |
| 2qjw_A | 176 | Uncharacterized protein XCC1541; putative hydrolas | 93.53 | |
| 2qru_A | 274 | Uncharacterized protein; alpha/beta-hydrolase, str | 93.5 | |
| 2q0x_A | 335 | Protein DUF1749, uncharacterized protein; alpha/be | 93.46 | |
| 2zyr_A | 484 | Lipase, putative; fatty acid, hydrolase; HET: 1PE; | 93.45 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 93.41 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 93.4 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 93.4 | |
| 3tjm_A | 283 | Fatty acid synthase; thioesterase domain, fatty ac | 93.37 | |
| 1ycd_A | 243 | Hypothetical 27.3 kDa protein in AAP1-SMF2 interge | 93.31 | |
| 1ei9_A | 279 | Palmitoyl protein thioesterase 1; alpha/beta hydro | 93.28 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 93.27 | |
| 2k2q_B | 242 | Surfactin synthetase thioesterase subunit; A/B-hyd | 93.26 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 93.24 | |
| 3fak_A | 322 | Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc | 93.13 | |
| 1kez_A | 300 | Erythronolide synthase; polyketide synthase, modul | 93.09 | |
| 3og9_A | 209 | Protein YAHD A copper inducible hydrolase; alpha/b | 93.06 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 92.19 | |
| 1zi8_A | 236 | Carboxymethylenebutenolidase; alpha and beta prote | 93.04 | |
| 3n2z_B | 446 | Lysosomal Pro-X carboxypeptidase; alpha/beta hydro | 92.99 | |
| 2pbl_A | 262 | Putative esterase/lipase/thioesterase; alpha/beta- | 92.94 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 92.9 | |
| 2vat_A | 444 | Acetyl-COA--deacetylcephalosporin C acetyltransfer | 92.86 | |
| 3tej_A | 329 | Enterobactin synthase component F; nonribosomal pe | 92.81 | |
| 1ufo_A | 238 | Hypothetical protein TT1662; alpha-beta fold, hydr | 92.78 | |
| 2hih_A | 431 | Lipase 46 kDa form; A1 phospholipase, phospholipid | 92.78 | |
| 2i3d_A | 249 | AGR_C_3351P, hypothetical protein ATU1826; structu | 92.54 | |
| 3cn9_A | 226 | Carboxylesterase; alpha/beta hydrolase fold super- | 92.38 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 92.2 | |
| 2uz0_A | 263 | Esterase, tributyrin esterase; alpha/beta hydrolas | 92.15 | |
| 3d0k_A | 304 | Putative poly(3-hydroxybutyrate) depolymerase LPQ; | 92.13 | |
| 4e15_A | 303 | Kynurenine formamidase; alpha/beta hydrolase fold, | 91.99 | |
| 1fj2_A | 232 | Protein (acyl protein thioesterase 1); alpha/beta | 91.83 | |
| 1w52_X | 452 | Pancreatic lipase related protein 2; detergent, cl | 91.77 | |
| 2dsn_A | 387 | Thermostable lipase; T1 lipase, hydrolase; 1.50A { | 91.74 | |
| 2o7r_A | 338 | CXE carboxylesterase; alpha/beta hydrolase; 1.40A | 91.58 | |
| 3ain_A | 323 | 303AA long hypothetical esterase; carboxylesterase | 91.56 | |
| 2o2g_A | 223 | Dienelactone hydrolase; YP_324580.1, structural ge | 91.49 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 91.46 | |
| 3h2g_A | 397 | Esterase; xanthomonas oryzae PV. oryzae, cell WALL | 91.43 | |
| 2cb9_A | 244 | Fengycin synthetase; thioesterase, non-ribosomal p | 91.37 | |
| 1jmk_C | 230 | SRFTE, surfactin synthetase; thioesterase, non-rib | 91.34 | |
| 3e4d_A | 278 | Esterase D; S-formylglutathione hydrolase, hydrola | 91.3 | |
| 1l7a_A | 318 | Cephalosporin C deacetylase; structural genomics, | 91.18 | |
| 1tht_A | 305 | Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. | 91.05 | |
| 3i6y_A | 280 | Esterase APC40077; lipase, structural genomics, PS | 91.03 | |
| 3bxp_A | 277 | Putative lipase/esterase; putative carboxylesteras | 91.03 | |
| 3f67_A | 241 | Putative dienelactone hydrolase; alpha-beta-alpha | 90.96 | |
| 4b6g_A | 283 | Putative esterase; hydrolase, formaldehyde detoxif | 90.89 | |
| 2zsh_A | 351 | Probable gibberellin receptor GID1L1; plant hormon | 90.87 | |
| 3ga7_A | 326 | Acetyl esterase; phosphoserine, IDP00896, hydrolas | 90.84 | |
| 4i19_A | 388 | Epoxide hydrolase; structural genomics, PSI-biolog | 90.83 | |
| 2hm7_A | 310 | Carboxylesterase; alpha/beta hydrolase fold, hydro | 90.8 | |
| 2c7b_A | 311 | Carboxylesterase, ESTE1; carboxyesterase, thermoph | 90.75 | |
| 2hfk_A | 319 | Pikromycin, type I polyketide synthase pikaiv; alp | 90.73 | |
| 1gpl_A | 432 | RP2 lipase; serine esterase, hydrolase, lipid degr | 90.47 | |
| 1jkm_A | 361 | Brefeldin A esterase; serine hydrolase, degradatio | 90.43 | |
| 3hxk_A | 276 | Sugar hydrolase; alpha-beta protein., structural g | 90.42 | |
| 1hpl_A | 449 | Lipase; hydrolase(carboxylic esterase); 2.30A {Equ | 90.21 | |
| 1jji_A | 311 | Carboxylesterase; alpha-beta hydrolase fold, hydro | 89.94 | |
| 1bu8_A | 452 | Protein (pancreatic lipase related protein 2); hyd | 89.88 | |
| 1vlq_A | 337 | Acetyl xylan esterase; TM0077, structural genomics | 89.87 | |
| 3doh_A | 380 | Esterase; alpha-beta hydrolase, beta sheet; 2.60A | 89.76 | |
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 89.75 | |
| 3bjr_A | 283 | Putative carboxylesterase; structural genomics, jo | 89.74 | |
| 3fcx_A | 282 | FGH, esterase D, S-formylglutathione hydrolase; re | 89.66 | |
| 1rp1_A | 450 | Pancreatic lipase related protein 1; hydrolase, li | 89.61 | |
| 3fcy_A | 346 | Xylan esterase 1; alpha/beta hydrolase, carbohydra | 89.58 | |
| 1jfr_A | 262 | Lipase; serine hydrolase; 1.90A {Streptomyces exfo | 89.5 | |
| 3ksr_A | 290 | Putative serine hydrolase; catalytic triad, struct | 89.43 | |
| 3g02_A | 408 | Epoxide hydrolase; alpha/beta hydrolase fold, enan | 89.39 | |
| 4ezi_A | 377 | Uncharacterized protein; alpha-beta hydrolases fol | 89.23 | |
| 2wir_A | 313 | Pesta, alpha/beta hydrolase fold-3 domain protein; | 89.15 | |
| 3qh4_A | 317 | Esterase LIPW; structural genomics, ssgcid, seattl | 89.1 | |
| 1dqz_A | 280 | 85C, protein (antigen 85-C); fibronectin, structur | 88.93 | |
| 3ls2_A | 280 | S-formylglutathione hydrolase; psychrophilic organ | 88.84 | |
| 1lzl_A | 323 | Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod | 88.77 | |
| 1r88_A | 280 | MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP | 88.46 | |
| 3mve_A | 415 | FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ | 88.4 | |
| 4h0c_A | 210 | Phospholipase/carboxylesterase; PSI-biology, midwe | 88.32 | |
| 2fx5_A | 258 | Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse | 88.2 | |
| 2hdw_A | 367 | Hypothetical protein PA2218; alpha/beta hydrolase | 88.02 | |
| 4fhz_A | 285 | Phospholipase/carboxylesterase; alpha/beta hydrola | 87.95 | |
| 1jjf_A | 268 | Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x | 87.62 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 87.57 | |
| 1sfr_A | 304 | Antigen 85-A; alpha/beta hydrolase, structural gen | 86.89 | |
| 1qlw_A | 328 | Esterase; anisotropic refinement, atomic resolutio | 86.77 | |
| 3k2i_A | 422 | Acyl-coenzyme A thioesterase 4; alpha/beta hydrola | 86.36 | |
| 2px6_A | 316 | Thioesterase domain; thioesaterse domain, orlistat | 86.23 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 85.94 | |
| 3guu_A | 462 | Lipase A; protein structure, hydrolase; HET: 1PE; | 85.78 | |
| 3hlk_A | 446 | Acyl-coenzyme A thioesterase 2, mitochondrial; alp | 84.87 | |
| 3g8y_A | 391 | SUSD/RAGB-associated esterase-like protein; struct | 84.47 | |
| 3vis_A | 306 | Esterase; alpha/beta-hydrolase fold, polyethylene | 84.38 | |
| 3nuz_A | 398 | Putative acetyl xylan esterase; structural genomic | 83.56 | |
| 2qm0_A | 275 | BES; alpha-beta structure, structural genomics, PS | 83.13 | |
| 2jbw_A | 386 | Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine | 83.05 | |
| 3fnb_A | 405 | Acylaminoacyl peptidase SMU_737; alpha-beta-alpha | 81.52 | |
| 1gkl_A | 297 | Endo-1,4-beta-xylanase Y; hydrolase, esterase fami | 81.49 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 80.33 |
| >3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} | Back alignment and structure |
|---|
Probab=100.00 E-value=6.9e-39 Score=315.14 Aligned_cols=205 Identities=20% Similarity=0.239 Sum_probs=158.7
Q ss_pred HHHHHHhhcChhhhhHhhhcccccccccccccccccCCCCCcEEEEEEeCCcCCCCEEEEEEcCCCcCCcccHHhhcccc
Q 012136 144 MMASKAAYENNAYITNIVENQWKMDFLGSHDYWNEFQGKATTQAFVLKENRKDDHDRIVVSFRGTETFDADSWCSDFDLS 223 (470)
Q Consensus 144 ~maS~lAYe~~~~i~~~v~~~W~m~~~~~~~~~n~~~~~~~t~afv~~d~~~~~~~~IVVaFRGT~~~s~~Dw~tDl~~~ 223 (470)
+..|.+||.+ |..+...++.+..+. ....++++||+.| ++++.||||||||. +..||++|+++.
T Consensus 15 a~~s~aAY~~------c~~~~~~~~iv~~f~-----~~~~d~~gyva~d---~~~~~IvVafRGT~--s~~dw~~Dl~~~ 78 (258)
T 3g7n_A 15 AKLSSAAYTG------CIGKAFDVTIVKRIY-----DLVTDTNGFVGYS---TEKKTIAVIMRGST--TITDFVNDIDIA 78 (258)
T ss_dssp HHHHHHHHHT------CSSEETTEEEEEEEE-----ETTTTEEEEEEEE---TTTTEEEEEECCCS--CCCC----CCCC
T ss_pred HHHHHHhhCC------CCCCCCCcEEEEEEe-----cCCCCceEEEEEE---CCCCEEEEEECCCC--CHHHHHHhcccc
Confidence 3446678885 323333444444432 1356899999999 78899999999999 689999999987
Q ss_pred cccc-------CCCceechhHHHHhhhhhccCCCcccccCCCCCChhHHHHHHHHHHHHHHhCCCCceEEeccChhHHHH
Q 012136 224 WYEI-------DGMGKIHGGFMKALGLQKCKGWPKELNKQDKRPAPLAYYAIRDMLRELLSKNDRAKYIVTGHSLGGALA 296 (470)
Q Consensus 224 ~~~~-------~~~G~VH~GF~~a~~~~~~~~w~~~~~~~~~~~~~~ay~~i~~~l~~ll~~~~~~~l~vTGHSLGGALA 296 (470)
+.+. +..++||+||++++.. .+.++.+.++++++++|+++|+|||||||||||
T Consensus 79 ~~~~~~~g~~~~~~~~VH~GF~~~~~~--------------------~~~~~~~~l~~~~~~~p~~~i~vtGHSLGGalA 138 (258)
T 3g7n_A 79 LITPELSGVTFPSDVKIMRGVHRPWSA--------------------VHDTIITEVKALIAKYPDYTLEAVGHSLGGALT 138 (258)
T ss_dssp EECCCCTTCCCCTTCCEEHHHHHHHHH--------------------HHHHHHHHHHHHHHHSTTCEEEEEEETHHHHHH
T ss_pred eeccccCCCcCCCCcEEehhHHHHHHH--------------------HHHHHHHHHHHHHHhCCCCeEEEeccCHHHHHH
Confidence 6542 3568999999999863 344688889999999999999999999999999
Q ss_pred HHHHHHHHhchhhhhhcccceEEEecCCccCCHHHHHHHHHhhcCCCceEEEEEeCCCcCCCCCCCCCCCCeeecceEEE
Q 012136 297 ILFPAVLALHEETFLLERLEGVYTFGQPRVGDEKFAEFMQKKLKDHGVEYIRFVYCNDIVPRLPFDDSDFMFKHFGKCLY 376 (470)
Q Consensus 297 ~L~aa~L~~~~~~~~~~~~~~vyTFG~PRVGd~~fa~~~~~~l~~~~~~~~RvV~~~DiVPrlP~~~~~~~f~H~G~~v~ 376 (470)
+|+++++....+ ...+.+||||+|||||++|++++++.. .+++||||.+|+||+||+. ..++|+|+|+|+|
T Consensus 139 ~l~a~~l~~~~~----~~~v~~~tFg~PrvGn~~fa~~~~~~~----~~~~Rvvn~~D~VP~lPp~-~~~gy~H~g~e~~ 209 (258)
T 3g7n_A 139 SIAHVALAQNFP----DKSLVSNALNAFPIGNQAWADFGTAQA----GTFNRGNNVLDGVPNMYSS-PLVNFKHYGTEYY 209 (258)
T ss_dssp HHHHHHHHHHCT----TSCEEEEEESCCCCBCHHHHHHHHHSS----SEEEEEEETTCBGGGTTCS-TTTCCBCCSEEEE
T ss_pred HHHHHHHHHhCC----CCceeEEEecCCCCCCHHHHHHHHhcC----CCeEEEEeCCCccCcCCCC-CCcCCEecceEEE
Confidence 999999876532 234689999999999999999998753 4899999999999999983 2589999999999
Q ss_pred EcCCCCceecc---cCCCCC
Q 012136 377 FDRFYEGKVVS---EEPNKN 393 (470)
Q Consensus 377 ~~~~~~~~~~~---e~p~~~ 393 (470)
+++.....++| |+|+|+
T Consensus 210 ~~~~~~~~~~C~~~ed~~Cs 229 (258)
T 3g7n_A 210 SSGTEASTVKCEGQRDKSCS 229 (258)
T ss_dssp ESSSSTTCEECSSSSCTTTG
T ss_pred ECCCCceEEEeCCCCCCCcc
Confidence 99765555555 446554
|
| >3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* | Back alignment and structure |
|---|
| >3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} | Back alignment and structure |
|---|
| >1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* | Back alignment and structure |
|---|
| >1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A | Back alignment and structure |
|---|
| >1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* | Back alignment and structure |
|---|
| >2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A | Back alignment and structure |
|---|
| >2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} | Back alignment and structure |
|---|
| >2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A | Back alignment and structure |
|---|
| >3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A | Back alignment and structure |
|---|
| >3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... | Back alignment and structure |
|---|
| >1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 | Back alignment and structure |
|---|
| >3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* | Back alignment and structure |
|---|
| >1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* | Back alignment and structure |
|---|
| >2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2zvd_A 3a6z_A 3a70_A* 2z8z_A 2zj6_A 2zj7_A | Back alignment and structure |
|---|
| >3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} | Back alignment and structure |
|---|
| >3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* | Back alignment and structure |
|---|
| >3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A | Back alignment and structure |
|---|
| >3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A | Back alignment and structure |
|---|
| >3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} | Back alignment and structure |
|---|
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} | Back alignment and structure |
|---|
| >1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* | Back alignment and structure |
|---|
| >3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} | Back alignment and structure |
|---|
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* | Back alignment and structure |
|---|
| >1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* | Back alignment and structure |
|---|
| >2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A | Back alignment and structure |
|---|
| >3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A | Back alignment and structure |
|---|
| >3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} | Back alignment and structure |
|---|
| >1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* | Back alignment and structure |
|---|
| >2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A | Back alignment and structure |
|---|
| >3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 | Back alignment and structure |
|---|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A | Back alignment and structure |
|---|
| >2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* | Back alignment and structure |
|---|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A | Back alignment and structure |
|---|
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A | Back alignment and structure |
|---|
| >3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 | Back alignment and structure |
|---|
| >3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A | Back alignment and structure |
|---|
| >4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A | Back alignment and structure |
|---|
| >3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A | Back alignment and structure |
|---|
| >2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* | Back alignment and structure |
|---|
| >3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A | Back alignment and structure |
|---|
| >1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 | Back alignment and structure |
|---|
| >3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* | Back alignment and structure |
|---|
| >3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} | Back alignment and structure |
|---|
| >1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* | Back alignment and structure |
|---|
| >2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* | Back alignment and structure |
|---|
| >4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A | Back alignment and structure |
|---|
| >3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A | Back alignment and structure |
|---|
| >2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A | Back alignment and structure |
|---|
| >1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A | Back alignment and structure |
|---|
| >2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A | Back alignment and structure |
|---|
| >3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A | Back alignment and structure |
|---|
| >1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A | Back alignment and structure |
|---|
| >3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A | Back alignment and structure |
|---|
| >1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* | Back alignment and structure |
|---|
| >3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} | Back alignment and structure |
|---|
| >2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 | Back alignment and structure |
|---|
| >2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* | Back alignment and structure |
|---|
| >3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A | Back alignment and structure |
|---|
| >1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 | Back alignment and structure |
|---|
| >2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} | Back alignment and structure |
|---|
| >2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A | Back alignment and structure |
|---|
| >2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A | Back alignment and structure |
|---|
| >1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} | Back alignment and structure |
|---|
| >2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A | Back alignment and structure |
|---|
| >2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A | Back alignment and structure |
|---|
| >3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A | Back alignment and structure |
|---|
| >2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* | Back alignment and structure |
|---|
| >3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A | Back alignment and structure |
|---|
| >2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* | Back alignment and structure |
|---|
| >1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 | Back alignment and structure |
|---|
| >3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* | Back alignment and structure |
|---|
| >1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A | Back alignment and structure |
|---|
| >3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* | Back alignment and structure |
|---|
| >3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* | Back alignment and structure |
|---|
| >3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} | Back alignment and structure |
|---|
| >2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A | Back alignment and structure |
|---|
| >2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} | Back alignment and structure |
|---|
| >2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A | Back alignment and structure |
|---|
| >1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A | Back alignment and structure |
|---|
| >1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 | Back alignment and structure |
|---|
| >1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* | Back alignment and structure |
|---|
| >1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* | Back alignment and structure |
|---|
| >3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A | Back alignment and structure |
|---|
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* | Back alignment and structure |
|---|
| >3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A | Back alignment and structure |
|---|
| >3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} | Back alignment and structure |
|---|
| >1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 | Back alignment and structure |
|---|
| >3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* | Back alignment and structure |
|---|
| >4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* | Back alignment and structure |
|---|
| >3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A | Back alignment and structure |
|---|
| >1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A | Back alignment and structure |
|---|
| >4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} | Back alignment and structure |
|---|
| >2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* | Back alignment and structure |
|---|
| >1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* | Back alignment and structure |
|---|
| >3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* | Back alignment and structure |
|---|
| >3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} | Back alignment and structure |
|---|
| >3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 | Back alignment and structure |
|---|
| >3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 470 | ||||
| d3tgla_ | 265 | c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor | 2e-27 | |
| d1lgya_ | 265 | c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus ni | 9e-27 | |
| d1uwca_ | 261 | c.69.1.17 (A:) Feruloyl esterase A {Aspergillus ni | 2e-26 | |
| d1tiba_ | 269 | c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces | 5e-25 |
| >d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Length = 265 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Fungal lipases domain: Triacylglycerol lipase species: Rhizomucor miehei [TaxId: 4839]
Score = 108 bits (270), Expect = 2e-27
Identities = 58/204 (28%), Positives = 82/204 (40%), Gaps = 34/204 (16%)
Query: 185 TQAFVLKENRKDDHDRIVVSFRGTETFDADSWCSDFDLSWYEIDGM--GKIHGGFMKALG 242
T A V R D I + FRG+ + +W +D + K+H GF+ + G
Sbjct: 58 TNAMVA---RGDSEKTIYIVFRGSSSIR--NWIADLTFVPVSYPPVSGTKVHKGFLDSYG 112
Query: 243 LQKCKGWPKELNKQDKRPAPLAYYAIRDMLRELLSKNDRAKYIVTGHSLGGALAILFPAV 302
+ + L++ + P+ K VTGHSLGGA +L A+
Sbjct: 113 EVQNELVATVLDQFKQYPS--------------------YKVAVTGHSLGGATVLLC-AL 151
Query: 303 LALHEETFLLERLEGVYTFGQPRVGDEKFAEFMQKKLKDHGVEYIRFVYCNDIVPRLPFD 362
E L +YT GQPRVGD FA ++ G+ Y R V DIVP LP
Sbjct: 152 DLYQREEGLSSSNLFLYTQGQPRVGDPAFANYV----VSTGIPYRRTVNERDIVPHLPP- 206
Query: 363 DSDFMFKHFGKCLYFDRFYEGKVV 386
+ F F H G+ + V
Sbjct: 207 -AAFGFLHAGEEYWITDNSPETVQ 229
|
| >d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Length = 265 | Back information, alignment and structure |
|---|
| >d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Length = 261 | Back information, alignment and structure |
|---|
| >d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Length = 269 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 470 | |||
| d1uwca_ | 261 | Feruloyl esterase A {Aspergillus niger [TaxId: 506 | 100.0 | |
| d1lgya_ | 265 | Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 | 100.0 | |
| d3tgla_ | 265 | Triacylglycerol lipase {Rhizomucor miehei [TaxId: | 100.0 | |
| d1tiba_ | 269 | Triacylglycerol lipase {Thermomyces lanuginosus, f | 100.0 | |
| d1tiaa_ | 271 | Triacylglycerol lipase {Penicillium camembertii [T | 100.0 | |
| d1cexa_ | 197 | Cutinase {Fungus (Fusarium solani), subsp. pisi [T | 97.23 | |
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 96.75 | |
| d1pjaa_ | 268 | Palmitoyl protein thioesterase 2 {Human (Homo sapi | 96.46 | |
| d1cvla_ | 319 | Lipase {Chromobacterium viscosum [TaxId: 42739]} | 95.97 | |
| d1mtza_ | 290 | Tricorn interacting factor F1 {Archaeon Thermoplas | 95.7 | |
| d1ex9a_ | 285 | Lipase {Pseudomonas aeruginosa [TaxId: 287]} | 95.61 | |
| d1tcaa_ | 317 | Triacylglycerol lipase {Yeast (Candida antarctica) | 95.46 | |
| d1jmkc_ | 230 | Surfactin synthetase, SrfA {Bacillus subtilis [Tax | 95.37 | |
| d1brta_ | 277 | Bromoperoxidase A2 {Streptomyces aureofaciens [Tax | 95.23 | |
| d1hkha_ | 279 | Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] | 95.12 | |
| d1k8qa_ | 377 | Gastric lipase {Dog (Canis familiaris) [TaxId: 961 | 94.96 | |
| d1ehya_ | 293 | Bacterial epoxide hydrolase {Agrobacterium radioba | 94.9 | |
| d1xkta_ | 286 | Fatty acid synthase {Human (Homo sapiens) [TaxId: | 94.85 | |
| d3c70a1 | 256 | Hydroxynitrile lyase {Rubber tree (Hevea brasilien | 94.51 | |
| d2rhwa1 | 283 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 94.46 | |
| d1a8qa_ | 274 | Bromoperoxidase A1 {Streptomyces aureofaciens [Tax | 94.37 | |
| d1vkha_ | 263 | Putative serine hydrolase Ydr428c {Baker's yeast ( | 94.32 | |
| d1c4xa_ | 281 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 94.25 | |
| d1mo2a_ | 255 | Erythromycin polyketide synthase {Saccharopolyspor | 94.21 | |
| d1q0ra_ | 297 | Aclacinomycin methylesterase RdmC {Streptomyces pu | 94.17 | |
| d1uk8a_ | 271 | Meta-cleavage product hydrolase CumD {Pseudomonas | 94.16 | |
| d1azwa_ | 313 | Proline iminopeptidase {Xanthomonas campestris, pv | 94.06 | |
| d2dsta1 | 122 | Hypothetical protein TTHA1544 {Thermus thermophilu | 93.99 | |
| d2h7xa1 | 283 | Picromycin polyketide synthase {Streptomyces venez | 93.94 | |
| d2fuka1 | 218 | XC6422 protein {Xanthomonas campestris [TaxId: 339 | 93.75 | |
| d1b6ga_ | 310 | Haloalkane dehalogenase {Xanthobacter autotrophicu | 93.7 | |
| d1zd3a2 | 322 | Mammalian epoxide hydrolase, C-terminal domain {Hu | 93.59 | |
| d1bn7a_ | 291 | Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 | 93.49 | |
| d1qoza_ | 207 | Acetylxylan esterase {Trichoderma reesei [TaxId: 5 | 93.31 | |
| d1g66a_ | 207 | Acetylxylan esterase {Penicillium purpurogenum [Ta | 93.15 | |
| d1j1ia_ | 268 | Meta cleavage compound hydrolase CarC {Janthinobac | 93.07 | |
| d1uxoa_ | 186 | Hypothetical protein YdeN {Bacillus subtilis [TaxI | 92.39 | |
| d3b5ea1 | 209 | Uncharacterized protein Mll8374 {Mesorhizobium lot | 92.35 | |
| d1thta_ | 302 | Myristoyl-ACP-specific thioesterase {Vibrio harvey | 92.34 | |
| d1ei9a_ | 279 | Palmitoyl protein thioesterase 1 {Cow (Bos taurus) | 92.08 | |
| d1r3da_ | 264 | Hypothetical protein VC1974 {Vibrio cholerae [TaxI | 91.23 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 91.05 | |
| d1mj5a_ | 298 | Haloalkane dehalogenase {Sphingomonas paucimobilis | 90.05 | |
| d2jbwa1 | 360 | 2,6-dihydropseudooxynicotine hydrolase {Arthrobact | 90.02 | |
| d1va4a_ | 271 | Arylesterase {Pseudomonas fluorescens [TaxId: 294] | 89.13 | |
| d2pbla1 | 261 | Uncharacterized protein TM1040_2492 {Silicibacter | 89.09 | |
| d1a8sa_ | 273 | Chloroperoxidase F {Pseudomonas fluorescens [TaxId | 88.47 | |
| d1m33a_ | 256 | Biotin biosynthesis protein BioH {Escherichia coli | 87.78 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 87.68 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 87.39 | |
| d1rp1a2 | 337 | Pancreatic lipase, N-terminal domain {Dog (Canis f | 87.31 | |
| d2r8ba1 | 203 | Uncharacterized protein Atu2452 {Agrobacterium tum | 86.37 | |
| d1fj2a_ | 229 | Acyl protein thioesterase 1 {Human (Homo sapiens) | 85.97 | |
| d1bu8a2 | 338 | Pancreatic lipase, N-terminal domain {Rat (Rattus | 85.31 | |
| d1a88a_ | 275 | Chloroperoxidase L {Streptomyces lividans [TaxId: | 84.1 | |
| d1sfra_ | 288 | Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 | 82.46 | |
| d1wm1a_ | 313 | Proline aminopeptidase {Serratia marcescens [TaxId | 82.28 | |
| d1r88a_ | 267 | Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta | 81.86 | |
| d1dqza_ | 280 | Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 | 81.58 | |
| d1xfda2 | 258 | Dipeptidyl aminopeptidase-like protein 6, DPP6, C- | 81.23 | |
| d2h1ia1 | 202 | Carboxylesterase {Bacillus cereus [TaxId: 1396]} | 80.2 |
| >d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Fungal lipases domain: Feruloyl esterase A species: Aspergillus niger [TaxId: 5061]
Probab=100.00 E-value=1.3e-39 Score=318.51 Aligned_cols=169 Identities=26% Similarity=0.437 Sum_probs=145.9
Q ss_pred CCCCcEEEEEEeCCcCCCCEEEEEEcCCCcCCcccHHhhccccccccC-----CCceechhHHHHhhhhhccCCCccccc
Q 012136 181 GKATTQAFVLKENRKDDHDRIVVSFRGTETFDADSWCSDFDLSWYEID-----GMGKIHGGFMKALGLQKCKGWPKELNK 255 (470)
Q Consensus 181 ~~~~t~afv~~d~~~~~~~~IVVaFRGT~~~s~~Dw~tDl~~~~~~~~-----~~G~VH~GF~~a~~~~~~~~w~~~~~~ 255 (470)
...++++||+.| ++++.||||||||. +..||++|+++...+++ +.|+||+||++++...
T Consensus 44 ~~~d~~gyv~~d---~~~k~ivVafRGT~--s~~d~~~Dl~~~~~~~~~~~~~~~~~vH~GF~~~~~~i----------- 107 (261)
T d1uwca_ 44 AQTDINGWILRD---DTSKEIITVFRGTG--SDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISV----------- 107 (261)
T ss_dssp TTTTEEEEEEEE---TTTTEEEEEECCCC--SHHHHHHHTCCCEEECTTCTTSTTCEEEHHHHHHHHHH-----------
T ss_pred ccCCcEEEEEEE---CCCCeEEEEEcCCC--CHHHHHHhcCcceEeccccCCCCCeEEeHHHHHHHHHH-----------
Confidence 345789999999 78899999999998 79999999998776553 3479999999998643
Q ss_pred CCCCCChhHHHHHHHHHHHHHHhCCCCceEEeccChhHHHHHHHHHHHHhchhhhhhcccceEEEecCCccCCHHHHHHH
Q 012136 256 QDKRPAPLAYYAIRDMLRELLSKNDRAKYIVTGHSLGGALAILFPAVLALHEETFLLERLEGVYTFGQPRVGDEKFAEFM 335 (470)
Q Consensus 256 ~~~~~~~~ay~~i~~~l~~ll~~~~~~~l~vTGHSLGGALA~L~aa~L~~~~~~~~~~~~~~vyTFG~PRVGd~~fa~~~ 335 (470)
..++.+.++++++++|+++|+|||||||||||+|++++|....+ ...+||||+|||||.+|++++
T Consensus 108 ---------~~~i~~~i~~~~~~~~~~~i~vTGHSLGGAlA~L~a~~l~~~~~------~~~~~tFG~PrvGn~~fa~~~ 172 (261)
T d1uwca_ 108 ---------QDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYD------NVRLYTFGEPRSGNQAFASYM 172 (261)
T ss_dssp ---------HHHHHHHHHHHHHHSTTSEEEEEEETHHHHHHHHHHHHHHTTCS------SEEEEEESCCCCBCHHHHHHH
T ss_pred ---------HHHHHHHHHHHHhhCCCcceEEeccchhHHHHHHHHHHHHhcCC------CcceEEecCccccCHHHHHHH
Confidence 34688889999999999999999999999999999999976642 357999999999999999999
Q ss_pred HHhhcC---CCceEEEEEeCCCcCCCCCCCCCCCCeeecceEEEEcCCCC
Q 012136 336 QKKLKD---HGVEYIRFVYCNDIVPRLPFDDSDFMFKHFGKCLYFDRFYE 382 (470)
Q Consensus 336 ~~~l~~---~~~~~~RvV~~~DiVPrlP~~~~~~~f~H~G~~v~~~~~~~ 382 (470)
++.+.. ...+++||||.+|+||+||+. .++|+|+|+|+||++.+.
T Consensus 173 ~~~~~~~~~~~~~~~Rvv~~~D~VP~lP~~--~~gy~H~g~Evw~~~~~~ 220 (261)
T d1uwca_ 173 NDAFQVSSPETTQYFRVTHSNDGIPNLPPA--EQGYAHGGVEYWSVDPYS 220 (261)
T ss_dssp HHHTTTTCTTTCSEEEEEETTCSGGGCSCG--GGTCBCCSEEEEECSSCS
T ss_pred HhhcccccccCccEEEEEeCCCeEEECCCC--CCCCEeCCeEEEeCCCCC
Confidence 987642 245789999999999999996 578999999999987655
|
| >d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} | Back information, alignment and structure |
|---|
| >d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} | Back information, alignment and structure |
|---|
| >d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} | Back information, alignment and structure |
|---|
| >d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} | Back information, alignment and structure |
|---|
| >d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} | Back information, alignment and structure |
|---|
| >d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} | Back information, alignment and structure |
|---|
| >d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} | Back information, alignment and structure |
|---|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|