Citrus Sinensis ID: 012287

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460------

MTPIRILFILFLTHPQTSKPKNKTARITKVTKIWRKMDRVFSVGEISEQFWSNPPDASSKMNRSESEWAFQRFLQEAQQPTSSGDSKNDSVVEIKSAHISNNNNNNNNNTDNQNDNVKAGGGGGNVSKAATSALSFDGTQNLEDYQAVLKSKLNLACAAVALSRASCARPQDTADRADSGSQSSNTSQLGSQAPKGPVHDLSRSQNKDVNGLHGIPSISTTLKKPLVPVRSATSGSSRDLSEDDEAEGETATTENMDPVDAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKVKMAEETVKRITGLNPLLQGSPEMSSMSMSSFGGSHSDTSADATVPLQDDPKHHFFQPPSDNPVSSHDLRVNNALSDISSVENVQPNAGATAAASGNKIGRTVSLQRVASLEHLQKRIRGGVSPCGPNSSGEQ

cccHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccc

*TPIRILFILFLTHPQTS*******RITKVTKIWRKMDRVFSVGEISEQFW******************************************************************************************LEDYQAVLKSKLNLACAAVALS***********************************************************************************************************************AHLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKVKM*EETV*****************************************************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MTPIRILFILFLTHPQTSKPKNKTARITKVTKIWRKMDRVFSVGEISEQFWSNPPDASSKMNRSESEWAFQRFLQEAQQPTSSGDSKNDSVVEIKSAHISNNNNNNNNNTDNQNDNVKAGGGGGNVSKAATSALSFDGTQNLEDYQAVLKSKLNLACAAVALSRASCARPQDTADRADSGSQSSNTSQLGSQAPKGPVHDLSRSQNKDVNGLHGIPSISTTLKKPLVPVRSATSGSSRDLSEDDEAEGETATTENMDPVDAKRVRRMLSNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLTDISQKYNEAAVDxxxxxxxxxxxxxxxxxxxxxVKRITGLNPLLQGSPEMSSMSMSSFGGSHSDTSADATVPLQDDPKHHFFQPPSDNPVSSHDLRVNNALSDISSVENVQPNAGATAAASGNKIGRTVSLQRVASLEHLQKRIRGGVSPCGPNSSGEQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Light-inducible protein CPRF2	Binds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.	probable	Q99090

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WT7, chain A
Confidence level:confident
Coverage over the Query: 261-315
View the alignment between query and template
View the model in PyMOL

Template: 3A5T, chain A
Confidence level:confident
Coverage over the Query: 258-303,318-334
View the alignment between query and template
View the model in PyMOL