Citrus Sinensis ID: 012286


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460------
MVSMGVKELAMIKEYVLLVAGFIHGSCRGDFKLNNFQDGVLSSAFMVGLLVASPIFASLAKSHNPFRLIGVGLSVWTFATAGCGSSFDFWSIAICRMLVGVGEASFISLAAPFIDDNAPVPQKTAWLSMFYMCIPTGVALGYVYGGVVGSHLNWRYAFWGEAILMLPFAVLAFVIKPLQLKGFAPAESGKAQVVASVSEGSEASNLNDHVSEDISDQASERSIKSIGESRFLNQLSQFSQDTKVLLQEKVYVVNVLGYIAYNFVIGAYSYWGPKAGYNIYHMSNADMMFGGVTIVCGIVGTISGGFILDQMGATISNAFKLLSAATFLGAISCLTAFCLSSLYGFLALFTVGELLVFATQAPVNYVCLHSVKPSLRALSMAISTVSIHIFGDVPSSPLVGVLQDHVNNWRKTTLALTSIFFLAAGIWFVGIFLKSIDKFNEDGENQISLDSKANMKPLLEGNGDNL
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccc
MVSMGVKELAMIKEYVLLVAGFIHGSCRGDFKLNNFQDGVLSSAFMVGLLVASPIFASLAKSHNPFRLIGVGLSVWTFATAGCGSSFDFWSIAICRMLVGVGEASFISLAAPFIDDNAPVPQKTAWLSMFYMCIPTGVALGYVYGGVVGSHLNWRYAFWGEAILMLPFAVLAFVIKPLQLKGFA*AE****QVVASVSEGSEASNLNDHVSEDISDQASERSIKSIGESRFLNQLSQFSQDTKVLLQEKVYVVNVLGYIAYNFVIGAYSYWGPKAGYNIYHMSNADMMFGGVTIVCGIVGTISGGFILDQMGATISNAFKLLSAATFLGAISCLTAFCLSSLYGFLALFTVGELLVFATQAPVNYVCLHSVKPSLRALSMAISTVSIHIFGDVPSSPLVGVLQDHVNNWRKTTLALTSIFFLAAGIWFVGIFLKSIDKF***************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSMGVKELAMIKEYVLLVAGFIHGSCRGDFKLNNFQDGVLSSAFMVGLLVASPIFASLAKSHNPFRLIGVGLSVWTFATAGCGSSFDFWSIAICRMLVGVGEASFISLAAPFIDDNAPVPQKTAWLSMFYMCIPTGVALGYVYGGVVGSHLNWRYAFWGEAILMLPFAVLAFVIKPLQLKGFAPAESGKAQVVASVSEGSEASNLNDHVSEDISDQASERSIKSIGESRFLNQLSQFSQDTKVLLQEKVYVVNVLGYIAYNFVIGAYSYWGPKAGYNIYHMSNADMMFGGVTIVCGIVGTISGGFILDQMGATISNAFKLLSAATFLGAISCLTAFCLSSLYGFLALFTVGELLVFATQAPVNYVCLHSVKPSLRALSMAISTVSIHIFGDVPSSPLVGVLQDHVNNWRKTTLALTSIFFLAAGIWFVGIFLKSIDKFNEDGENQISLDSKANMKPLLEGNGDNL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable sphingolipid transporter spinster homolog 2 Probable sphingolipid transporter that plays a central role in endosomes and/or lysosomes storage.probableQ9FLG8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PW4, chain A
Confidence level:very confident
Coverage over the Query: 5-193,204,234-429
View the alignment between query and template
View the model in PyMOL
Template: 4GC0, chain A
Confidence level:confident
Coverage over the Query: 6-221,233-448
View the alignment between query and template
View the model in PyMOL