Citrus Sinensis ID: 012266

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------
MEKNRWDLRFQNSGSSQSEESALDLERNYCHHPNLPSSSPSPLQPFASGGQHSESNAAYFSWPTLSRLNDAAEDRANYFGNLQKGVLPETLGRLPTGQQATTLLELMTIRAFHSKILRRFSLGTAIGFRIRRGVLTDIPAILVFVARKVHRQWLSHVQCLPAALEGPGGVWCDVDVVEFSYYGAPAPTPKEELYTELVDGLRGSDPCIGSGSQVASQETYGTLGAIVRSRTGNQQVGFLTNRHVAVDLDYPNQKMFHPLPPSLGPGVYLGAVERATSFITDDLWYGIFAGTNPETFVRADGAFIPFAEDFNLNNVTTSVKGVGEIGDVHIIDLQSPINSLIGRQVMKVGRSSGLTTGTVMAYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDLLELDLIATNEGFQGLFYRTN
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccccccccEEEEEEcccccccccccccccccccccccccEEEccEEEEccccccccccccccHHHHccccccccccccccccccccccEEEEEEEEEEcccccEEEEEEccEEEEccccccccccccccccccccccccccccccEEEEccEEEEEEEcccccccccccccccccccccccccccccEEEEcccccEEEEcccccccccccccEEEEEEEcccEEEEEEEEEEEEEccccEEEEEEEEEEccccccccccccccEEEEEccccccccccEEEEEEEccccccEEcccccccccccccccHHHHHHHcccEEEEccccccccccccc
cccccccHHHHccccccccccHccHHcccccccccccccccccccccccccccccccEEEEccccHHcccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHEEEEEEEEccccccccEEEEEEEccccHHcccHHHcccHHHcccccEEEEEEEEEEcccccccccccccccHHHHccccccccccccccccccccccccEEEEEEEcccccEEEEEEccEEEEEcccccccccccccccccccccccccEcccccccccEEEEcccccccccEEEccccEEEcccccccccccccEEEEEEcccEEEccccccHHHHHcccEEEEccccccccEEEEEEEEEEcccccEEEEEEEEEEccccccccccccccEEEEEEccccccccEEEEEEEcccccccEEEEcccccccccccccHHHHHHHccEEEEEccccccccHcccc
meknrwdlrfqnsgssqseeSALDLErnychhpnlpssspsplqpfasggqhsesnaayfswptlsrlnDAAEDRANYFGnlqkgvlpetlgrlptgqqATTLLELMTIRAFHSKILRRFSLGTAIGFRIrrgvltdiPAILVFVARKVHRQWLSHvqclpaalegpggvwcdvdvvefsyygapaptpkeELYTELVDglrgsdpcigsgsqvasqeTYGTLGAIVRsrtgnqqvgfltnrhvavdldypnqkmfhplppslgpgvylGAVERATsfitddlwygifagtnpetfvradgafipfaedfnlnnvttsvkgvgeigdvhiidlqspinsligrqvmkvgrssglttGTVMAYALEyndekgicfftdflvvgenqqtfdlegdsgslilltgqngekprpvgiiwggtanrgrlklkvgqppvnwtsgvdlGRLLDLLELDLiatnegfqglfyrtn
meknrwdlrfqnsgssqsEESALDLERNYCHHPNLPSSSPSPLQPFASGGQHSESNAAYFSWPTLSRLNDAAEDRANYFGNLQKGVLPETLGRLPTGQQATTLLELMTIRAFHSKILRRFSLGTAIGFRIRRGVLTDIPAILVFVARKVHRQWLSHVQCLPAALEGPGGVWCDVDVVEFSYygapaptpKEELYTELVDGLRGSDPCIGSGSQVASQETYGTLGAIVRSRTGNQQVGFLTNRHVAVDLDYPNQKMFHPLPPSLGPGVYLGAVERATSFITDDLWYGIFAGTNPETFVRADGAFIPFAEDFNLNNVTTSVKGVGEIGDVHIIDLQSPINSLIGRQVMKVGRSSGLTTGTVMAYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTgqngekprpVGIIWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDLLELDLIatnegfqglfyrtn
MEKNRWDLRFQNSGSSQSEESALDLERNYCHHpnlpssspsplqpfasGGQHSESNAAYFSWPTLSRLNDAAEDRANYFGNLQKGVLPETLGRLPTGQQATTLLELMTIRAFHSKILRRFSLGTAIGFRIRRGVLTDIPAILVFVARKVHRQWLSHVQCLPAALEGPGGVWCDVDVVEFSYYGAPAPTPKEELYTELVDGLRGSDPCIGSGSQVASQETYGTLGAIVRSRTGNQQVGFLTNRHVAVDLDYPNQKMFHPLPPSLGPGVYLGAVERATSFITDDLWYGIFAGTNPETFVRADGAFIPFAEDFNLNNVTTSVKGVGEIGDVHIIDLQSPINSLIGRQVMKVGRSSGLTTGTVMAYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTANRGRLKLKVGQPPVNWTSGVdlgrlldlleldlIATNEGFQGLFYRTN
*********************************************************AYFSWPTLSRLNDAAEDRANYFGNLQKGVLPETLGRLPTGQQATTLLELMTIRAFHSKILRRFSLGTAIGFRIRRGVLTDIPAILVFVARKVHRQWLSHVQCLPAALEGPGGVWCDVDVVEFSYYGAPAPTPKEELYTELVDGLRGSDPCIGSGSQVASQETYGTLGAIVRSRTGNQQVGFLTNRHVAVDLDYPNQKMFHPLPPSLGPGVYLGAVERATSFITDDLWYGIFAGTNPETFVRADGAFIPFAEDFNLNNVTTSVKGVGEIGDVHIIDLQSPINSLIGRQVMKVGRSSGLTTGTVMAYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDLLELDLIATNEGFQGLFY***
***************************NYCHHPN***************GQHSESNAAYFSWPTLSRLNDAAEDRANYFGNL****************QATTLLELMTIRAFHSKILRRFSLGTAIGFRIRRGVLTDIPAILVFVARKVHRQWLSHVQCLPAALEGPGGVWCDVDVVEFSYYGAPAPTPKEELYTELVDGLRGSDPCIGSGSQVASQETYGTLGAIVRSRTGNQQVGFLTNRHVAVDLDYPNQKMFHPLPPSLGPGVYLGAVERATSFITDDLWYGIFAGTNPETFVRADGAFIPFAEDFNLNNVTTSVKGVGEIGDVHIIDLQSPINSLIGRQVMKVGRSSGLTTGTVMAYALEYNDEKGICFFTDFLVVGENQ******GDSGSLILLTGQNGEKPRPVGIIWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDLLELDLIATNEGFQ*******
***********************DLERNYCHHPNLPSSSPSPLQPFASGGQHSESNAAYFSWPTLSRLNDAAEDRANYFGNLQKGVLPETLGRLPTGQQATTLLELMTIRAFHSKILRRFSLGTAIGFRIRRGVLTDIPAILVFVARKVHRQWLSHVQCLPAALEGPGGVWCDVDVVEFSYYGAPAPTPKEELYTELVDGLRGSDPCIGSGSQVASQETYGTLGAIVRSRTGNQQVGFLTNRHVAVDLDYPNQKMFHPLPPSLGPGVYLGAVERATSFITDDLWYGIFAGTNPETFVRADGAFIPFAEDFNLNNVTTSVKGVGEIGDVHIIDLQSPINSLIGRQVMKVGRSSGLTTGTVMAYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDLLELDLIATNEGFQGLFYRTN
**********************LDLERNYCHHPNLPSSSPSPLQP*A*GGQHSESNAAYFSWPTLSRLNDAAEDRANYFGNLQKGVLPETLGRLPTGQQATTLLELMTIRAFHSKILRRFSLGTAIGFRIRRGVLTDIPAILVFVARKVHRQWLSHVQCLPAALEGPGGVWCDVDVVEFSYYGAPAPTPKEELYTELVDGLRGSDPCIGSGSQVASQETYGTLGAIVRSRTGNQQVGFLTNRHVAVDLDYPNQKMFHPLPPSLGPGVYLGAVERATSFITDDLWYGIFAGTNPETFVRADGAFIPFAEDFNLNNVTTSVKGVGEIGDVHIIDLQSPINSLIGRQVMKVGRSSGLTTGTVMAYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDLLELDLIATNEGFQGLF****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKNRWDLRFQNSGSSQSEESALDLERNYCHHPNLPSSSPSPLQPFASGGQHSESNAAYFSWPTLSRLNDAAEDRANYFGNLQKGVLPETLGRLPTGQQATTLLELMTIRAFHSKILRRFSLGTAIGFRIRRGVLTDIPAILVFVARKVHRQWLSHVQCLPAALEGPGGVWCDVDVVEFSYYGAPAPTPKEELYTELVDGLRGSDPCIGSGSQVASQETYGTLGAIVRSRTGNQQVGFLTNRHVAVDLDYPNQKMFHPLPPSLGPGVYLGAVERATSFITDDLWYGIFAGTNPETFVRADGAFIPFAEDFNLNNVTTSVKGVGEIGDVHIIDLQSPINSLIGRQVMKVGRSSGLTTGTVMAYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDLLELDLIATNEGFQGLFYRTN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query467
224136616 594 predicted protein [Populus trichocarpa] 0.987 0.776 0.917 0.0
255566289 593 conserved hypothetical protein [Ricinus 0.985 0.775 0.919 0.0
224114770 593 predicted protein [Populus trichocarpa] 0.982 0.774 0.919 0.0
225423710 596 PREDICTED: uncharacterized protein LOC10 0.995 0.780 0.924 0.0
297737962 684 unnamed protein product [Vitis vinifera] 0.995 0.679 0.924 0.0
356521576 600 PREDICTED: uncharacterized protein LOC10 0.982 0.765 0.913 0.0
356576395 600 PREDICTED: uncharacterized protein LOC10 0.982 0.765 0.911 0.0
356576393 598 PREDICTED: uncharacterized protein LOC10 0.982 0.767 0.911 0.0
147798987 1092 hypothetical protein VITISV_008456 [Viti 0.989 0.423 0.865 0.0
357475191 597 hypothetical protein MTR_4g084020 [Medic 0.978 0.765 0.891 0.0
>gi|224136616|ref|XP_002322374.1| predicted protein [Populus trichocarpa] gi|222869370|gb|EEF06501.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  848 bits (2192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/461 (91%), Positives = 443/461 (96%)

Query: 1   MEKNRWDLRFQNSGSSQSEESALDLERNYCHHPNLPSSSPSPLQPFASGGQHSESNAAYF 60
           M++NR  LR  +SGSSQSEESALDLERNYC HPNL  SSPSPLQPFASGGQHSESNAAYF
Sbjct: 1   MDRNRLGLRIHHSGSSQSEESALDLERNYCSHPNLLWSSPSPLQPFASGGQHSESNAAYF 60

Query: 61  SWPTLSRLNDAAEDRANYFGNLQKGVLPETLGRLPTGQQATTLLELMTIRAFHSKILRRF 120
           SWPTLSRLNDAAE RANYFGNLQKGVLPETLGRLP+GQ+ATTLLELMTIRAFHSKILRRF
Sbjct: 61  SWPTLSRLNDAAEVRANYFGNLQKGVLPETLGRLPSGQRATTLLELMTIRAFHSKILRRF 120

Query: 121 SLGTAIGFRIRRGVLTDIPAILVFVARKVHRQWLSHVQCLPAALEGPGGVWCDVDVVEFS 180
           SLGTAIGFRIRRG LTDIPAILVFVARKVHRQWLSHVQCLPAALEGPGGVWCDVDVVEFS
Sbjct: 121 SLGTAIGFRIRRGDLTDIPAILVFVARKVHRQWLSHVQCLPAALEGPGGVWCDVDVVEFS 180

Query: 181 YYGAPAPTPKEELYTELVDGLRGSDPCIGSGSQVASQETYGTLGAIVRSRTGNQQVGFLT 240
           YYG PA TPKE+LYTELVDGLRGSDPCIGSGSQVA+QETYGTLGAIV+SRTGN+QVGFLT
Sbjct: 181 YYGVPAATPKEQLYTELVDGLRGSDPCIGSGSQVANQETYGTLGAIVKSRTGNRQVGFLT 240

Query: 241 NRHVAVDLDYPNQKMFHPLPPSLGPGVYLGAVERATSFITDDLWYGIFAGTNPETFVRAD 300
           NRHVAVDLDYPNQKMFHPLPPSLGPGVYLGAVERATSFITD+LWYGIFAGTNPETFVRAD
Sbjct: 241 NRHVAVDLDYPNQKMFHPLPPSLGPGVYLGAVERATSFITDELWYGIFAGTNPETFVRAD 300

Query: 301 GAFIPFAEDFNLNNVTTSVKGVGEIGDVHIIDLQSPINSLIGRQVMKVGRSSGLTTGTVM 360
           GAFIPFAEDFN+NNV  +VKGVGE+GDVH+IDLQ+PINSLIGRQV+KVGRSSGLTTGT+M
Sbjct: 301 GAFIPFAEDFNMNNVNITVKGVGEVGDVHVIDLQAPINSLIGRQVVKVGRSSGLTTGTIM 360

Query: 361 AYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTAN 420
           AYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTG++ EKPRPVGIIWGGTAN
Sbjct: 361 AYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGRDCEKPRPVGIIWGGTAN 420

Query: 421 RGRLKLKVGQPPVNWTSGVDLGRLLDLLELDLIATNEGFQG 461
           RGRLKLKVGQPP NWTSGVDLGRLLDLLELD+I TNEG Q 
Sbjct: 421 RGRLKLKVGQPPENWTSGVDLGRLLDLLELDIITTNEGLQA 461

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255566289|ref|XP_002524131.1| conserved hypothetical protein [Ricinus communis] gi|223536598|gb|EEF38242.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224114770|ref|XP_002332278.1| predicted protein [Populus trichocarpa] gi|222832440|gb|EEE70917.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225423710|ref|XP_002277727.1| PREDICTED: uncharacterized protein LOC100250825 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737962|emb|CBI27163.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356521576|ref|XP_003529430.1| PREDICTED: uncharacterized protein LOC100796081 [Glycine max] Back     alignment and taxonomy information
>gi|356576395|ref|XP_003556317.1| PREDICTED: uncharacterized protein LOC100816119 isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356576393|ref|XP_003556316.1| PREDICTED: uncharacterized protein LOC100816119 isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|147798987|emb|CAN61635.1| hypothetical protein VITISV_008456 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357475191|ref|XP_003607881.1| hypothetical protein MTR_4g084020 [Medicago truncatula] gi|124359654|gb|ABN06026.1| Peptidase, trypsin-like serine and cysteine proteases [Medicago truncatula] gi|355508936|gb|AES90078.1| hypothetical protein MTR_4g084020 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query467
TAIR|locus:505006292 579 AT2G35155 [Arabidopsis thalian 0.940 0.758 0.828 2.9e-199
TAIR|locus:2155317 607 AT5G45030 [Arabidopsis thalian 0.980 0.754 0.778 3.7e-190
TAIR|locus:2089255 558 AT3G12950 [Arabidopsis thalian 0.875 0.732 0.732 6.3e-163
TAIR|locus:505006292 AT2G35155 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1929 (684.1 bits), Expect = 2.9e-199, P = 2.9e-199
 Identities = 366/442 (82%), Positives = 394/442 (89%)

Query:     1 MEKNRWDLRF-QNSGSSQSEESALDLERNY-CHHXXXXXXXXXXXXX-XXXGGQHSESNA 57
             M    W  RF Q + SS+SE+SALDLERN+ C+H                   QH+ESNA
Sbjct:     1 MNLGAWGQRFIQAAASSESEDSALDLERNHHCNHLSLPSSSSPSPLQPFTLNIQHAESNA 60

Query:    58 AYFSWPTLSRLNDAAEDRANYFGNLQKGVLPETLGRLPTGQQATTLLELMTIRAFHSKIL 117
              YFSWPTLSRLND  EDRANYFGNLQKGVLPET+GRLP+GQQATTLLELMTIRAFHSKIL
Sbjct:    61 PYFSWPTLSRLNDTVEDRANYFGNLQKGVLPETVGRLPSGQQATTLLELMTIRAFHSKIL 120

Query:   118 RRFSLGTAIGFRIRRGVLTDIPAILVFVARKVHRQWLSHVQCLPAALEGPGGVWCDVDVV 177
             RRFSLGTA+GFRI RGVLT++PAILVFVARKVHRQWL+ +QCLP+ALEGPGGVWCDVDVV
Sbjct:   121 RRFSLGTAVGFRISRGVLTNVPAILVFVARKVHRQWLNPMQCLPSALEGPGGVWCDVDVV 180

Query:   178 EFSYYGAPAPTPKEELYTELVDGLRGSDPCIGSGSQVASQETYGTLGAIVRSRTGNQQVG 237
             EF YYGAPA TPKE++Y ELVDGLRGSDPCIGSGSQVASQETYGTLGAIV+SRTGN QVG
Sbjct:   181 EFQYYGAPAATPKEQVYNELVDGLRGSDPCIGSGSQVASQETYGTLGAIVKSRTGNHQVG 240

Query:   238 FLTNRHVAVDLDYPNQKMFHPLPPSLGPGVYLGAVERATSFITDDLWYGIFAGTNPETFV 297
             FLTNRHVAVDLDYP+QKMFHPLPPSLGPGVYLGAVERATSFITDD WYGIFAGTNPETFV
Sbjct:   241 FLTNRHVAVDLDYPSQKMFHPLPPSLGPGVYLGAVERATSFITDDQWYGIFAGTNPETFV 300

Query:   298 RADGAFIPFAEDFNLNNVTTSVKGVGEIGDVHIIDLQSPINSLIGRQVMKVGRSSGLTTG 357
             RADGAFIPFAEDFN +NVTT +KG+GEIGDVH+IDLQSPI+SLIG+QV+KVGRSSG TTG
Sbjct:   301 RADGAFIPFAEDFNTSNVTTLIKGIGEIGDVHVIDLQSPIDSLIGKQVVKVGRSSGYTTG 360

Query:   358 TVMAYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGG 417
             T+MAYALEYNDEKGICF TDFLV+GENQQTFDLEGDSGSLILLTG NG+KPRPVGIIWGG
Sbjct:   361 TIMAYALEYNDEKGICFLTDFLVIGENQQTFDLEGDSGSLILLTGPNGQKPRPVGIIWGG 420

Query:   418 TANRGRLKLKVGQPPVNWTSGV 439
             TANRGRLKL  GQ P NWTSGV
Sbjct:   421 TANRGRLKLIAGQEPENWTSGV 442
GO:0003824 "catalytic activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
TAIR|locus:2155317 AT5G45030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089255 AT3G12950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 467
PF08192695 Peptidase_S64: Peptidase family S64; InterPro: IPR 99.71
PRK10139 455 serine endoprotease; Provisional 97.99
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.96
PRK10898353 serine endoprotease; Provisional 97.88
PRK10942 473 serine endoprotease; Provisional 97.86
TIGR02037 428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.82
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 97.2
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 96.73
PF00863235 Peptidase_C4: Peptidase family C4 This family belo 95.35
COG0265347 DegQ Trypsin-like serine proteases, typically peri 95.21
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 94.56
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 94.47
KOG1421 955 consensus Predicted signaling-associated protein ( 94.22
PF00944158 Peptidase_S3: Alphavirus core protein ; InterPro: 93.96
PF00947127 Pico_P2A: Picornavirus core protein 2A; InterPro: 92.49
PF05579297 Peptidase_S32: Equine arteritis virus serine endop 89.68
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 89.04
PF10459698 Peptidase_S46: Peptidase S46; InterPro: IPR019500 86.87
PF00949132 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine 83.79
PF12381231 Peptidase_C3G: Tungro spherical virus-type peptida 82.44
>PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information 
Probab=99.71  E-value=4.6e-17  Score=175.67  Aligned_cols=102  Identities=29%  Similarity=0.428  Sum_probs=85.6

Q ss_pred             cccccCCCcEEEeeeccCceEEEEEEEEEEEeCCCCeEEEEEEEEEcCCCCCCCCCCCccceEEeeccC-CCCCceEEEE
Q 012266          336 PINSLIGRQVMKVGRSSGLTTGTVMAYALEYNDEKGICFFTDFLVVGENQQTFDLEGDSGSLILLTGQN-GEKPRPVGII  414 (467)
Q Consensus       336 ~~~p~lG~~V~KvGRTTGlT~G~I~ai~v~y~~~~G~~~f~dqiit~~~~~~fS~~GDSGSlvl~~~~~-d~~~~~VGLl  414 (467)
                      ......|+.|+|+|||||+|+|+|+++.+.|+.+ |...+.+++|...++..|+.+|||||+|+.+.++ ...-.+||||
T Consensus       584 ~~~~~~G~~VfK~GrTTgyT~G~lNg~klvyw~d-G~i~s~efvV~s~~~~~Fa~~GDSGS~VLtk~~d~~~gLgvvGMl  662 (695)
T PF08192_consen  584 VSNLVPGMEVFKVGRTTGYTTGILNGIKLVYWAD-GKIQSSEFVVSSDNNPAFASGGDSGSWVLTKLEDNNKGLGVVGML  662 (695)
T ss_pred             hhccCCCCeEEEecccCCccceEecceEEEEecC-CCeEEEEEEEecCCCccccCCCCcccEEEecccccccCceeeEEe
Confidence            3455679999999999999999999999888876 5567899999987788899999999999965444 3345699999


Q ss_pred             EeccCCCCccccccCCCCcceeeeechHHHHhhcC
Q 012266          415 WGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDLLE  449 (467)
Q Consensus       415 fgG~~~~g~~~~~~~~~~~~~t~~~pI~~VL~~L~  449 (467)
                      ++.++..           ..|.+|+||..||+.|.
T Consensus       663 hsydge~-----------kqfglftPi~~il~rl~  686 (695)
T PF08192_consen  663 HSYDGEQ-----------KQFGLFTPINEILDRLE  686 (695)
T ss_pred             eecCCcc-----------ceeeccCcHHHHHHHHH
Confidence            9986543           48999999999999884

Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This family of fungal proteins is involved in the processing of membrane bound transcription factor Stp1 [] and belongs to MEROPS petidase family S64 (clan PA). The processing causes the signalling domain of Stp1 to be passed to the nucleus where several permease genes are induced. The permeases are important for uptake of amino acids, and processing of tp1 only occurs in an amino acid-rich environment. This family is predicted to be distantly related to the trypsin family (MEROPS peptidase family S1) and to have a typical trypsin-like catalytic triad [].
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>PF00944 Peptidase_S3: Alphavirus core protein ; InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00947 Pico_P2A: Picornavirus core protein 2A; InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF12381 Peptidase_C3G: Tungro spherical virus-type peptidase; InterPro: IPR024387 This entry represents a rice tungro spherical waikavirus-type peptidase that belongs to MEROPS peptidase family C3G Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query467
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 2e-06
2oua_A188 Serine protease, protein NAPA; kinetic stability, 3e-06
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 4e-06
1hpg_A187 Glutamic acid specific protease; serine protease, 7e-06
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 3e-04
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 6e-04
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Length = 181 Back     alignment and structure
 Score = 47.2 bits (112), Expect = 2e-06
 Identities = 30/215 (13%), Positives = 53/215 (24%), Gaps = 56/215 (26%)

Query: 208 IGSGSQVASQETYGTLGAIVRSRTGNQQVGFLTNRHVAVDLDYPNQKMFHPLPPSLGPGV 267
           I  G  + +  +  +LG  V   + N     LT  H                        
Sbjct: 1   IAGGEAITTGGSRCSLGFNV---SVNGVAHALTAGHCTNI----------------SASW 41

Query: 268 YLGAVERATSFITDDLWYGIFAGTNPETFVRADGAFIPFAEDFNLNNVTTSVKGVGEIGD 327
            +G     +    D               +R           +  N     +   G    
Sbjct: 42  SIGTRTGTSFPNNDYGI------------IRHSNPAAADGRVYLYNGSYQDITTAGN--- 86

Query: 328 VHIIDLQSPINSLIGRQVMKVGRSSGLTTGTVMAYALEYNDEKGICFFTDFLVVGENQQT 387
                      + +G+ V + G ++GL +G+V       N       +            
Sbjct: 87  -----------AFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQT-----NV 130

Query: 388 FDLEGDSGSLILLTGQNGEKPRPVGIIWGGTANRG 422
               GDSG  +            +G+  GG+ N  
Sbjct: 131 CAQPGDSGGSLFAGST------ALGLTSGGSGNCR 159
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Length = 188 Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Length = 185 Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Length = 187 Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Length = 189 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Length = 198 Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Length = 186 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query467
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 99.85
2oua_A188 Serine protease, protein NAPA; kinetic stability, 99.81
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 99.8
1hpg_A187 Glutamic acid specific protease; serine protease, 99.79
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 99.73
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 99.64
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 99.55
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 98.61
3k6y_A237 Serine protease, possible membrane-associated seri 98.37
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 98.36
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 98.35
3qo6_A 348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.29
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 98.29
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 98.29
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.25
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.17
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.15
3num_A 332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.08
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.04
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 97.96
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.93
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.89
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 97.77
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 97.66
2o8l_A274 V8 protease, taphylococcal serine; serine protease 97.65
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 97.6
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 97.44
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 97.41
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 97.38
2w5e_A163 Putative serine protease; coiled coil, transmembra 97.36
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 97.13
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 96.46
3mmg_A241 Nuclear inclusion protein A; 3C-type protease, TEV 96.27
1lvm_A229 Catalytic domain of the nuclear inclusion protein 94.55
1a7s_A225 Heparin binding protein; serine protease homolog, 93.8
2z7f_E218 Leukocyte elastase; serine protease, serine protea 93.55
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 93.14
2xw9_A228 Complement factor D; immune system, hydrolase, ser 92.87
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 92.74
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 92.72
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 92.62
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 92.31
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 92.25
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 92.11
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 92.1
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 91.88
1ao5_A237 Glandular kallikrein-13; serine protease, protein 91.78
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 91.41
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 91.35
2r0l_A248 Hepatocyte growth factor activator; serine proteas 91.29
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 91.25
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 91.21
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 90.94
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 90.86
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 90.62
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 90.61
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 90.5
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 90.32
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 90.16
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 90.01
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 89.98
2aiq_A231 Protein C activator; snake venom serine proteinase 89.97
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 89.95
1euf_A227 Duodenase; serine protease, dual specificity, hydr 89.9
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 89.63
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 89.56
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 89.55
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 89.46
2jde_A276 Urokinase-type plasminogen activator; plasminogen 89.44
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 89.32
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 89.16
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 89.1
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 88.87
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 88.56
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 88.51
2asu_B234 Hepatocyte growth factor-like protein; serine prot 87.88
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 87.69
1ep5_B157 Capsid protein C, coat protein C; beta barrel, hyd 87.68
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 87.65
1vcp_A149 Semliki forest virus capsid protein; virus coat pr 87.54
1elv_A333 Complement C1S component; trypsin-like serin prote 87.45
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 87.32
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 87.2
1svp_A161 Sindbis virus capsid protein; chymotrypsin-like se 86.94
3bg8_A238 Coagulation factor XIA light chain; protease inhib 86.94
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 86.61
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 86.6
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 86.52
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 86.5
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 86.2
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 86.19
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 86.19
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 86.01
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 85.67
1md8_A329 C1R complement serine protease; innate immunity, a 85.62
1kxf_A264 Sindbis virus capsid protein; chymotrypsin-like se 85.05
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 84.79
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 84.55
1azz_A226 Collagenase; complex (serine protease/inhibitor), 84.53
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 84.52
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 84.08
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 84.06
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 84.01
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 83.64
4agk_A158 Capsid protein, coat protein, C; hydrolase, viral 83.56
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 83.41
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 82.77
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 81.11
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
Probab=99.85  E-value=1.2e-20  Score=178.15  Aligned_cols=179  Identities=20%  Similarity=0.270  Sum_probs=126.3

Q ss_pred             ceeeeEEEEEeCCCCceeEEeecCcccccCCCCCccCCCCCCCccCCcccCCCccccceeEEeccccccccCCCCccccc
Q 012266          219 TYGTLGAIVRSRTGNQQVGFLTNRHVAVDLDYPNQKMFHPLPPSLGPGVYLGAVERATSFITDDLWYGIFAGTNPETFVR  298 (467)
Q Consensus       219 ~aGTLGclV~D~~G~~~~yiLSNnHVla~~n~~~~~~~~~g~pIlQPg~~DGG~~~~~~fipl~~~~~~~~~~~p~N~vD  298 (467)
                      ..+|+||+|++.   +..|||||+||.....           ++.    .|+ . ..-+++..+         .|.+   
T Consensus        15 ~~CT~Gf~v~~~---~~~~ilTa~Hc~~~~~-----------~v~----~~~-~-~~g~vv~~~---------~~~~---   62 (198)
T 2h5c_A           15 SLCSVGFSVTRG---ATKGFVTAGHCGTVNA-----------TAR----IGG-A-VVGTFAARV---------FPGN---   62 (198)
T ss_dssp             EEEECCEEEEET---TEEEEEECGGGCCTTC-----------EEE----ETT-E-EEEEEEEEE---------CSBS---
T ss_pred             CCCCcCEEEecC---CeeEEEECcccCCCCC-----------EEE----eCC-c-EEEEEEecC---------CCCC---
Confidence            579999999985   5789999999986522           333    232 1 122333222         1334   


Q ss_pred             ccccccccccccCCCCcccccccccccCceeeecccCcccccCCCcEEEeeeccCceEEEEEEEEEEEeCCCCeEEEEEE
Q 012266          299 ADGAFIPFAEDFNLNNVTTSVKGVGEIGDVHIIDLQSPINSLIGRQVMKVGRSSGLTTGTVMAYALEYNDEKGICFFTDF  378 (467)
Q Consensus       299 aD~Ali~~a~~~d~s~vs~~I~~iG~iG~v~~v~l~g~~~p~lG~~V~KvGRTTGlT~G~I~ai~v~y~~~~G~~~f~dq  378 (467)
                       |+|+|++..   ....++.|...|   ..  +.+.+...+.+|+.|+|+|++||+|+|+|++++....+..+.  |+++
T Consensus        63 -D~Avi~i~~---~~~~~~~v~~~g---~~--~~v~g~~~~~vG~~V~~~G~~tg~t~G~V~~~~~~~~~~~g~--~~~~  131 (198)
T 2h5c_A           63 -DRAWVSLTS---AQTLLPRVANGS---SF--VTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGA--VRGL  131 (198)
T ss_dssp             -CEEEEEECT---TSEEEEEEEETT---EE--EECCBCCCCCTTCEEEEEETTTEEEEEEEEEEEEEEEETTEE--EEEE
T ss_pred             -CEEEEEeCC---CCccCceEecCC---ce--EEecCcccCCCCCeEEEeecCcceEEEEEEeeeeEEEeCCCe--Eeee
Confidence             569988762   223345554322   11  223567889999999999999999999999998433322233  7889


Q ss_pred             EEEcCCCCCCCCCCCccceEEeeccCCCCCceEEEEEecc-----CCCCccccccCCCCcceeeeechHHHHhhcCceEE
Q 012266          379 LVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGT-----ANRGRLKLKVGQPPVNWTSGVDLGRLLDLLELDLI  453 (467)
Q Consensus       379 iit~~~~~~fS~~GDSGSlvl~~~~~d~~~~~VGLlfgG~-----~~~g~~~~~~~~~~~~~t~~~pI~~VL~~L~V~Lv  453 (467)
                      +.+..    ++.+||||++|+     +.++++|||++++.     .+++      +......+||+||..+|++|+|+|+
T Consensus       132 i~t~~----~~~~GDSGGPl~-----~~~g~~vGI~s~~~~~~~~~~c~------~~~~~g~~f~~Pi~~vl~~~gv~l~  196 (198)
T 2h5c_A          132 TQGNA----CMGRGDSGGSWI-----TSAGQAQGVMSGGNVQSNGNNCG------IPASQRSSLFERLQPILSQYGLSLV  196 (198)
T ss_dssp             EEECS----CCBTTCTTCEEE-----CTTCBEEEEEEEECCCTTSBSTT------SCGGGCCEEEEEHHHHHHHHTCEEC
T ss_pred             EEecc----cCCCCcceeEEE-----eeCCEEEEEEEeecCccCCCccc------cccCCceEEEEEHHHHHHHCCcEEe
Confidence            88876    899999999999     78889999999985     2210      0012357999999999999999999


Q ss_pred             cC
Q 012266          454 AT  455 (467)
Q Consensus       454 t~  455 (467)
                      |+
T Consensus       197 t~  198 (198)
T 2h5c_A          197 TG  198 (198)
T ss_dssp             CC
T ss_pred             cC
Confidence            84
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 Back     alignment and structure
>1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>1ep5_B Capsid protein C, coat protein C; beta barrel, hydrolase; 2.30A {Venezuelan equine encephalitis virus} SCOP: b.47.1.3 PDB: 1ep6_A 3j0c_C Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>1vcp_A Semliki forest virus capsid protein; virus coat protein, polyprotein, transmembrane, glycoprotein, nucleocapsid protein, viral protein; 3.00A {Semliki forest virus} SCOP: b.47.1.3 PDB: 1dyl_A 1vcq_A Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1svp_A Sindbis virus capsid protein; chymotrypsin-like serine, mutant, coat protein, viral protein; 2.00A {Sindbis virus} SCOP: b.47.1.3 PDB: 1kxb_A 1kxa_A 2snw_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>4agk_A Capsid protein, coat protein, C; hydrolase, viral protein; 1.81A {Aura virus} PDB: 4agj_A 1kxa_A 2snw_A 1svp_A 1kxb_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query467
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 99.77
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 99.76
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 99.66
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 99.39
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 98.49
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.39
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 98.26
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 98.25
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 98.19
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 98.1
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 98.08
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 98.06
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 97.75
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 97.63
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 97.07
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 95.06
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 94.87
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 94.66
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 94.38
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 94.11
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 94.07
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 94.06
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 93.87
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 93.81
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 93.75
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 93.67
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 93.63
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 93.27
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 93.12
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 93.04
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 92.68
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 92.56
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 91.8
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 91.75
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 91.7
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 91.69
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 91.11
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 90.98
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 90.97
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 90.75
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 90.7
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 90.67
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 90.56
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 90.55
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 90.35
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 90.17
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 90.16
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 90.14
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 89.93
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 89.84
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 89.05
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 88.91
d1elva1259 Complement C1S protease, catalytic domain {Human ( 88.51
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 88.0
d1ep5a_156 Viral capsid protein {Venezuelan equine encephalit 87.83
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 87.79
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 87.77
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 87.74
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 87.42
d1wyka_152 Viral capsid protein {Sindbis virus [TaxId: 11034] 87.3
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 87.21
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 87.12
d1vcpa_149 Viral capsid protein {Semliki forest virus [TaxId: 86.82
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 86.79
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 86.04
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 85.6
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 85.19
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 84.53
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 83.14
d1mbma_198 NSP4 proteinase {Equine arteritis virus, EAV [TaxI 82.54
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 82.38
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease B
species: Streptomyces griseus, strain k1 [TaxId: 1911]

Probab=99.77  E-value=4e-18  Score=155.00  Aligned_cols=174  Identities=21%  Similarity=0.225  Sum_probs=118.3

Q ss_pred             ceeeeEEEEEeCCCCceeEEeecCcccccCCCCCccCCCCCCCccCCcccCCCccccceeEEeccccccccCCCCccccc
Q 012266          219 TYGTLGAIVRSRTGNQQVGFLTNRHVAVDLDYPNQKMFHPLPPSLGPGVYLGAVERATSFITDDLWYGIFAGTNPETFVR  298 (467)
Q Consensus       219 ~aGTLGclV~D~~G~~~~yiLSNnHVla~~n~~~~~~~~~g~pIlQPg~~DGG~~~~~~fipl~~~~~~~~~~~p~N~vD  298 (467)
                      ..+|+|+.|++.   ...|||||+||......            +.....++..  ...++ ..        ..|.+   
T Consensus        12 ~~CT~Gf~v~~~---~~~~ilTA~Hcv~~~~~------------~~~~~~~~~~--~g~~~-~~--------~~~~~---   62 (185)
T d2qaaa1          12 GRCSLGFNVRSG---STYYFLTAGHCTDGATT------------WWANSARTTV--LGTTS-GS--------SFPNN---   62 (185)
T ss_dssp             CEEECCEEEEET---TEEEEEECHHHHTTCCE------------EESSTTSCSE--EEEEE-EE--------ECSBS---
T ss_pred             CcEeeeEeEEEC---CccEEEECCCccCCCCE------------EEEEcCCCeE--eeeEE-ec--------cCCCC---
Confidence            469999999986   46799999999876432            1111122211  11111 00        12333   


Q ss_pred             ccccccccccccCCCCcccccccccccCceeeecccCcccccCCCcEEEeeeccCceEEEEEEEEEEEeCCCCeEEEEEE
Q 012266          299 ADGAFIPFAEDFNLNNVTTSVKGVGEIGDVHIIDLQSPINSLIGRQVMKVGRSSGLTTGTVMAYALEYNDEKGICFFTDF  378 (467)
Q Consensus       299 aD~Ali~~a~~~d~s~vs~~I~~iG~iG~v~~v~l~g~~~p~lG~~V~KvGRTTGlT~G~I~ai~v~y~~~~G~~~f~dq  378 (467)
                       |+||+++..   ...  +....+..      ..+.+...+.+|+.|+|.|++||++.|.|++++..+....+. .+.++
T Consensus        63 -D~All~~~~---~~~--~~~~~~~~------~~v~~~~~~~~G~~v~~~G~~tg~~~g~v~~~~~~~~~~~~~-~~~~~  129 (185)
T d2qaaa1          63 -DYGIVRYTN---TTI--PKDGTVGG------QDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGD-VVYGM  129 (185)
T ss_dssp             -CEEEEEECC---SSS--CCCSEETT------EECCEECCCCTTCEEEEEETTTEEEEEEEEEEEEEEECSTTC-EEEEE
T ss_pred             -CeEEEEecc---CCc--ccccccCc------eeccCCCcCCCCCEEEEccCCCCcccceeEeeEEEEEcCCCC-eeeeE
Confidence             679998762   111  11111111      122345678899999999999999999999998666554333 45677


Q ss_pred             EEEcCCCCCCCCCCCccceEEeeccCCCCCceEEEEEeccCCCCccccccCCCCcceeeeechHHHHhhcCceEE
Q 012266          379 LVVGENQQTFDLEGDSGSLILLTGQNGEKPRPVGIIWGGTANRGRLKLKVGQPPVNWTSGVDLGRLLDLLELDLI  453 (467)
Q Consensus       379 iit~~~~~~fS~~GDSGSlvl~~~~~d~~~~~VGLlfgG~~~~g~~~~~~~~~~~~~t~~~pI~~VL~~L~V~Lv  453 (467)
                      +.+..    ++.+||||+.|+     + .+++||+++++....         .....++|.||+.+|++|+|+|.
T Consensus       130 ~~~~~----~~~~GdSGGPv~-----~-~~~~vGi~~~g~~~~---------~~~~~~~~~Pi~~~l~~~g~~l~  185 (185)
T d2qaaa1         130 IRTNV----CAEPGDSGGPLY-----S-GTRAIGLTSGGSGNC---------SSGGTTFFQPVTEALSAYGVSVY  185 (185)
T ss_dssp             EEESC----CCCTTCTTCEEE-----E-TTEEEEEEEEEEEET---------TTEEEEEEEEHHHHHHHHTCEEC
T ss_pred             EEEee----eecCCcccceeE-----E-CCEEEEEEEEeecCC---------CCCceEEEEEHHHHHHHhCCeeC
Confidence            77766    799999999999     5 579999999986533         23467999999999999999983
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ep5a_ b.47.1.3 (A:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyka_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus [TaxId: 11033]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure
>d1mbma_ b.47.1.3 (A:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure