Citrus Sinensis ID: 012287

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460------
MTPIRILFILFLTHPQTSKPKNKTARITKVTKIWRKMDRVFSVGEISEQFWSNPPDASSKMNRSESEWAFQRFLQEAQQPTSSGDSKNDSVVEIKSAHISNNNNNNNNNTDNQNDNVKAGGGGGNVSKAATSALSFDGTQNLEDYQAVLKSKLNLACAAVALSRASCARPQDTADRADSGSQSSNTSQLGSQAPKGPVHDLSRSQNKDVNGLHGIPSISTTLKKPLVPVRSATSGSSRDLSEDDEAEGETATTENMDPVDAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKVKMAEETVKRITGLNPLLQGSPEMSSMSMSSFGGSHSDTSADATVPLQDDPKHHFFQPPSDNPVSSHDLRVNNALSDISSVENVQPNAGATAAASGNKIGRTVSLQRVASLEHLQKRIRGGVSPCGPNSSGEQ
cccHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccc
cccHEEEEEEEcccccccccccccEEEHHHHHHHHHHHHEEcHHHccccccccccccccHcccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEcccccccccccccccHcccccccEEEccccccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHcccccEHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccc
MTPIRILFILFLthpqtskpknktaRITKVTKIWRKMDRVFsvgeiseqfwsnppdasskmnrsESEWAFQRFLQEaqqptssgdskndsVVEIKSAHIsnnnnnnnnntdnqndnvkagggggnvsKAATsalsfdgtqNLEDYQAVLKSKLNLACAAVALSRascarpqdtadradsgsqssntsqlgsqapkgpvhdlsrsqnkdvnglhgipsisttlkkplvpvrsatsgssrdlseddeaegetattenmdpvDAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKVKMAEETVKRItglnpllqgspemssmsmssfggshsdtsadatvplqddpkhhffqppsdnpvsshdlrvnnalsdissvenvqpnagataAASGNKIGRTVSLQRVASLEHLQKRirggvspcgpnssgeq
MTPIRILFILflthpqtskpknktariTKVTKIWRKMDRVFsvgeiseqfwsnppdasSKMNRSESEWAFQRFLQEaqqptssgdskNDSVVEIKSAHisnnnnnnnnntDNQNDNVKAGGGGGNVSKAATSALSFDGTQNLEDYQAVLKSKLNLACAAVALSRASCARPQDTAdradsgsqssntsqlgsqapkgpVHDLSRSQNKDVNGLHGipsisttlkkplvpvrsatsgssrdlseddeaegetattenmdpvdakrvrrmlsnresarrsrrrkqahlteletqvsqlrvenSSLLKRLTDISqkyneaavdnrvlkaDVETLRAKVKmaeetvkritglnpllqgspEMSSMSMSSFGGSHSDTSADATVPLQDDPKHHFFQPPSDNPVSSHDLRVNNALSDISSVENVQPNAGATAAASGNKIGRTVSLQRVASLEHLqkrirggvspcgpnssgeq
MTPIRILFILFLTHPQTSKPKNKTARITKVTKIWRKMDRVFSVGEISEQFWSNPPDASSKMNRSESEWAFQRFLQEAQQPTSSGDSKNDSVVEIKSAHISnnnnnnnnntdnqndnVKAGGGGGNVSKAATSALSFDGTQNLEDYQAVLKSKLNLACAAVALSRASCARPQDTADRADSGSQSSNTSQLGSQAPKGPVHDLSRSQNKDVNGLHGIPSISTTLKKPLVPVRSATSGSSRDLSeddeaegetatteNMDPVDAKRVRRMLsnresarrsrrrKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKVKMAEETVKRITGLNPLLQgspemssmsmssfggshsdtsADATVPLQDDPKHHFFQPPSDNPVSSHDLRVNNALSDISSVENVQPNAGATAAASGNKIGRTVSLQRVASLEHLQKRIRGGVSPCGPNSSGEQ
***IRILFILFLTHP********TARITKVTKIWRKMDRVFSVGEISEQFW******************************************************************************************LEDYQAVLKSKLNLACAAVALS**********************************************************************************************************************************************LTDISQKYNEAAVDNRVLKADVETLRAKVKM**********************************************************************************************************************************
*TPIRILFILFLTHPQTS*********TKVTKIWRKMDRVFSVGEISEQ*************************************************************************************************************************************************************************************************************************************RRKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNE*A**NRVLKADVETLR*KVKM*EETV*****************************************************************************************************************************
MTPIRILFILFLTHPQT********RITKVTKIWRKMDRVFSVGEISEQFWSNP***********SEWAFQRFLQE*************SVVEIKSAHISNNNNNNNNNTDNQNDNVKAGGGGGNVSKAATSALSFDGTQNLEDYQAVLKSKLNLACAAVALSR****************************************QNKDVNGLHGIPSISTTLKKPLV**************************ENMDPVDAKRVRRML***************HLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKVKMAEETVKRITGLNPLLQGSPE*****************ADATVPLQDDPKHHFFQPPSDNPVSSHDLRVNNALSDISSVENVQPNAGATAAASGNKIGRTVSLQRVASLEHLQKRIRGGV***********
*TPIRILFILFLTHPQTSKPKNKTARITKVTKIWRKMDRVFSVGEISEQFWSN**************WAFQRFLQEAQ**********************************************************DGTQNLEDYQAVLKSKLNLACAAVALSRASC********************************************LHGI*******************************************************************AHLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKVKMAEETVKRITGLNPLLQGSPE*SS**************ADATVPLQDDPKHHFFQPPSDNPVSSHDLRVNNALSDISSV************************Q************R**************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPIRILFILFLTHPQTSKPKNKTARITKVTKIWRKMDRVFSVGEISEQFWSNPPDASSKMNRSESEWAFQRFLQEAQQPTSSGDSKNDSVVEIKSAHISNNNNNNNNNTDNQNDNVKAGGGGGNVSKAATSALSFDGTQNLEDYQAVLKSKLNLACAAVALSRASCARPQDTADRADSGSQSSNTSQLGSQAPKGPVHDLSRSQNKDVNGLHGIPSISTTLKKPLVPVRSATSGSSRDLSEDDEAEGETATTENMDPVDAKRVRRMLSNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLTDISQKYNEAAVDxxxxxxxxxxxxxxxxxxxxxVKRITGLNPLLQGSPEMSSMSMSSFGGSHSDTSADATVPLQDDPKHHFFQPPSDNPVSSHDLRVNNALSDISSVENVQPNAGATAAASGNKIGRTVSLQRVASLEHLQKRIRGGVSPCGPNSSGEQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query466 2.2.26 [Sep-21-2011]
Q99090401 Light-inducible protein C N/A no 0.824 0.957 0.568 1e-105
B9DGI8314 Basic leucine zipper 63 O yes no 0.654 0.971 0.419 1e-55
O22763411 Basic leucine zipper 10 O no no 0.633 0.717 0.4 5e-43
Q9M1G6403 Basic leucine zipper 25 O no no 0.633 0.732 0.394 3e-38
Q9FUD3277 Basic leucine zipper 9 OS no no 0.375 0.631 0.466 3e-29
P12959453 Regulatory protein opaque N/A no 0.515 0.529 0.349 1e-27
P23922349 Transcription factor HBP- N/A no 0.221 0.295 0.365 9e-09
P24068151 Ocs element-binding facto N/A no 0.195 0.602 0.386 1e-08
Q04088398 Probable transcription fa no no 0.231 0.271 0.324 6e-08
P42777270 G-box-binding factor 4 OS no no 0.118 0.203 0.527 4e-07
>sp|Q99090|CPRF2_PETCR Light-inducible protein CPRF2 OS=Petroselinum crispum GN=CPRF2 PE=2 SV=2 Back     alignment and function desciption
 Score =  382 bits (982), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 254/447 (56%), Positives = 300/447 (67%), Gaps = 63/447 (14%)

Query: 37  MDRVFSVGEISEQFWSNPP-DASSK--MNRSESEWAFQRFLQEAQ-----QPTSS----- 83
           MDRVFSV +IS+QFWS P  + SSK  MNRS+SEWAFQ FLQ+A      QP  S     
Sbjct: 1   MDRVFSVEDISDQFWSPPAREDSSKLVMNRSDSEWAFQSFLQQASALESSQPLPSDPVPV 60

Query: 84  -GDSKNDSVVEIKSAHISNNNNNNNNNTDNQNDNVKAGGGGGNVSKAATSALSFDGTQNL 142
            GD KN   VEI +                   NV                         
Sbjct: 61  AGDVKNP--VEIPA-------------------NVPVDS--------------------- 78

Query: 143 EDYQAVLKSKLNLACAAVALSRASCARPQDTADRADSGSQSSNTSQLGSQAP-KGPVHDL 201
           EDYQA LKS+L+LACAAVAL+RAS  +PQD+A   D+GSQ+SNTSQL SQ P KG  HDL
Sbjct: 79  EDYQAYLKSRLDLACAAVALTRASSLKPQDSAALLDNGSQASNTSQLVSQVPPKGSGHDL 138

Query: 202 SRSQNKDVNGLHGIPSISTTLKKPLVPVRSATSGSSRDLSEDD-EAEGETATTENMDPVD 260
           S+ ++K+       P +    KK  + V+S TSGSSRD S+DD E EGET TT N DP D
Sbjct: 139 SKEEDKEALAATATPLLPALQKKSAIQVKSTTSGSSRDHSDDDDELEGETETTRNGDPSD 198

Query: 261 AKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDN 320
           AKRVRRMLSNRESARRSRRRKQAH+TELETQVSQLRVENSSLLKRLTDISQ+YN+AAVDN
Sbjct: 199 AKRVRRMLSNRESARRSRRRKQAHMTELETQVSQLRVENSSLLKRLTDISQRYNDAAVDN 258

Query: 321 RVLKADVETLRAKVKMAEETVKRITGLNPLLQG-SPEMSSMSMSSFGGSHSDTSADATVP 379
           RVLKAD+ET+RAKVKMAEETVKR+TGLNP+ Q  S E+S++ M SF GS SDTSAD T  
Sbjct: 259 RVLKADIETMRAKVKMAEETVKRVTGLNPMFQSMSSEISTIGMQSFSGSPSDTSADTT-- 316

Query: 380 LQDDPKHHFFQPPSDNPVSSHDLRVNNALSDISSVENVQPNAGATAAASGNKIGRTVSLQ 439
            QD  K HF+QP   + + + D ++ N L  +  V+N+Q ++ A+    GNK+ RT S+Q
Sbjct: 317 -QDGSKQHFYQPAPTSHMPAQDQKIQNGLLQVPPVDNLQQHS-ASGPVEGNKMERTSSMQ 374

Query: 440 RVASLEHLQKRIRGGVSPCGPNSSGEQ 466
           RVASLEHLQKRIRGGVS C    SG+Q
Sbjct: 375 RVASLEHLQKRIRGGVSSCEAQVSGKQ 401
Binds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.
Petroselinum crispum (taxid: 4043)
>sp|B9DGI8|BZP63_ARATH Basic leucine zipper 63 OS=Arabidopsis thaliana GN=BZIP63 PE=1 SV=1 Back     alignment and function description
>sp|O22763|BZP10_ARATH Basic leucine zipper 10 OS=Arabidopsis thaliana GN=BZIP10 PE=1 SV=2 Back     alignment and function description
>sp|Q9M1G6|BZP25_ARATH Basic leucine zipper 25 OS=Arabidopsis thaliana GN=BZIP25 PE=1 SV=1 Back     alignment and function description
>sp|Q9FUD3|BZIP9_ARATH Basic leucine zipper 9 OS=Arabidopsis thaliana GN=BZIP9 PE=1 SV=1 Back     alignment and function description
>sp|P12959|OP2_MAIZE Regulatory protein opaque-2 OS=Zea mays GN=O2 PE=1 SV=1 Back     alignment and function description
>sp|P23922|HBP1A_WHEAT Transcription factor HBP-1a OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|P24068|OCS1_MAIZE Ocs element-binding factor 1 OS=Zea mays GN=OBF1 PE=2 SV=2 Back     alignment and function description
>sp|Q04088|POF21_ARATH Probable transcription factor PosF21 OS=Arabidopsis thaliana GN=POSF21 PE=2 SV=1 Back     alignment and function description
>sp|P42777|GBF4_ARATH G-box-binding factor 4 OS=Arabidopsis thaliana GN=GBF4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query466
255580955453 Light-inducible protein CPRF-2, putative 0.912 0.938 0.643 1e-141
224131278385 predicted protein [Populus trichocarpa] 0.819 0.992 0.638 1e-127
16797791450 bZIP transcription factor [Nicotiana tab 0.892 0.924 0.579 1e-122
224123412371 predicted protein [Populus trichocarpa] 0.776 0.975 0.624 1e-121
225451342423 PREDICTED: light-inducible protein CPRF2 0.873 0.962 0.622 1e-121
147796457446 hypothetical protein VITISV_022136 [Viti 0.856 0.894 0.601 1e-116
351720703417 bZIP protein [Glycine max] gi|183014149| 0.851 0.952 0.579 1e-114
444300790444 bZIP transcription factor family protein 0.869 0.912 0.560 1e-112
351724709378 G/HBF-1 protein [Glycine max] gi|1905785 0.693 0.854 0.677 1e-110
351725229404 bZIP transcription factor bZIP89 [Glycin 0.834 0.962 0.570 1e-108
>gi|255580955|ref|XP_002531296.1| Light-inducible protein CPRF-2, putative [Ricinus communis] gi|223529129|gb|EEF31109.1| Light-inducible protein CPRF-2, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  506 bits (1304), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 294/457 (64%), Positives = 336/457 (73%), Gaps = 32/457 (7%)

Query: 37  MDRVFSVGEISEQFWSN------------PPDASSKMNRSESEWAFQRFLQEAQQPTSSG 84
           MDRVFSV  ISEQFWS               D+S K+NRS SEWAFQRFLQEA    S+ 
Sbjct: 1   MDRVFSVDGISEQFWSPPLPPPPPSSSSSAEDSSKKINRSASEWAFQRFLQEANSVASTT 60

Query: 85  D--------------SKNDSVVEIKSAHISNNNNNNNNNTDNQNDNVKAGGGGGNVSKAA 130
           D              + +D+VVEIK    + NN N  N++   + N +   G        
Sbjct: 61  DSSSSSDVVVRDNHKTSDDAVVEIKD---NKNNTNKYNDSSVSSANAQISNGRCAPPPFN 117

Query: 131 TSALSFDGTQNLEDYQAVLKSKLNLACAAVALSRASCARPQDTADRADSGSQSSNTSQLG 190
            +A   +   + EDYQA LKSKLNLACAAVA SRAS  +P+D++ RADSG Q+SNTSQLG
Sbjct: 118 AAAPPPNIPADSEDYQAFLKSKLNLACAAVAQSRASFLKPEDSSARADSGLQASNTSQLG 177

Query: 191 SQAP-KGPVHDLSRSQNKDVNGLHGIPSISTTLKKPLVPVRSATSGSSRDLSEDDEAEGE 249
           S AP KG  HD+ RSQ  DV+G  GIPS+ +T KK +VP++  TSGSSR+ S+DDE EGE
Sbjct: 178 SHAPSKGAGHDVFRSQEVDVDGSVGIPSLPSTHKKSVVPLKPTTSGSSREQSDDDENEGE 237

Query: 250 TATTENMDPVDAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDI 309
           T  TENMDP DAKRVRRMLSNRESARRSRRRKQAHLTELETQV+QLRVENSSLLKRLTDI
Sbjct: 238 TELTENMDPTDAKRVRRMLSNRESARRSRRRKQAHLTELETQVAQLRVENSSLLKRLTDI 297

Query: 310 SQKYNEAAVDNRVLKADVETLRAKVKMAEETVKRITGLNPLLQGSPEMSSMSMSSFGGSH 369
           S KYNE+AVDNRVLKADVETLRAKVKMAEETVKRITGLN L    PEMS+MSM SF GS 
Sbjct: 298 SHKYNESAVDNRVLKADVETLRAKVKMAEETVKRITGLNSLFHTIPEMSTMSMPSFDGSP 357

Query: 370 SDTSADATVPLQDDPKHHFFQPPSDNPVSSHDLRVNNALSDISSVENVQPNAGATAAASG 429
           SDTS DA VP+QDD +H F+QPP +NP+S+HD RVNNAL+DISSVENVQP++GA A   G
Sbjct: 358 SDTSTDAAVPVQDDTEHQFYQPP-NNPLSTHDPRVNNALADISSVENVQPHSGA-AGLGG 415

Query: 430 NKIGRTVSLQRVASLEHLQKRIRGGVSPCGPNSSGEQ 466
           NK+GRT SLQRVASLEHLQKRIRGG +PC   SSGE 
Sbjct: 416 NKMGRTASLQRVASLEHLQKRIRGGATPCETQSSGEH 452

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224131278|ref|XP_002328499.1| predicted protein [Populus trichocarpa] gi|222838214|gb|EEE76579.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|16797791|gb|AAL27150.1| bZIP transcription factor [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|224123412|ref|XP_002319072.1| predicted protein [Populus trichocarpa] gi|222857448|gb|EEE94995.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225451342|ref|XP_002279520.1| PREDICTED: light-inducible protein CPRF2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147796457|emb|CAN74806.1| hypothetical protein VITISV_022136 [Vitis vinifera] Back     alignment and taxonomy information
>gi|351720703|ref|NP_001237953.1| bZIP protein [Glycine max] gi|183014149|dbj|BAG24402.1| bZIP protein [Glycine max] Back     alignment and taxonomy information
>gi|444300790|gb|AGD98704.1| bZIP transcription factor family protein 6 [Camellia sinensis] Back     alignment and taxonomy information
>gi|351724709|ref|NP_001236299.1| G/HBF-1 protein [Glycine max] gi|1905785|emb|CAA71687.1| G/HBF-1 [Glycine max] Back     alignment and taxonomy information
>gi|351725229|ref|NP_001237085.1| bZIP transcription factor bZIP89 [Glycine max] gi|113367196|gb|ABI34655.1| bZIP transcription factor bZIP89 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query466
TAIR|locus:2184251314 BZO2H3 "AT5G28770" [Arabidopsi 0.315 0.468 0.493 5.3e-47
TAIR|locus:505006398403 BZIP25 "basic leucine zipper 2 0.377 0.436 0.439 4.4e-36
TAIR|locus:2149403277 BZIP9 "AT5G24800" [Arabidopsis 0.332 0.559 0.390 2.4e-19
TAIR|locus:2827461166 bZIP48 "AT2G04038" [Arabidopsi 0.221 0.620 0.300 5.3e-06
TAIR|locus:2053124171 bZIP2 "AT2G18160" [Arabidopsis 0.178 0.485 0.325 1.9e-05
TAIR|locus:2009932196 bZIP58 "AT1G13600" [Arabidopsi 0.212 0.505 0.28 0.00019
TAIR|locus:2092595173 bZIP42 "AT3G30530" [Arabidopsi 0.165 0.445 0.311 0.00021
TAIR|locus:2184251 BZO2H3 "AT5G28770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 327 (120.2 bits), Expect = 5.3e-47, Sum P(3) = 5.3e-47
 Identities = 76/154 (49%), Positives = 99/154 (64%)

Query:   197 PVHDLSRSQNKDVNGLHGIPSISTTLKKPLVPVRSATSGSSRDLSXXXXXXXXXXXXXNM 256
             P     RS N   N      S++++   P++   + TSGS  +LS             NM
Sbjct:    95 PQDTSGRSDNGGANESEQA-SLASSKATPMMS-SAITSGS--ELSGDEEEADGET---NM 147

Query:   257 DPVDAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEA 316
             +P + KRV+RML            KQAHL+ELETQVSQLRVENS L+K LTD++Q +N+A
Sbjct:   148 NPTNVKRVKRMLSNRESARRSRRRKQAHLSELETQVSQLRVENSKLMKGLTDVTQTFNDA 207

Query:   317 AVDNRVLKADVETLRAKVKMAEETVKRITGLNPL 350
             +V+NRVLKA++ETLRAKVKMAEETVKR+TG NP+
Sbjct:   208 SVENRVLKANIETLRAKVKMAEETVKRLTGFNPM 241
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0005515 "protein binding" evidence=IPI
GO:0042802 "identical protein binding" evidence=IPI
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:0071333 "cellular response to glucose stimulus" evidence=IEP
GO:0071215 "cellular response to abscisic acid stimulus" evidence=IEP
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
TAIR|locus:505006398 BZIP25 "basic leucine zipper 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149403 BZIP9 "AT5G24800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827461 bZIP48 "AT2G04038" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053124 bZIP2 "AT2G18160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009932 bZIP58 "AT1G13600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092595 bZIP42 "AT3G30530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q99090CPRF2_PETCRNo assigned EC number0.56820.82400.9576N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query466
pfam12498112 pfam12498, bZIP_C, Basic leucine-zipper C terminal 7e-38
smart0033865 smart00338, BRLZ, basic region leucin zipper 2e-16
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 6e-11
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 5e-07
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 4e-06
>gnl|CDD|221605 pfam12498, bZIP_C, Basic leucine-zipper C terminal Back     alignment and domain information 
 Score =  133 bits (337), Expect = 7e-38
 Identities = 69/131 (52%), Positives = 83/131 (63%), Gaps = 19/131 (14%)

Query: 329 TLRAKVKMAEETVKRITGLNPLLQGSPEMSSMSMSSFGGSHSDTSADATVPLQDDPKHHF 388
           TLRAKVKMAE+TVKR+TGLNPLLQ   EMSSM M   G   SD S+DA+VP+QD+  ++F
Sbjct: 1   TLRAKVKMAEDTVKRVTGLNPLLQAISEMSSMGMPFSG--PSDASSDASVPIQDNSSNYF 58

Query: 389 FQPPSDNPVSSHDLRVNNALSDISSVENVQPNAGATAAASGNKIGRTVSLQRVASLEHLQ 448
            QP  +  ++ HD +                      A +G K+GRT SLQRVASLEHLQ
Sbjct: 59  QQPAVNPGITVHDDQPELG-----------------GATAGGKMGRTPSLQRVASLEHLQ 101

Query: 449 KRIRGGVSPCG 459
           KRIRGGVS   
Sbjct: 102 KRIRGGVSSST 112

This family of proteins is found in eukaryotes. Proteins in this family are typically between 174 and 411 amino acids in length. The family is found in association with pfam00170. There is a conserved KVK sequence motif. There is a single completely conserved residue K that may be functionally important. Various bZIP proteins have been found and shown to play a role in seed-specific gene expression. bZIP binds to the alpha-globulin gene promoter, but not to promoters of other major storage genes such as glutelin, prolamin and albumin. Length = 112
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 466
PF12498115 bZIP_C: Basic leucine-zipper C terminal; InterPro: 99.94
smart0033865 BRLZ basic region leucin zipper. 99.33
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.29
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 99.2
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 99.17
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.0
KOG3584348 consensus cAMP response element binding protein an 98.96
KOG0709472 consensus CREB/ATF family transcription factor [Tr 98.86
KOG0837279 consensus Transcriptional activator of the JUN fam 98.08
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.0
KOG4571294 consensus Activating transcription factor 4 [Trans 97.14
KOG4196135 consensus bZIP transcription factor MafK [Transcri 96.91
KOG3119269 consensus Basic region leucine zipper transcriptio 96.66
TIGR0244965 conserved hypothetical protein TIGR02449. Members 96.6
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 96.32
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 96.01
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 95.56
PRK10884206 SH3 domain-containing protein; Provisional 94.77
TIGR0244965 conserved hypothetical protein TIGR02449. Members 94.62
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 94.55
PRK13169110 DNA replication intiation control protein YabA; Re 94.51
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 94.37
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 94.2
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 94.13
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 94.12
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 93.35
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 93.34
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 92.81
PRK13169110 DNA replication intiation control protein YabA; Re 92.77
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 92.76
PRK10884206 SH3 domain-containing protein; Provisional 92.74
PF13851201 GAS: Growth-arrest specific micro-tubule binding 92.21
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 92.07
PRK11637 428 AmiB activator; Provisional 92.0
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 91.85
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 91.75
COG307479 Uncharacterized protein conserved in bacteria [Fun 91.32
PF0489970 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 Th 90.77
COG4467114 Regulator of replication initiation timing [Replic 90.47
PRK1542279 septal ring assembly protein ZapB; Provisional 90.36
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 89.87
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 89.64
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 89.36
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 88.46
PRK11637428 AmiB activator; Provisional 88.43
PRK1542279 septal ring assembly protein ZapB; Provisional 88.29
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 88.29
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 87.51
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 87.48
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 87.45
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 87.31
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 87.24
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 87.22
COG4467114 Regulator of replication initiation timing [Replic 87.15
COG4026290 Uncharacterized protein containing TOPRIM domain, 87.1
PF10186302 Atg14: UV radiation resistance protein and autopha 86.96
PRK09039343 hypothetical protein; Validated 86.85
COG3883265 Uncharacterized protein conserved in bacteria [Fun 86.49
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 86.47
TIGR03495135 phage_LysB phage lysis regulatory protein, LysB fa 86.46
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 86.41
COG4942 420 Membrane-bound metallopeptidase [Cell division and 86.36
PF1374789 DUF4164: Domain of unknown function (DUF4164) 86.29
PF09755 310 DUF2046: Uncharacterized conserved protein H4 (DUF 85.94
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 85.9
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 85.81
COG307479 Uncharacterized protein conserved in bacteria [Fun 85.65
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 85.25
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 85.21
PF06785401 UPF0242: Uncharacterised protein family (UPF0242); 85.18
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 85.16
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 85.06
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 84.98
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 84.32
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 84.01
TIGR00219283 mreC rod shape-determining protein MreC. MreC (mur 83.78
PF1157768 NEMO: NF-kappa-B essential modulator NEMO; InterPr 83.53
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 83.14
PRK0211973 hypothetical protein; Provisional 83.08
COG2433652 Uncharacterized conserved protein [Function unknow 83.03
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 82.99
PF14662193 CCDC155: Coiled-coil region of CCDC155 82.95
PF0537755 FlaC_arch: Flagella accessory protein C (FlaC); In 82.88
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 82.79
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 82.62
PHA03162135 hypothetical protein; Provisional 82.49
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 81.97
PF15294278 Leu_zip: Leucine zipper 81.94
COG4026290 Uncharacterized protein containing TOPRIM domain, 81.7
PF14662193 CCDC155: Coiled-coil region of CCDC155 81.51
PRK09039343 hypothetical protein; Validated 81.34
PRK0440675 hypothetical protein; Provisional 81.29
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 81.18
PLN02678 448 seryl-tRNA synthetase 81.12
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 80.83
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 80.76
PHA02562562 46 endonuclease subunit; Provisional 80.72
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 80.54
PRK0211973 hypothetical protein; Provisional 80.42
PRK0029568 hypothetical protein; Provisional 80.25
>PF12498 bZIP_C: Basic leucine-zipper C terminal; InterPro: IPR020983 Basic leucine-zipper (bZIP) proteins are found in eukaryotes Back     alignment and domain information 
Probab=99.94  E-value=5.1e-27  Score=206.08  Aligned_cols=115  Identities=54%  Similarity=0.757  Sum_probs=96.6

Q ss_pred             HHHHHHHHHHHHHHHHhccCccccCCCCCCCCCCCCCCCCCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCcccccCccc
Q 012287          329 TLRAKVKMAEETVKRITGLNPLLQGSPEMSSMSMSSFGGSHSDTSADATVPLQDDPKHHFFQPPSDNPVSSHDLRVNNAL  408 (466)
Q Consensus       329 ~Lr~kl~maE~~v~Rl~~ln~~l~~~~~~~~~~mp~~~gs~s~~s~~~~vp~q~~~~~~f~~~~~n~~~~~~~~~~~n~~  408 (466)
                      +||+|||||||+|||++|++++|++++++++++||++ +++++...++++|+||++.|||+++.+|..++.|+    |  
T Consensus         1 TLRAKVKMAEe~VkRvTg~n~~~~~~~~~ss~~~p~~-~~~s~~~~~~~~Piq~~~~~~~~~~~~~~~i~~~~----~--   73 (115)
T PF12498_consen    1 TLRAKVKMAEETVKRVTGMNPMFQAISQMSSMGMPFS-SSPSPADSSAAVPIQDNSNNYFHQPNPNPTISVHG----N--   73 (115)
T ss_pred             ChhHHHHHHHHHHHHHhccCccccccccCCCCCCCCC-CCcccccccccCCccCCchhhccCCCCCCCcCCCC----c--
Confidence            5999999999999999999999999999999999965 55566555599999999999999998887766553    0  


Q ss_pred             cccccccccCCCcccccccccCcCCCccccchhhhHHHHhhhhcCCCCCCC
Q 012287          409 SDISSVENVQPNAGATAAASGNKIGRTVSLQRVASLEHLQKRIRGGVSPCG  459 (466)
Q Consensus       409 ~~~~~~~~~q~~~~~~~~~~~~~m~~~~s~q~vaslehlqkri~~~~~~~~  459 (466)
                               +.++...+.+.+.||+|+++|||||||||||||||||++||+
T Consensus        74 ---------~~~~~~~~~~~~~~~~~t~smqrvaslEhlQkri~~g~~~~~  115 (115)
T PF12498_consen   74 ---------NDNPEPGGAFVGGKMGRTASMQRVASLEHLQKRIRGGPTSST  115 (115)
T ss_pred             ---------ccccccccccccccccCCccCccchhHHHHHHHhcCCCCCCC
Confidence                     112222355688999999999999999999999999999985

They are typically between 174 and 411 amino acids in length. Various bZIP proteins have been found and shown to play a role in seed-specific gene expression. bZIP binds to the alpha-globulin gene promoter, but not to promoters of other major storage genes such as glutelin, prolamin and albumin []. This entry represents a C-terminal domain found in bZIP proteins. It is found in association with PF00170 from PFAM. There is a conserved KVK sequence motif and a single completely conserved residue K that may be functionally important.
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04899 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 The MbeD and MobD proteins are plasmid encoded, and are involved in the plasmid mobilisation and transfer in the presence of conjugative plasmids [] Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>TIGR03495 phage_LysB phage lysis regulatory protein, LysB family Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PF11577 NEMO: NF-kappa-B essential modulator NEMO; InterPro: IPR021063 This entry represents a conserved domain found at the N-terminal of NF-kappa-B essential modulator (NEMO) and optineurin proteins Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PHA03162 hypothetical protein; Provisional Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PLN02678 seryl-tRNA synthetase Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query466
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 1e-15
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 3e-10
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 2e-09
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 8e-09
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 8e-09
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 1e-08
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 3e-08
2wt7_B90 Transcription factor MAFB; transcription, transcri 5e-08
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 2e-06
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 3e-06
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 4e-05
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
 Score = 70.1 bits (172), Expect = 1e-15
 Identities = 20/52 (38%), Positives = 34/52 (65%)

Query: 262 KRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKY 313
           KR  R++ NRE+AR SRR+K+ ++  LE +V+ L  +N +L++ L  +   Y
Sbjct: 1   KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY 52
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query466
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.51
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.26
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.18
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.12
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.07
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 98.85
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 98.84
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.42
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.4
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.37
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.1
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 97.01
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 95.63
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 94.87
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 94.77
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 93.47
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 93.13
1deb_A54 APC protein, adenomatous polyposis coli protein; c 93.11
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 91.27
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 90.96
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 90.68
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 90.49
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 90.14
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 89.76
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 88.4
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 88.27
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 87.99
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 87.79
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 86.47
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 86.19
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 85.84
3cve_A72 Homer protein homolog 1; coiled coil, alternative 84.83
1wlq_A83 Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z 84.69
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 84.63
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 84.41
3m48_A33 General control protein GCN4; leucine zipper, synt 84.4
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 84.25
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 84.23
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 84.22
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 84.21
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 83.75
2kz5_A91 Transcription factor NF-E2 45 kDa subunit; structu 83.72
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 83.55
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 83.41
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 83.4
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 83.04
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 82.88
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 82.57
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 82.48
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 82.47
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 82.23
2v4h_A110 NF-kappa-B essential modulator; transcription, met 82.03
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 81.68
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 81.63
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 81.22
1p9i_A31 Cortexillin I/GCN4 hybrid peptide; coiled-coil, un 80.89
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 80.71
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 80.36
4emc_A190 Monopolin complex subunit CSM1; RWD domain, kineto 80.36
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.51  E-value=1.8e-14  Score=111.00  Aligned_cols=52  Identities=38%  Similarity=0.626  Sum_probs=48.9

Q ss_pred             HHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 012287          262 KRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKY  313 (466)
Q Consensus       262 KR~RRmLsNRESARRSR~RKq~~LeELE~qV~~Le~ENs~L~~ql~~L~q~~  313 (466)
                      ||++||++||+||++||.||++|+++||.+|..|+.||..|..++..|++.|
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~   52 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY   52 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            6899999999999999999999999999999999999999999998887654
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1p9i_A Cortexillin I/GCN4 hybrid peptide; coiled-coil, unknown function; 1.17A {Synthetic} SCOP: h.1.10.1 Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query466
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 90.16
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=90.16  E-value=0.065  Score=41.78  Aligned_cols=29  Identities=24%  Similarity=0.413  Sum_probs=24.4

Q ss_pred             HHHHHHHHHHhHHHHHHHHHHHHHHHHHH
Q 012287          260 DAKRVRRMLSNRESARRSRRRKQAHLTEL  288 (466)
Q Consensus       260 D~KR~RRmLsNRESARRSR~RKq~~LeEL  288 (466)
                      -.+-.||.=+|+.+|++||+||....++|
T Consensus        46 lirDIRRRGKNKvAAqnCRKRKld~~d~l   74 (74)
T d1sknp_          46 LIRKIRRRGKNKVAARTCRQRRTDRHDKM   74 (74)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTTTC
T ss_pred             HHHHHHHhcccHHHHHHHHHhhhhhhccC
Confidence            35778899999999999999998876543