Citrus Sinensis ID: 012182

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47

MSGLTVARLQLFHYPSSTVRTTVISSKLHHSFPSSNRYRPRTLHNFSTSGIAQSSSSSSIVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRNMSCLVAFAVGQKYSVGRVIVRGSDGSFLHKLVKVKRPLLRVPTLAIHLDRTVNKDGFKPNLETQLIPLLATKSEETSVEPKEKSSTSSSKVTHHPQLMQILSQELGCGTDDIASIELNICDTQPSCLGGANNEFIFSGRLDNLASSYCGLRALIDSCVSPSNLSSEHAIRMVALFDNEEVGSDSYQGAGAPTMFQAIRRIVGSLAHEHVSETSFECTIRQSFLVSADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQEFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYESFSSIDKKLIVDF

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccccccEEEEEEcccEEEEEEEcccccccEEEEEccccccEEEEEcccccEEEcccccccccccccccccccccccccccEEEEccccccccccccccccccccccHHHHHHHHHHHccccccccccccEEEECccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHccEEEccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHHHccccCEEEEccccccccccHHHHHHccccccEEEccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccc

*****VARLQLFHYPSSTVRTTVI***********************************IVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRNMSCLVAFAVGQKYSVGRVIVRGSDGSFLHKLVKVKRPLLRVPTLAIHLDRTVNKDGFKPNLETQLIPLLATKS*****************VTHHPQLMQILSQELGCGTDDIASIELNICDTQPSCLGGANNEFIFSGRLDNLASSYCGLRALIDSCVSPSNLSSEHAIRMVALFDNEEVGSDSYQGAGAPTMFQAIRRIVGSLAHEHVSETSFECTIRQSFLVSADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQEFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYESFSSIDKKLIVDF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Aspartyl aminopeptidase	Likely to play an important role in intracellular protein and peptide metabolism.	probable	Q5RBT2
Aspartyl aminopeptidase	Likely to play an important role in intracellular protein and peptide metabolism.	probable	Q9ULA0
Aspartyl aminopeptidase	Likely to play an important role in intracellular protein and peptide metabolism.	probable	Q54M70

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EME, chain A
Confidence level:very confident
Coverage over the Query: 207-468
View the alignment between query and template
View the model in PyMOL

Template: 2GLJ, chain A
Confidence level:very confident
Coverage over the Query: 36-456
View the alignment between query and template
View the model in PyMOL