Citrus Sinensis ID: 012352


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-----
MESPNLLVASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYDRARELAETVGGHALSLADLENFNPEDGMILANTTSIGMQPKVDETPIPKV
cccccEEEEEccEEEcccccccccEEEEEEccccHHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHcccccccEEEEEcccccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHccccccccccccccccccccccccHHHHHHHHHccccccccEEEEEEEccccccccHHHHHHHHHHcccccEEEEcccccHHHHHHHHccccccEEEEccccHHHHHHHcccccHHHHHcccccEEEEEccccEEEEEccHHHHHHHHHHHHHcccccccccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHcccccccccccccccccccEEEEcccccccccccccccccc
cccccEEEEccccccHHHHcccccEEEEEEEcccHHHHHHHHHHHHHccccEEEEEEHHcccccHHHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHccccEEEEEccccccHHHHEcccccccccccccccccccccccccHHHHHHHHHHHccccccEEEEEEEcccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHccccccEEEEccccccHHHHHccEEcHHHHHHccccEEEEccccccEEccccHHHHHHHHHHHHccccccccccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHcccccccHHHHHHcccccccEEEEEccccccccccccccccc
mespnllvasgsklvsggmrknptlicvpimgeSVDKMVVDMGKANASGADLVEIRLdglknfnpreniktlikespvptlftyrpiweggqydgdeneRVDVLRLAMELGADYIDVELQVAREFNdsirgkkpekcKVIVSshnyqytpsveDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAkfggfltfgtlengivsapgqptiKDLLDLYnfrqmgpdtkvfgiigkpvghskspilyneafksvgfNGVFVHLLVDDIAKFFQtyssndfagfsctiphkeaavkccDEVDTVAKSIGAVNciirrqsdgklfgyntdyvGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYDRARELAETVGghalsladlenfnpedgmilanttsigmqpkvdetpipkv
mespnllvasgsklvsggmrknpTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGlknfnpreniktlikespvptlFTYRpiweggqydgdeNERVDVLRLAMELGADYIDVELQVAREfndsirgkkpekCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKsigavnciirrqsdgklfgYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALaygakakgarVVIANRTYDRARELAETVGGHALSLADLENFNPEDGMILANttsigmqpkvdetpipkv
MESPNLLVASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIgaggagkalaygakakgaRVVIANRTYDRARELAETVGGHALSLADLENFNPEDGMILANTTSIGMQPKVDETPIPKV
*********************NPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYDRARELAETVGGHALSLADLENFNPEDGMIL********************
***********************TLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLEN****APGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYDRARELAETVGGHALSLADLENFNPEDGMILANTTSIGMQPKVDETPIPKV
MESPNLLVASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYDRARELAETVGGHALSLADLENFNPEDGMILANTTSIGMQPKVDETPIPKV
***PNLLVASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGR******VSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYDRARELAETVGGHALSLADLENFNPEDGMILANTTSIGMQPKVDETP****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESPNLLVASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYDRARELAETVGGHALSLADLENFNPEDGMILANTTSIGMQPKVDETPIPKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query465 2.2.26 [Sep-21-2011]
Q9SQT8603 Bifunctional 3-dehydroqui yes no 0.997 0.769 0.737 0.0
Q74ZZ11577 Pentafunctional AROM poly yes no 0.815 0.240 0.284 7e-35
C5DN021579 Pentafunctional AROM poly yes no 0.776 0.228 0.297 1e-34
Q6CJC41578 Pentafunctional AROM poly yes no 0.763 0.224 0.307 1e-33
C4R4R81545 Pentafunctional AROM poly yes no 0.851 0.256 0.313 3e-33
Q6FIV41579 Pentafunctional AROM poly yes no 0.776 0.228 0.312 6e-33
A8QCB21611 Pentafunctional AROM poly N/A no 0.767 0.221 0.296 6e-33
C8Z5431588 Pentafunctional AROM poly N/A no 0.776 0.227 0.286 1e-31
P085661588 Pentafunctional AROM poly yes no 0.776 0.227 0.286 1e-31
C5FQ731571 Pentafunctional AROM poly N/A no 0.8 0.236 0.291 1e-31
>sp|Q9SQT8|DHQSD_ARATH Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic OS=Arabidopsis thaliana GN=EMB3004 PE=1 SV=1 Back     alignment and function desciption
 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/469 (73%), Positives = 400/469 (85%), Gaps = 5/469 (1%)

Query: 1   MESPNLLVASGS---KLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRL 57
           ME  N+ VAS S   ++ S  + KNP+LIC P+M +S+DKMV++  KA+  GADLVEIRL
Sbjct: 68  MEPSNVYVASNSTEMEIGSHDIVKNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRL 127

Query: 58  DGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDV 117
           D LK+FNP E++KT+IK+SP+PTLFTYRP WEGGQY+GDENER DVLRLAMELGADYIDV
Sbjct: 128 DWLKDFNPLEDLKTIIKKSPLPTLFTYRPKWEGGQYEGDENERRDVLRLAMELGADYIDV 187

Query: 118 ELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTAL 177
           ELQVA EF  SI GKKP K KVIVSSHNYQ TPSVEDL  LVARIQ +GADIVK ATTA+
Sbjct: 188 ELQVASEFIKSIDGKKPGKFKVIVSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAV 247

Query: 178 DITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTI 237
           DI DVAR+F IT  +QVP IGLVMGERGL+SRILC+KFGG+LTFGTL++  VSAPGQPTI
Sbjct: 248 DIADVARMFHITSKAQVPTIGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTI 307

Query: 238 KDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFF 297
           KDLLDLYNFR++GPDTKV+GIIGKPV HSKSPI++N+AFKSV FNGV+VHLLVD++  F 
Sbjct: 308 KDLLDLYNFRRIGPDTKVYGIIGKPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFL 367

Query: 298 QTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGA 357
           Q YSS+DFAGFSCTIPHKEAA++CCDEVD +AKSIGAVN I+RR+SDGKL GYNTD +G+
Sbjct: 368 QAYSSSDFAGFSCTIPHKEAALQCCDEVDPLAKSIGAVNTILRRKSDGKLLGYNTDCIGS 427

Query: 358 ISAIEDGLR--GRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYD 415
           ISAIEDGLR  G  +     SS LA K  VVIGAGGAGKALAYGAK KGA+VVIANRTY+
Sbjct: 428 ISAIEDGLRSSGDPSSVPSSSSPLASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYE 487

Query: 416 RARELAETVGGHALSLADLENFNPEDGMILANTTSIGMQPKVDETPIPK 464
           RA ELAE +GG ALSL DL+N++PEDGM+LANTTS+GMQP V+ETPI K
Sbjct: 488 RALELAEAIGGKALSLTDLDNYHPEDGMVLANTTSMGMQPNVEETPISK 536





Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 5
>sp|Q74ZZ1|ARO1_ASHGO Pentafunctional AROM polypeptide OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARO1 PE=3 SV=2 Back     alignment and function description
>sp|C5DN02|ARO1_LACTC Pentafunctional AROM polypeptide OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=ARO1 PE=3 SV=1 Back     alignment and function description
>sp|Q6CJC4|ARO1_KLULA Pentafunctional AROM polypeptide OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARO1 PE=3 SV=1 Back     alignment and function description
>sp|C4R4R8|ARO1_PICPG Pentafunctional AROM polypeptide OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ARO1 PE=3 SV=1 Back     alignment and function description
>sp|Q6FIV4|ARO1_CANGA Pentafunctional AROM polypeptide OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARO1 PE=3 SV=1 Back     alignment and function description
>sp|A8QCB2|ARO1_MALGO Pentafunctional AROM polypeptide OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MGL_3989 PE=3 SV=1 Back     alignment and function description
>sp|C8Z543|ARO1_YEAS8 Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=ARO1 PE=3 SV=1 Back     alignment and function description
>sp|P08566|ARO1_YEAST Pentafunctional AROM polypeptide OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO1 PE=1 SV=1 Back     alignment and function description
>sp|C5FQ73|ARO1_ARTOC Pentafunctional AROM polypeptide OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04845 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query465
224107417538 dehydroquinate dehydratase/ shikimate de 0.965 0.834 0.819 0.0
255551621539 shikimate dehydrogenase, putative [Ricin 0.963 0.831 0.819 0.0
359477446522 PREDICTED: bifunctional 3-dehydroquinate 0.965 0.860 0.816 0.0
58047529508 3-dehydroquinate dehydratase/shikimate 5 0.948 0.868 0.825 0.0
76782194536 putative 3-dehydroquinate dehydratase/sh 0.984 0.854 0.776 0.0
356495945527 PREDICTED: bifunctional 3-dehydroquinate 0.989 0.872 0.765 0.0
297736925495 unnamed protein product [Vitis vinifera] 0.918 0.862 0.824 0.0
449503035542 PREDICTED: bifunctional 3-dehydroquinate 0.956 0.821 0.773 0.0
388521847515 unknown [Medicago truncatula] 0.952 0.860 0.765 0.0
449461453542 PREDICTED: bifunctional 3-dehydroquinate 0.956 0.821 0.769 0.0
>gi|224107417|ref|XP_002314474.1| dehydroquinate dehydratase/ shikimate dehydrogenase [Populus trichocarpa] gi|222863514|gb|EEF00645.1| dehydroquinate dehydratase/ shikimate dehydrogenase [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/449 (81%), Positives = 407/449 (90%)

Query: 16  SGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKE 75
           SGG+R+NPTLIC PIM +SVDKM + M +A + GADLVEIRLD LK+FNP  +IKTLI  
Sbjct: 23  SGGVRRNPTLICTPIMADSVDKMAILMAEAKSVGADLVEIRLDSLKDFNPNSDIKTLILH 82

Query: 76  SPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPE 135
           SP+PTLFTYRP+WEGGQY+GDE  R+D LRLAMELGADYIDVEL+VA EFN+ +RG KP 
Sbjct: 83  SPLPTLFTYRPMWEGGQYNGDEKPRLDALRLAMELGADYIDVELKVAHEFNELLRGNKPG 142

Query: 136 KCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVP 195
           KCK+IVSSHNY+ TPSVE+L NLVARIQA+GADIVK ATTALDI+DVAR+FQITVHSQVP
Sbjct: 143 KCKLIVSSHNYENTPSVEELGNLVARIQAAGADIVKIATTALDISDVARIFQITVHSQVP 202

Query: 196 IIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKV 255
           IIGLVMGERGLISRILCAKFGG+LTFGTLE+G+VSAPGQPTIKDLLDLYNFR +GPDTKV
Sbjct: 203 IIGLVMGERGLISRILCAKFGGYLTFGTLESGVVSAPGQPTIKDLLDLYNFRLIGPDTKV 262

Query: 256 FGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHK 315
           FGIIGKPVGHSKSP+L+NEAFKSVG NGV+VHLLVDDIA+F QTYSS DFAGFSCTIPHK
Sbjct: 263 FGIIGKPVGHSKSPVLFNEAFKSVGINGVYVHLLVDDIARFLQTYSSTDFAGFSCTIPHK 322

Query: 316 EAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGV 375
           E A KCCDEV  VAKSIGAVNCIIRRQ+DGKLFGYNTDYVGAISAIE+GLR   NVS  V
Sbjct: 323 EDAAKCCDEVHPVAKSIGAVNCIIRRQNDGKLFGYNTDYVGAISAIEEGLRASQNVSNTV 382

Query: 376 SSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYDRARELAETVGGHALSLADLE 435
            S LAGKLFVVIGAGGAGKALAYGAK KGARVVIANRTY+RA+ LA+ +GG A++LADLE
Sbjct: 383 GSPLAGKLFVVIGAGGAGKALAYGAKEKGARVVIANRTYERAKVLADIIGGDAITLADLE 442

Query: 436 NFNPEDGMILANTTSIGMQPKVDETPIPK 464
           NF+PEDGMILANTTSIGMQPKVDETP+ K
Sbjct: 443 NFHPEDGMILANTTSIGMQPKVDETPVSK 471




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255551621|ref|XP_002516856.1| shikimate dehydrogenase, putative [Ricinus communis] gi|223543944|gb|EEF45470.1| shikimate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359477446|ref|XP_002277395.2| PREDICTED: bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|58047529|gb|AAW65140.1| 3-dehydroquinate dehydratase/shikimate 5-dehydrogenase [Juglans regia] Back     alignment and taxonomy information
>gi|76782194|gb|ABA54867.1| putative 3-dehydroquinate dehydratase/shikimate dehydrogenase [Fagus sylvatica] Back     alignment and taxonomy information
>gi|356495945|ref|XP_003516831.1| PREDICTED: bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|297736925|emb|CBI26126.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449503035|ref|XP_004161812.1| PREDICTED: bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388521847|gb|AFK48985.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449461453|ref|XP_004148456.1| PREDICTED: bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query465
TAIR|locus:2081036603 MEE32 "MATERNAL EFFECT EMBRYO 0.997 0.769 0.701 2.7e-171
SGD|S0000025341588 ARO1 "Pentafunctional arom pro 0.701 0.205 0.292 1e-28
TIGR_CMR|CBU_2075233 CBU_2075 "3-dehydroquinate deh 0.462 0.922 0.32 5e-28
TIGR_CMR|BA_4561308 BA_4561 "shikimate 5-dehydroge 0.421 0.636 0.333 4.3e-26
POMBASE|SPAC1834.021573 aro1 "pentafunctional aromatic 0.673 0.198 0.315 1.5e-25
ASPGD|ASPL00000559691583 aromA [Emericella nidulans (ta 0.668 0.196 0.303 2.9e-21
CGD|CAL00043461551 ARO1 [Candida albicans (taxid: 0.761 0.228 0.276 4.8e-21
TIGR_CMR|DET_0466222 DET_0466 "3-dehydroquinate deh 0.449 0.941 0.325 1.3e-20
TIGR_CMR|CHY_0623280 CHY_0623 "shikimate 5-dehydrog 0.421 0.7 0.313 2.8e-20
TIGR_CMR|SPO_3891277 SPO_3891 "shikimate 5-dehydrog 0.419 0.703 0.339 7.7e-20
TAIR|locus:2081036 MEE32 "MATERNAL EFFECT EMBRYO ARREST 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1665 (591.2 bits), Expect = 2.7e-171, P = 2.7e-171
 Identities = 329/469 (70%), Positives = 383/469 (81%)

Query:     1 MESPNLLVASGS---KLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRL 57
             ME  N+ VAS S   ++ S  + KNP+LIC P+M +S+DKMV++  KA+  GADLVEIRL
Sbjct:    68 MEPSNVYVASNSTEMEIGSHDIVKNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRL 127

Query:    58 DGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDV 117
             D LK+FNP E++KT+IK+SP+PTLFTYRP WEGGQY+GDENER DVLRLAMELGADYIDV
Sbjct:   128 DWLKDFNPLEDLKTIIKKSPLPTLFTYRPKWEGGQYEGDENERRDVLRLAMELGADYIDV 187

Query:   118 ELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTAL 177
             ELQVA EF  SI GKKP K KVIVSSHNYQ TPSVEDL  LVARIQ +GADIVK ATTA+
Sbjct:   188 ELQVASEFIKSIDGKKPGKFKVIVSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAV 247

Query:   178 DITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTI 237
             DI DVAR+F IT  +QVP IGLVMGERGL+SRILC+KFGG+LTFGTL++  VSAPGQPTI
Sbjct:   248 DIADVARMFHITSKAQVPTIGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTI 307

Query:   238 KDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFF 297
             KDLLDLYNFR++GPDTKV+GIIGKPV HSKSPI++N+AFKSV FNGV+VHLLVD++  F 
Sbjct:   308 KDLLDLYNFRRIGPDTKVYGIIGKPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFL 367

Query:   298 QTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGA 357
             Q YSS+DFAGFSCTIPHKEAA++CCDEVD +AKSIGAVN I+RR+SDGKL GYNTD +G+
Sbjct:   368 QAYSSSDFAGFSCTIPHKEAALQCCDEVDPLAKSIGAVNTILRRKSDGKLLGYNTDCIGS 427

Query:   358 ISAIEDGLRGRLNVSG--GVSSALAGKLFVVIXXXXXXXXXXXXXXXXXXRVVIANRTYD 415
             ISAIEDGLR   + S     SS LA K  VVI                  +VVIANRTY+
Sbjct:   428 ISAIEDGLRSSGDPSSVPSSSSPLASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYE 487

Query:   416 RARELAETVGGHALSLADLENFNPEDGMILANTTSIGMQPKVDETPIPK 464
             RA ELAE +GG ALSL DL+N++PEDGM+LANTTS+GMQP V+ETPI K
Sbjct:   488 RALELAEAIGGKALSLTDLDNYHPEDGMVLANTTSMGMQPNVEETPISK 536




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0003855 "3-dehydroquinate dehydratase activity" evidence=IEA;IDA
GO:0004764 "shikimate 3-dehydrogenase (NADP+) activity" evidence=IEA;IDA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP;NAS
GO:0050661 "NADP binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0019632 "shikimate metabolic process" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0006865 "amino acid transport" evidence=RCA
SGD|S000002534 ARO1 "Pentafunctional arom protein" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_2075 CBU_2075 "3-dehydroquinate dehydratase, type I" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4561 BA_4561 "shikimate 5-dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
POMBASE|SPAC1834.02 aro1 "pentafunctional aromatic polypeptide Aro1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000055969 aromA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0004346 ARO1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0466 DET_0466 "3-dehydroquinate dehydratase, type I" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0623 CHY_0623 "shikimate 5-dehydrogenase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3891 SPO_3891 "shikimate 5-dehydrogenase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SQT8DHQSD_ARATH1, ., 1, ., 1, ., 2, 50.73770.99780.7694yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.2.1.100.946
3rd Layer1.1.10.963
3rd Layer4.2.10.963
4th Layer1.1.1.250.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
DHQD4
dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25) (518 aa)
(Populus trichocarpa)
Predicted Functional Partners:
DHQS6
SubName- Full=Putative uncharacterized protein; (375 aa)
   0.971
SK2
shikimate kinase (EC-2.7.1.71) (286 aa)
     0.932
SK3
shikimate kinase (EC-2.7.1.71) (294 aa)
     0.931
SKp
shikimate kinase (EC-2.7.1.71) (223 aa)
      0.927
SK1
shikimate kinase (EC-2.7.1.71) (286 aa)
     0.920
DHQD5
dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25 4.2.1.10) (504 aa)
     0.903
DHQD3
dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25 4.2.1.10) (518 aa)
     0.902
DHQD1
dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25 4.2.1.10) (518 aa)
     0.902
DHQD2
dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25) (521 aa)
     0.901
EPSPS
3-phosphoshikimate 1-carboxyvinyltransferase (EC-2.5.1.19) (519 aa)
    0.751

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query465
PLN02520529 PLN02520, PLN02520, bifunctional 3-dehydroquinate 0.0
pfam01487222 pfam01487, DHquinase_I, Type I 3-dehydroquinase 3e-83
TIGR01093228 TIGR01093, aroD, 3-dehydroquinate dehydratase, typ 3e-72
cd00502225 cd00502, DHQase_I, Type I 3-dehydroquinase, (3-deh 2e-65
COG0169283 COG0169, AroE, Shikimate 5-dehydrogenase [Amino ac 9e-61
PRK00258278 PRK00258, aroE, shikimate 5-dehydrogenase; Reviewe 7e-58
COG0710231 COG0710, AroD, 3-dehydroquinate dehydratase [Amino 2e-52
PRK09310477 PRK09310, aroDE, bifunctional 3-dehydroquinate deh 2e-46
TIGR00507270 TIGR00507, aroE, shikimate 5-dehydrogenase 2e-43
PRK02412253 PRK02412, aroD, 3-dehydroquinate dehydratase; Prov 1e-40
PRK12548289 PRK12548, PRK12548, shikimate 5-dehydrogenase; Pro 9e-30
pfam0850183 pfam08501, Shikimate_dh_N, Shikimate dehydrogenase 2e-28
PRK13575238 PRK13575, PRK13575, 3-dehydroquinate dehydratase; 2e-25
TIGR01809282 TIGR01809, Shik-DH-AROM, shikimate-5-dehydrogenase 2e-21
PRK12549284 PRK12549, PRK12549, shikimate 5-dehydrogenase; Rev 2e-19
cd01065155 cd01065, NAD_bind_Shikimate_DH, NAD(P) binding dom 4e-19
PRK12749288 PRK12749, PRK12749, quinate/shikimate dehydrogenas 1e-17
pfam01488133 pfam01488, Shikimate_DH, Shikimate / quinate 5-deh 5e-15
PRK12550272 PRK12550, PRK12550, shikimate 5-dehydrogenase; Rev 9e-12
PRK00045 423 PRK00045, hemA, glutamyl-tRNA reductase; Reviewed 5e-11
PRK14027283 PRK14027, PRK14027, quinate/shikimate dehydrogenas 2e-10
cd05213311 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-bindi 9e-10
COG0373 414 COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme m 5e-09
TIGR01035 417 TIGR01035, hemA, glutamyl-tRNA reductase 2e-07
PRK13576216 PRK13576, PRK13576, 3-dehydroquinate dehydratase; 1e-06
cd08944 246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 5e-05
PRK07890 258 PRK07890, PRK07890, short chain dehydrogenase; Pro 1e-04
PRK08277 278 PRK08277, PRK08277, D-mannonate oxidoreductase; Pr 2e-04
cd08934 243 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase 2e-04
PRK08642 253 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-04
PRK12823 260 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1 3e-04
PRK08324 681 PRK08324, PRK08324, short chain dehydrogenase; Val 5e-04
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 6e-04
PRK05872 296 PRK05872, PRK05872, short chain dehydrogenase; Pro 8e-04
PRK07067 257 PRK07067, PRK07067, sorbitol dehydrogenase; Provis 0.001
pfam0380793 pfam03807, F420_oxidored, NADP oxidoreductase coen 0.001
PRK07231 251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 0.002
smart01002149 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT 0.002
cd05305 359 cd05305, L-AlaDH, Alanine dehydrogenase NAD-bindin 0.002
PRK12384 259 PRK12384, PRK12384, sorbitol-6-phosphate dehydroge 0.003
cd05327 269 cd05327, retinol-DH_like_SDR_c_like, retinol dehyd 0.004
PRK07041 230 PRK07041, PRK07041, short chain dehydrogenase; Pro 0.004
cd00401 402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 0.004
>gnl|CDD|178135 PLN02520, PLN02520, bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
 Score =  889 bits (2299), Expect = 0.0
 Identities = 373/462 (80%), Positives = 410/462 (88%), Gaps = 1/462 (0%)

Query: 3   SPNLLVASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKN 62
                +AS     SGG+R+NPTLICVPIM +SVDKM+++M KA   GADLVEIRLD LKN
Sbjct: 2   VSTASLASDDLQGSGGVRRNPTLICVPIMADSVDKMLIEMAKAKELGADLVEIRLDFLKN 61

Query: 63  FNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVA 122
           FNPRE++KTLIK+SP+PTL TYRP WEGGQY+GDEN+R D LRLAMELGADY+DVEL+VA
Sbjct: 62  FNPREDLKTLIKQSPLPTLVTYRPKWEGGQYEGDENKRQDALRLAMELGADYVDVELKVA 121

Query: 123 REFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDV 182
            EF +SI GKKPEKCKVIVSSHNY+ TPSVE+L NLVARIQA+GADIVK ATTALDITDV
Sbjct: 122 HEFINSISGKKPEKCKVIVSSHNYENTPSVEELGNLVARIQATGADIVKIATTALDITDV 181

Query: 183 ARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLD 242
           AR+FQITVHSQVP IGLVMGERGLISRILC KFGG+LTFGTLE G VSAPGQPTIKDLLD
Sbjct: 182 ARMFQITVHSQVPTIGLVMGERGLISRILCPKFGGYLTFGTLEAGKVSAPGQPTIKDLLD 241

Query: 243 LYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSS 302
           LYNFRQ+GPDTKV+GIIGKPVGHSKSPIL+NEAFKSVGFNGV+VHLLVDD+AKF QTYSS
Sbjct: 242 LYNFRQIGPDTKVYGIIGKPVGHSKSPILHNEAFKSVGFNGVYVHLLVDDLAKFLQTYSS 301

Query: 303 NDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIE 362
            DFAGFSCTIPHKE A+KCCDEVD +AKSIGA+N IIRR SDGKL GYNTDY+GAISAIE
Sbjct: 302 PDFAGFSCTIPHKEDALKCCDEVDPIAKSIGAINTIIRRPSDGKLVGYNTDYIGAISAIE 361

Query: 363 DGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYDRARELAE 422
           DGLR     S    S LAGKLFVVIGAGGAGKALAYGAK KGARVVIANRTY+RA+ELA+
Sbjct: 362 DGLRA-SGSSPASGSPLAGKLFVVIGAGGAGKALAYGAKEKGARVVIANRTYERAKELAD 420

Query: 423 TVGGHALSLADLENFNPEDGMILANTTSIGMQPKVDETPIPK 464
            VGG AL+LADLENF+PE+GMILANTTS+GMQP VDETPI K
Sbjct: 421 AVGGQALTLADLENFHPEEGMILANTTSVGMQPNVDETPISK 462


Length = 529

>gnl|CDD|216526 pfam01487, DHquinase_I, Type I 3-dehydroquinase Back     alignment and domain information
>gnl|CDD|233268 TIGR01093, aroD, 3-dehydroquinate dehydratase, type I Back     alignment and domain information
>gnl|CDD|188633 cd00502, DHQase_I, Type I 3-dehydroquinase, (3-dehydroquinate dehydratase or DHQase) Back     alignment and domain information
>gnl|CDD|223247 COG0169, AroE, Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234703 PRK00258, aroE, shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|223782 COG0710, AroD, 3-dehydroquinate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|137204 PRK09310, aroDE, bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>gnl|CDD|161904 TIGR00507, aroE, shikimate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|235036 PRK02412, aroD, 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|183585 PRK12548, PRK12548, shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|149523 pfam08501, Shikimate_dh_N, Shikimate dehydrogenase substrate binding domain Back     alignment and domain information
>gnl|CDD|184156 PRK13575, PRK13575, 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|233580 TIGR01809, Shik-DH-AROM, shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>gnl|CDD|183586 PRK12549, PRK12549, shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|133443 cd01065, NAD_bind_Shikimate_DH, NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>gnl|CDD|183721 PRK12749, PRK12749, quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|216527 pfam01488, Shikimate_DH, Shikimate / quinate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|183587 PRK12550, PRK12550, shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|234592 PRK00045, hemA, glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>gnl|CDD|172521 PRK14027, PRK14027, quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133452 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>gnl|CDD|223450 COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|233242 TIGR01035, hemA, glutamyl-tRNA reductase Back     alignment and domain information
>gnl|CDD|237433 PRK13576, PRK13576, 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236216 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR Back     alignment and domain information
>gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|202773 pfam03807, F420_oxidored, NADP oxidoreductase coenzyme F420-dependent Back     alignment and domain information
>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|214966 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain Back     alignment and domain information
>gnl|CDD|240630 cd05305, L-AlaDH, Alanine dehydrogenase NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235914 PRK07041, PRK07041, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 465
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 100.0
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 100.0
PRK02412253 aroD 3-dehydroquinate dehydratase; Provisional 100.0
COG0710231 AroD 3-dehydroquinate dehydratase [Amino acid tran 100.0
TIGR01093228 aroD 3-dehydroquinate dehydratase, type I. Type II 100.0
PF01487224 DHquinase_I: Type I 3-dehydroquinase; InterPro: IP 100.0
PRK13575238 3-dehydroquinate dehydratase; Provisional 100.0
cd00502225 DHQase_I Type I 3-dehydroquinase, (3-dehydroquinat 100.0
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 100.0
PRK13576216 3-dehydroquinate dehydratase; Provisional 100.0
PRK14027283 quinate/shikimate dehydrogenase; Provisional 100.0
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 100.0
PRK12549284 shikimate 5-dehydrogenase; Reviewed 100.0
PRK12548289 shikimate 5-dehydrogenase; Provisional 100.0
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 100.0
PRK01261229 aroD 3-dehydroquinate dehydratase; Provisional 100.0
PRK12550272 shikimate 5-dehydrogenase; Reviewed 100.0
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 100.0
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 100.0
KOG0692595 consensus Pentafunctional AROM protein [Amino acid 99.95
PF0850183 Shikimate_dh_N: Shikimate dehydrogenase substrate 99.93
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.82
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 99.43
PRK13940 414 glutamyl-tRNA reductase; Provisional 99.12
PRK08291 330 ectoine utilization protein EutC; Validated 99.1
TIGR02992 326 ectoine_eutC ectoine utilization protein EutC. Mem 99.07
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 99.06
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 99.02
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 98.96
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.65
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.65
cd05311 226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 98.63
PLN00203 519 glutamyl-tRNA reductase 98.58
COG0300 265 DltE Short-chain dehydrogenases of various substra 98.5
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.5
COG4221 246 Short-chain alcohol dehydrogenase of unknown speci 98.36
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.32
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 98.28
PRK00676338 hemA glutamyl-tRNA reductase; Validated 98.15
KOG1201 300 consensus Hydroxysteroid 17-beta dehydrogenase 11 98.14
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.12
KOG1205 282 consensus Predicted dehydrogenase [Secondary metab 98.11
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.06
PRK06141 314 ornithine cyclodeaminase; Validated 98.04
PRK07340304 ornithine cyclodeaminase; Validated 98.0
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 98.0
PRK08618 325 ornithine cyclodeaminase; Validated 97.97
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.95
KOG1208 314 consensus Dehydrogenases with different specificit 97.93
KOG0725 270 consensus Reductases with broad range of substrate 97.88
TIGR00518 370 alaDH alanine dehydrogenase. The family of known L 97.87
PRK05872 296 short chain dehydrogenase; Provisional 97.86
KOG1200 256 consensus Mitochondrial/plastidial beta-ketoacyl-A 97.86
COG3967 245 DltE Short-chain dehydrogenase involved in D-alani 97.85
PRK05854 313 short chain dehydrogenase; Provisional 97.85
PRK08339 263 short chain dehydrogenase; Provisional 97.83
PRK08862 227 short chain dehydrogenase; Provisional 97.78
KOG1207 245 consensus Diacetyl reductase/L-xylulose reductase 97.78
PRK07523 255 gluconate 5-dehydrogenase; Provisional 97.77
PRK06139 330 short chain dehydrogenase; Provisional 97.74
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 97.73
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 97.73
PRK05876 275 short chain dehydrogenase; Provisional 97.71
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 97.69
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.69
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 97.67
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 97.66
PRK08265 261 short chain dehydrogenase; Provisional 97.66
PRK05867 253 short chain dehydrogenase; Provisional 97.66
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 97.65
PRK07062 265 short chain dehydrogenase; Provisional 97.65
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 97.64
PRK06196 315 oxidoreductase; Provisional 97.64
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.64
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.64
PRK06718 202 precorrin-2 dehydrogenase; Reviewed 97.63
PRK07063 260 short chain dehydrogenase; Provisional 97.62
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 97.61
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 97.61
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.6
PRK07825 273 short chain dehydrogenase; Provisional 97.59
PRK06720169 hypothetical protein; Provisional 97.59
PRK05717 255 oxidoreductase; Validated 97.59
PRK05866 293 short chain dehydrogenase; Provisional 97.58
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 97.57
PRK14982 340 acyl-ACP reductase; Provisional 97.57
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.56
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.56
PRK07060 245 short chain dehydrogenase; Provisional 97.55
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.55
PRK06194 287 hypothetical protein; Provisional 97.55
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.54
PRK12481 251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 97.54
PRK08589 272 short chain dehydrogenase; Validated 97.54
PRK06500 249 short chain dehydrogenase; Provisional 97.53
PRK08277 278 D-mannonate oxidoreductase; Provisional 97.52
KOG1014 312 consensus 17 beta-hydroxysteroid dehydrogenase typ 97.52
PRK07109 334 short chain dehydrogenase; Provisional 97.52
PRK06057 255 short chain dehydrogenase; Provisional 97.51
PRK08594 257 enoyl-(acyl carrier protein) reductase; Provisiona 97.51
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.5
PRK07478 254 short chain dehydrogenase; Provisional 97.5
PRK07889 256 enoyl-(acyl carrier protein) reductase; Provisiona 97.5
PRK06949 258 short chain dehydrogenase; Provisional 97.5
PRK07067 257 sorbitol dehydrogenase; Provisional 97.49
PRK06197 306 short chain dehydrogenase; Provisional 97.49
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.49
PLN02253 280 xanthoxin dehydrogenase 97.49
PRK06603 260 enoyl-(acyl carrier protein) reductase; Provisiona 97.49
PRK08085 254 gluconate 5-dehydrogenase; Provisional 97.49
PRK08690 261 enoyl-(acyl carrier protein) reductase; Provisiona 97.48
PRK06182 273 short chain dehydrogenase; Validated 97.48
PRK12367 245 short chain dehydrogenase; Provisional 97.47
PRK07453 322 protochlorophyllide oxidoreductase; Validated 97.47
PRK07791 286 short chain dehydrogenase; Provisional 97.44
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 97.44
PLN02780 320 ketoreductase/ oxidoreductase 97.43
PRK06719157 precorrin-2 dehydrogenase; Validated 97.43
PRK09242 257 tropinone reductase; Provisional 97.42
PRK06997 260 enoyl-(acyl carrier protein) reductase; Provisiona 97.41
PRK06180 277 short chain dehydrogenase; Provisional 97.41
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 97.41
PRK12742 237 oxidoreductase; Provisional 97.39
PRK05993 277 short chain dehydrogenase; Provisional 97.39
PRK07370 258 enoyl-(acyl carrier protein) reductase; Validated 97.39
PLN03209 576 translocon at the inner envelope of chloroplast su 97.38
PRK07774 250 short chain dehydrogenase; Provisional 97.38
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 97.37
PRK12936 245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 97.37
PRK06484 520 short chain dehydrogenase; Validated 97.36
PRK06125 259 short chain dehydrogenase; Provisional 97.36
PRK08251 248 short chain dehydrogenase; Provisional 97.36
PRK08303 305 short chain dehydrogenase; Provisional 97.36
PRK06940 275 short chain dehydrogenase; Provisional 97.36
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.36
KOG1209 289 consensus 1-Acyl dihydroxyacetone phosphate reduct 97.36
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.35
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 97.34
PRK06484 520 short chain dehydrogenase; Validated 97.34
PRK09072 263 short chain dehydrogenase; Provisional 97.33
PRK07890 258 short chain dehydrogenase; Provisional 97.32
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 97.32
PRK07097 265 gluconate 5-dehydrogenase; Provisional 97.31
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 97.31
PRK06138 252 short chain dehydrogenase; Provisional 97.31
PRK07814 263 short chain dehydrogenase; Provisional 97.31
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 97.31
PRK08340 259 glucose-1-dehydrogenase; Provisional 97.3
PRK07831 262 short chain dehydrogenase; Provisional 97.3
PRK07035 252 short chain dehydrogenase; Provisional 97.3
PRK09186 256 flagellin modification protein A; Provisional 97.3
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 97.28
PRK06114 254 short chain dehydrogenase; Provisional 97.28
PRK08643 256 acetoin reductase; Validated 97.28
PRK07024 257 short chain dehydrogenase; Provisional 97.27
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.27
PRK08213 259 gluconate 5-dehydrogenase; Provisional 97.26
PRK07666 239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.26
PRK07326 237 short chain dehydrogenase; Provisional 97.24
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 97.24
PRK07677 252 short chain dehydrogenase; Provisional 97.24
PRK08267 260 short chain dehydrogenase; Provisional 97.23
PRK07454 241 short chain dehydrogenase; Provisional 97.23
PRK06124 256 gluconate 5-dehydrogenase; Provisional 97.22
PRK09291 257 short chain dehydrogenase; Provisional 97.22
PRK06483 236 dihydromonapterin reductase; Provisional 97.22
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.2
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.2
PRK07576 264 short chain dehydrogenase; Provisional 97.19
PRK06398 258 aldose dehydrogenase; Validated 97.18
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 97.18
PRK08628 258 short chain dehydrogenase; Provisional 97.17
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.17
PRK12939 250 short chain dehydrogenase; Provisional 97.17
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 97.17
PRK12829 264 short chain dehydrogenase; Provisional 97.15
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 97.15
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 97.14
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 97.14
PRK06841 255 short chain dehydrogenase; Provisional 97.14
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.14
PTZ00075 476 Adenosylhomocysteinase; Provisional 97.13
PRK06914 280 short chain dehydrogenase; Provisional 97.13
PRK06172 253 short chain dehydrogenase; Provisional 97.12
PRK10538 248 malonic semialdehyde reductase; Provisional 97.12
TIGR01470 205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.12
PRK05855 582 short chain dehydrogenase; Validated 97.12
PRK08945 247 putative oxoacyl-(acyl carrier protein) reductase; 97.12
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.12
PRK08263 275 short chain dehydrogenase; Provisional 97.11
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.11
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 97.11
PRK06482 276 short chain dehydrogenase; Provisional 97.1
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.1
PRK05693 274 short chain dehydrogenase; Provisional 97.09
PRK12828 239 short chain dehydrogenase; Provisional 97.09
PRK05875 276 short chain dehydrogenase; Provisional 97.09
PRK07832 272 short chain dehydrogenase; Provisional 97.09
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 97.08
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.08
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.08
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.07
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 97.07
PRK05599 246 hypothetical protein; Provisional 97.07
PLN02928347 oxidoreductase family protein 97.06
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 97.04
KOG4169 261 consensus 15-hydroxyprostaglandin dehydrogenase an 97.04
PRK06179 270 short chain dehydrogenase; Provisional 97.03
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.03
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.03
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 97.02
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 97.02
PRK05653 246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.02
PRK05650 270 short chain dehydrogenase; Provisional 97.02
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.01
PRK05884 223 short chain dehydrogenase; Provisional 97.01
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.01
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.01
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.0
PRK05479 330 ketol-acid reductoisomerase; Provisional 97.0
PRK08936 261 glucose-1-dehydrogenase; Provisional 96.99
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 96.99
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 96.99
PRK08324 681 short chain dehydrogenase; Validated 96.99
PRK08278 273 short chain dehydrogenase; Provisional 96.99
PLN02494 477 adenosylhomocysteinase 96.98
PRK07856 252 short chain dehydrogenase; Provisional 96.98
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.97
PRK06046 326 alanine dehydrogenase; Validated 96.97
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 96.96
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.96
PRK07201 657 short chain dehydrogenase; Provisional 96.96
PRK12747 252 short chain dehydrogenase; Provisional 96.95
PRK06523 260 short chain dehydrogenase; Provisional 96.95
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 96.95
PRK07074 257 short chain dehydrogenase; Provisional 96.94
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 96.93
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.92
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.91
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 96.89
PRK13243 333 glyoxylate reductase; Reviewed 96.88
PRK12938 246 acetyacetyl-CoA reductase; Provisional 96.88
PRK06823315 ornithine cyclodeaminase; Validated 96.87
PRK08264 238 short chain dehydrogenase; Validated 96.87
PRK08993 253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 96.86
PRK06407301 ornithine cyclodeaminase; Provisional 96.86
PRK06181 263 short chain dehydrogenase; Provisional 96.86
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 96.86
PRK07806 248 short chain dehydrogenase; Provisional 96.85
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.85
PRK07904 253 short chain dehydrogenase; Provisional 96.83
PRK13403 335 ketol-acid reductoisomerase; Provisional 96.83
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.83
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.82
PRK08226 263 short chain dehydrogenase; Provisional 96.82
PRK08017 256 oxidoreductase; Provisional 96.82
PRK05565 247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.82
PRK08177 225 short chain dehydrogenase; Provisional 96.82
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.82
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.8
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.79
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.78
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 96.78
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.77
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 96.76
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 96.76
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 96.76
PRK06101 240 short chain dehydrogenase; Provisional 96.76
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 96.76
PRK07775 274 short chain dehydrogenase; Provisional 96.76
TIGR02415 254 23BDH acetoin reductases. One member of this famil 96.74
PRK12746 254 short chain dehydrogenase; Provisional 96.74
PRK06198 260 short chain dehydrogenase; Provisional 96.74
TIGR02685 267 pter_reduc_Leis pteridine reductase. Pteridine red 96.72
PRK06128 300 oxidoreductase; Provisional 96.72
PRK07634 245 pyrroline-5-carboxylate reductase; Reviewed 96.71
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.69
TIGR02371 325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 96.69
PRK09135 249 pteridine reductase; Provisional 96.68
PRK06199 379 ornithine cyclodeaminase; Validated 96.68
PRK07589 346 ornithine cyclodeaminase; Validated 96.66
PRK12937 245 short chain dehydrogenase; Provisional 96.66
COG1028 251 FabG Dehydrogenases with different specificities ( 96.66
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 96.66
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.66
PRK12859 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.65
PRK08703 239 short chain dehydrogenase; Provisional 96.65
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 96.64
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.64
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 96.64
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 96.63
PRK12744 257 short chain dehydrogenase; Provisional 96.63
COG0569 225 TrkA K+ transport systems, NAD-binding component [ 96.62
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.6
PRK07985 294 oxidoreductase; Provisional 96.59
COG1648 210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 96.59
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 96.58
PRK12743 256 oxidoreductase; Provisional 96.58
PRK09134 258 short chain dehydrogenase; Provisional 96.58
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 96.58
PRK12748 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.57
PRK06701 290 short chain dehydrogenase; Provisional 96.56
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.56
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.55
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 96.54
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 96.53
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 96.53
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.52
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.51
PRK07069 251 short chain dehydrogenase; Validated 96.51
PRK12480330 D-lactate dehydrogenase; Provisional 96.51
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.51
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 96.5
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 96.5
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 96.5
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.49
PLN00015 308 protochlorophyllide reductase 96.48
PRK06550 235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.47
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 96.44
TIGR01829 242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 96.43
PRK05690 245 molybdopterin biosynthesis protein MoeB; Provision 96.42
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.41
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.41
cd00757 228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 96.4
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 96.4
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 96.39
PRK12935 247 acetoacetyl-CoA reductase; Provisional 96.36
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 96.35
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 96.34
PRK08655 437 prephenate dehydrogenase; Provisional 96.32
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 96.31
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 96.31
PRK06077 252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.3
PRK09880343 L-idonate 5-dehydrogenase; Provisional 96.28
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 96.28
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 96.27
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.27
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.26
PRK09730 247 putative NAD(P)-binding oxidoreductase; Provisiona 96.26
PRK07417 279 arogenate dehydrogenase; Reviewed 96.26
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.25
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.24
PLN02896 353 cinnamyl-alcohol dehydrogenase 96.23
PRK15116 268 sulfur acceptor protein CsdL; Provisional 96.22
PRK12827 249 short chain dehydrogenase; Provisional 96.22
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 96.22
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 96.21
PRK12491 272 pyrroline-5-carboxylate reductase; Reviewed 96.21
COG2423 330 Predicted ornithine cyclodeaminase, mu-crystallin 96.21
COG2085 211 Predicted dinucleotide-binding enzymes [General fu 96.2
PRK07041 230 short chain dehydrogenase; Provisional 96.19
TIGR01915 219 npdG NADPH-dependent F420 reductase. This model re 96.19
PRK12745 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.18
PRK06953 222 short chain dehydrogenase; Provisional 96.18
PRK08219 227 short chain dehydrogenase; Provisional 96.17
cd00755 231 YgdL_like Family of activating enzymes (E1) of ubi 96.16
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 96.16
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.15
PRK11880 267 pyrroline-5-carboxylate reductase; Reviewed 96.15
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 96.14
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 96.14
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 96.13
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 96.13
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.12
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 96.11
PRK07574 385 formate dehydrogenase; Provisional 96.1
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 96.09
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 96.08
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 96.07
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 96.07
PRK06947 248 glucose-1-dehydrogenase; Provisional 96.07
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 96.07
PLN03139 386 formate dehydrogenase; Provisional 96.06
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.05
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 96.05
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 96.04
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 95.98
PRK05786 238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.98
PRK07102 243 short chain dehydrogenase; Provisional 95.97
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 95.97
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 95.96
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 95.96
PRK07577 234 short chain dehydrogenase; Provisional 95.95
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.93
PRK06436303 glycerate dehydrogenase; Provisional 95.93
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 95.92
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 95.92
COG0345 266 ProC Pyrroline-5-carboxylate reductase [Amino acid 95.91
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 95.9
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 95.9
PRK06487317 glycerate dehydrogenase; Provisional 95.88
COG0499 420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 95.84
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 95.84
PF13561 241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 95.83
PRK06123 248 short chain dehydrogenase; Provisional 95.82
PLN02650 351 dihydroflavonol-4-reductase 95.8
PRK13302 271 putative L-aspartate dehydrogenase; Provisional 95.79
PRK07680 273 late competence protein ComER; Validated 95.78
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 95.77
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.74
PRK08605 332 D-lactate dehydrogenase; Validated 95.74
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 95.74
PRK06476 258 pyrroline-5-carboxylate reductase; Reviewed 95.73
PLN00198 338 anthocyanidin reductase; Provisional 95.72
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 95.7
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 95.7
PLN02214 342 cinnamoyl-CoA reductase 95.69
PRK05562 223 precorrin-2 dehydrogenase; Provisional 95.69
PRK06545 359 prephenate dehydrogenase; Validated 95.68
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 95.67
PRK12330499 oxaloacetate decarboxylase; Provisional 95.66
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transpor 95.65
PRK12824 245 acetoacetyl-CoA reductase; Provisional 95.64
PLN02686 367 cinnamoyl-CoA reductase 95.61
PRK09496 453 trkA potassium transporter peripheral membrane com 95.61
PLN02256 304 arogenate dehydrogenase 95.59
PLN02688 266 pyrroline-5-carboxylate reductase 95.56
KOG0409 327 consensus Predicted dehydrogenase [General functio 95.55
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 95.53
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 95.5
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 95.49
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 95.47
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 95.46
PRK06932314 glycerate dehydrogenase; Provisional 95.46
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 95.45
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 95.44
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 95.44
PRK09496 453 trkA potassium transporter peripheral membrane com 95.44
PTZ00082 321 L-lactate dehydrogenase; Provisional 95.44
PRK13304 265 L-aspartate dehydrogenase; Reviewed 95.43
CHL00194 317 ycf39 Ycf39; Provisional 95.42
PLN02653 340 GDP-mannose 4,6-dehydratase 95.4
PLN02306 386 hydroxypyruvate reductase 95.35
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 95.33
PLN02586360 probable cinnamyl alcohol dehydrogenase 95.3
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 95.29
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 95.29
PRK06924 251 short chain dehydrogenase; Provisional 95.28
PRK07578 199 short chain dehydrogenase; Provisional 95.28
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 95.28
PRK08328 231 hypothetical protein; Provisional 95.28
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 95.26
TIGR01692 288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 95.23
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 95.21
PRK12331448 oxaloacetate decarboxylase; Provisional 95.19
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.13
KOG1199 260 consensus Short-chain alcohol dehydrogenase/3-hydr 95.12
KOG1210 331 consensus Predicted 3-ketosphinganine reductase [S 95.1
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 95.09
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 95.05
cd00300 300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 95.05
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.04
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 95.02
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 95.0
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 94.99
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.98
TIGR01500 256 sepiapter_red sepiapterin reductase. This model de 94.98
PLN02712 667 arogenate dehydrogenase 94.96
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.95
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 94.88
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 94.85
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 94.85
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 94.84
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 94.84
PRK10637 457 cysG siroheme synthase; Provisional 94.82
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 94.8
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 94.76
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 94.72
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 94.72
cd00650 263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 94.72
TIGR02355 240 moeB molybdopterin synthase sulfurylase MoeB. This 94.72
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 94.7
COG1712 255 Predicted dinucleotide-utilizing enzyme [General f 94.7
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.68
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 94.67
PLN02178 375 cinnamyl-alcohol dehydrogenase 94.66
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 94.64
PLN02427 386 UDP-apiose/xylose synthase 94.64
PRK08507 275 prephenate dehydrogenase; Validated 94.64
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.61
PTZ00117 319 malate dehydrogenase; Provisional 94.58
COG0686 371 Ald Alanine dehydrogenase [Amino acid transport an 94.57
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 94.55
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 94.55
PLN02712 667 arogenate dehydrogenase 94.53
PLN02240 352 UDP-glucose 4-epimerase 94.51
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 94.5
PRK14041467 oxaloacetate decarboxylase; Provisional 94.49
KOG1502 327 consensus Flavonol reductase/cinnamoyl-CoA reducta 94.46
PRK08309177 short chain dehydrogenase; Provisional 94.43
PLN02514357 cinnamyl-alcohol dehydrogenase 94.41
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 94.4
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 94.34
PRK09282 592 pyruvate carboxylase subunit B; Validated 94.33
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 94.32
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 94.3
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 94.26
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 94.25
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 94.2
PLN02740381 Alcohol dehydrogenase-like 94.17
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
Probab=100.00  E-value=1.1e-102  Score=833.57  Aligned_cols=454  Identities=82%  Similarity=1.257  Sum_probs=406.5

Q ss_pred             cccccccccCCCCCCcEEEEeeccCCHHHHHHHHHhhhhcCCCEEEEEecCCCCCCchhHHHHHHhhCCCcEEEEeccCC
Q 012352            9 ASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIW   88 (465)
Q Consensus         9 ~~~~~~~~~~~~~~~~~icv~l~~~t~~e~~~~~~~~~~~~~D~vElRlD~l~~~~~~~~l~~l~~~~~~PiI~T~R~~~   88 (465)
                      ||.---|||+++.++|+|||||++++.+|++.+++++...++|+||||+|+|++..+.+++..+++..++|+|||+|+++
T Consensus         8 ~~~~~~~~~~~~~~~~~icv~i~~~~~~e~~~~~~~~~~~~~D~vElRlD~l~~~~~~~~~~~~~~~~~~plI~T~R~~~   87 (529)
T PLN02520          8 ASDDLQGSGGVRRNPTLICVPIMADSVDKMLIEMAKAKELGADLVEIRLDFLKNFNPREDLKTLIKQSPLPTLVTYRPKW   87 (529)
T ss_pred             hhhhhhcccccccCCCEEEEEeCCCCHHHHHHHHHHhhhcCCCEEEEEeccccccCCHHHHHHHHhcCCCcEEEEeccHH
Confidence            44555689999999999999999999999999999887789999999999999876666777777777899999999999


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCcEEEEeeccccchhHHHHhcCCCCcEEEEEeccCCCCCCHHHHHHHHHHHHHcCCC
Q 012352           89 EGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGAD  168 (465)
Q Consensus        89 eGG~~~~~~~~~~~~l~~~~~~~~~~iDiEl~~~~~~~~~l~~~~~~~~~iI~S~H~f~~tps~~el~~~~~~~~~~gad  168 (465)
                      |||.++.++++|+++|+.+++.++||||||++..++..+.+...+..++++|+|||||++||+.+|+.+++++|+++|||
T Consensus        88 eGG~~~~~~~~~~~ll~~~~~~~~d~iDiEl~~~~~~~~~~~~~~~~~~~vI~S~H~f~~tP~~~el~~~~~~~~~~gaD  167 (529)
T PLN02520         88 EGGQYEGDENKRQDALRLAMELGADYVDVELKVAHEFINSISGKKPEKCKVIVSSHNYENTPSVEELGNLVARIQATGAD  167 (529)
T ss_pred             HCCCCCCCHHHHHHHHHHHHHhCCCEEEEEcCCchhHHHHHHhhhhcCCEEEEEecCCCCCCCHHHHHHHHHHHHHhCCC
Confidence            99999999999999999999999999999999888776666666668999999999999999999999999999999999


Q ss_pred             EEEEEeecCCHHHHHHHHHHhccCCCCEEEEecCccchhhhhhccccCCccccccccCccCCCCCCCChhhHHhhhcccc
Q 012352          169 IVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQ  248 (465)
Q Consensus       169 ivKia~~~~~~~D~~~ll~~~~~~~~p~i~~~MG~~G~~sRi~~~~~Gs~~tf~~~~~~~~sApGQ~~~~~l~~~~~~~~  248 (465)
                      |+|||+||++.+|++++++++.+.+.|+|+||||+.|++||+++++|||++||++++++.++||||++++++++++++.+
T Consensus       168 i~Kia~~~~~~~D~~~ll~~~~~~~~p~i~~~MG~~G~~sRi~~~~~GS~lTy~~~~~~~~sAPGQ~~~~~l~~~~~~~~  247 (529)
T PLN02520        168 IVKIATTALDITDVARMFQITVHSQVPTIGLVMGERGLISRILCPKFGGYLTFGTLEAGKVSAPGQPTIKDLLDLYNFRQ  247 (529)
T ss_pred             EEEEecCCCCHHHHHHHHHHHhhcCCCEEEEecCCCCchheecccccCCceeeeecCcccccCCCCCCHHHHHHHhhhhc
Confidence            99999999999999999998777789999999999999999999999999999999865579999999999999999999


Q ss_pred             cCCCcceeeecCCCccccccHHHHHHHHHHcCCCeeEeccccccHHHHHHHhhcCCCCeeEeccCchHHHhhhccccCHH
Q 012352          249 MGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTV  328 (465)
Q Consensus       249 ~~~~~~~~~~iG~pi~hS~SP~~hn~~f~~~gl~~~y~~~~~~~l~~~~~~l~~~~~~G~~vT~P~K~~v~~~~d~~~~~  328 (465)
                      +.++|++|+|+|+||+||+||.|||++|+++|+|+.|.++++++++++++.++.++|.|+|||||||+++++++|++++.
T Consensus       248 ~~~~t~~~~liG~Pi~hS~SP~ihn~~f~~~gl~~~Y~~~~v~~l~~~~~~l~~~~~~G~nVTiP~K~~v~~~lD~~~~~  327 (529)
T PLN02520        248 IGPDTKVYGIIGKPVGHSKSPILHNEAFKSVGFNGVYVHLLVDDLAKFLQTYSSPDFAGFSCTIPHKEDALKCCDEVDPI  327 (529)
T ss_pred             ccCCceEEEEEcCCcccccCHHHHHHHHHHCCCCcEEEEeehhhHHHHHHHHhhCCCCEEEECcCCHHHHHHHhccCCHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhccceeeEEEeccCCeEEEEeccHHHHHHHHHhhhccCCCCCCCcccccCCcEEEEEccchhHHHHHHHHHHCCCeEE
Q 012352          329 AKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVV  408 (465)
Q Consensus       329 A~~~gavNtv~~~~~~g~l~G~NTD~~G~~~~l~~~~~~~~~~~~~~~~~l~~k~vlV~GaGg~g~ai~~~L~~~G~~v~  408 (465)
                      |+.+||||||+++..+|+|+||||||.||+++|++.+... +..+..+.++++|+|+|+|+||+|++++++|++.|++|+
T Consensus       328 A~~iGAVNTvv~~~~~g~l~G~NTD~~G~~~~l~~~~~~~-~~~~~~~~~~~~k~vlIlGaGGagrAia~~L~~~G~~V~  406 (529)
T PLN02520        328 AKSIGAINTIIRRPSDGKLVGYNTDYIGAISAIEDGLRAS-GSSPASGSPLAGKLFVVIGAGGAGKALAYGAKEKGARVV  406 (529)
T ss_pred             HHHhCCceEEEEeCCCCEEEEEcccHHHHHHHHHhhhccc-ccccccccCCCCCEEEEECCcHHHHHHHHHHHHCCCEEE
Confidence            9999999999986227899999999999999998643110 000001245778999999999999999999999999999


Q ss_pred             EEECCHHHHHHHHHHHCCcccchhcccccCCCCeeEEEecCCCCCCCCCCCCCCC
Q 012352          409 IANRTYDRARELAETVGGHALSLADLENFNPEDGMILANTTSIGMQPKVDETPIP  463 (465)
Q Consensus       409 i~~R~~~~a~~la~~~~~~~~~~~~l~~~~~~~~DilInaT~~gm~~~~~~~p~~  463 (465)
                      ++||+.+++++++++++...+.++++.+.....+|+||||||+||.+..+.+|++
T Consensus       407 i~nR~~e~a~~la~~l~~~~~~~~~~~~~~~~~~diiINtT~vGm~~~~~~~pl~  461 (529)
T PLN02520        407 IANRTYERAKELADAVGGQALTLADLENFHPEEGMILANTTSVGMQPNVDETPIS  461 (529)
T ss_pred             EEcCCHHHHHHHHHHhCCceeeHhHhhhhccccCeEEEecccCCCCCCCCCCccc
Confidence            9999999999999988654455555432122357999999999999877777765



>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK02412 aroD 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>COG0710 AroD 3-dehydroquinate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01093 aroD 3-dehydroquinate dehydratase, type I Back     alignment and domain information
>PF01487 DHquinase_I: Type I 3-dehydroquinase; InterPro: IPR001381 3-dehydroquinate dehydratase (4 Back     alignment and domain information
>PRK13575 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>cd00502 DHQase_I Type I 3-dehydroquinase, (3-dehydroquinate dehydratase or DHQase Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13576 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK01261 aroD 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>KOG0692 consensus Pentafunctional AROM protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF08501 Shikimate_dh_N: Shikimate dehydrogenase substrate binding domain; InterPro: IPR013708 This domain is the substrate binding domain of shikimate dehydrogenase [] Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query465
2gpt_A523 Crystal Structure Of Arabidopsis Dehydroquinate Deh 0.0
2o7q_A523 Crystal Structure Of The A. Thaliana Dhq-Dehydroshi 0.0
1nvt_A287 Crystal Structure Of Shikimate Dehydrogenase (Aroe 2e-23
2egg_A297 Crystal Structure Of Shikimate 5-Dehydrogenase (Aro 6e-23
3js3_A258 Crystal Structure Of Type I 3-Dehydroquinate Dehydr 5e-22
3l2i_A276 1.85 Angstrom Crystal Structure Of The 3-Dehydroqui 4e-19
3m7w_A255 Crystal Structure Of Type I 3-Dehydroquinate Dehydr 4e-19
3don_A277 Crystal Structure Of Shikimate Dehydrogenase From S 7e-19
4guf_A276 1.5 Angstrom Crystal Structure Of The Salmonella En 2e-18
3nnt_A276 Crystal Structure Of K170m Mutant Of Type I 3-Dehyd 2e-18
3o1n_A276 1.03 Angstrom Crystal Structure Of Q236a Mutant Typ 2e-18
1qfe_A252 The Structure Of Type I 3-Dehydroquinate Dehydratas 3e-18
2hk7_A269 Crystal Structure Of Shikimate Dehydrogenase From A 1e-17
2hk9_A275 Crystal Structure Of Shikimate Dehydrogenase From A 1e-17
1wxd_A263 Crystal Structure Of Shikimate 5-dehydrogenase (aro 6e-15
2ox1_A196 Archaeal Dehydroquinase Length = 196 1e-14
2yr1_A257 Crystal Structure Of 3-Dehydroquinate Dehydratase F 4e-14
1nyt_A271 Shikimate Dehydrogenase Aroe Complexed With Nadp+ L 3e-13
3u62_A253 Crystal Structure Of Shikimate Dehydrogenase From T 5e-13
1sfl_A238 1.9a Crystal Structure Of Staphylococcus Aureus Typ 1e-12
3toz_A315 2.2 Angstrom Crystal Structure Of Shikimate 5-Dehyd 2e-12
1sfj_A238 2.4a Crystal Structure Of Staphylococcus Aureus Typ 3e-12
2egz_A219 Crystal Structure Of The 3-Dehydroquinate Dehydrata 2e-11
4fq8_A271 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 3e-11
4fr5_A271 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 3e-11
4fpx_A271 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 3e-11
4foo_A271 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 3e-11
4fos_A271 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 3e-11
3phg_A269 Crystal Structure Of The Shikimate 5-Dehydrogenase 3e-11
4fsh_A271 Crystal Structure Of Shikimate Dehydrogenase (aroe) 3e-11
3fbt_A282 Crystal Structure Of A Chorismate MutaseSHIKIMATE 5 1e-10
3t4e_A312 1.95 Angstrom Crystal Structure Of Shikimate 5-Dehy 2e-10
3l9c_A259 The Crystal Structure Of Smu.777 From Streptococcus 2e-10
1npd_A288 X-Ray Structure Of Shikimate Dehydrogenase Complexe 8e-09
1vi2_A300 Crystal Structure Of Shikimate-5-Dehydrogenase With 9e-09
1p74_A272 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 4e-08
3tum_B269 2.15 Angstrom Resolution Crystal Structure Of A Shi 5e-08
3o8q_A281 1.45 Angstrom Resolution Crystal Structure Of Shiki 4e-07
3pgj_A302 2.49 Angstrom Resolution Crystal Structure Of Shiki 4e-07
3o8q_B275 1.45 Angstrom Resolution Crystal Structure Of Shiki 6e-07
2ocz_A231 The Structure Of A Putative 3-dehydroquinate Dehydr 7e-07
3pwz_A272 Crystal Structure Of An Ael1 Enzyme From Pseudomona 3e-06
3jyo_A283 Quinate Dehydrogenase From Corynebacterium Glutamic 2e-05
2nlo_A302 Crystal Structure Of The Quinate Dehydrogenase From 2e-05
1npy_A271 Structure Of Shikimate 5-Dehydrogenase-Like Protein 5e-05
>pdb|2GPT|A Chain A, Crystal Structure Of Arabidopsis Dehydroquinate Dehydratase- Shikimate Dehydrogenase In Complex With Tartrate And Shikimate Length = 523 Back     alignment and structure

Iteration: 1

Score = 652 bits (1681), Expect = 0.0, Method: Compositional matrix adjust. Identities = 321/446 (71%), Positives = 371/446 (83%), Gaps = 2/446 (0%) Query: 21 KNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPT 80 KNP+LIC P+M +S+DKMV++ KA+ GADLVEIRLD LK+FNP E++KT+IK+SP+PT Sbjct: 2 KNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKDFNPLEDLKTIIKKSPLPT 61 Query: 81 LFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVI 140 LFTYRP WEGGQY+GDENER DVLRLAMELGADYIDVELQVA EF SI GKKP K KVI Sbjct: 62 LFTYRPKWEGGQYEGDENERRDVLRLAMELGADYIDVELQVASEFIKSIDGKKPGKFKVI 121 Query: 141 VSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLV 200 VSSHNYQ TPSVEDL LVARIQ +GADIVK ATTA+DI DVAR+F IT +QVP IGLV Sbjct: 122 VSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIADVARMFHITSKAQVPTIGLV 181 Query: 201 MGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIG 260 MGERGL+SRILC+KFGG+LTFGTL++ VSAPGQPTIKDLLDLYNFR++GPDTKV+GIIG Sbjct: 182 MGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFRRIGPDTKVYGIIG 241 Query: 261 KPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVK 320 KPV HSKSPI++N+AFKSV FNGV+VHLLVD++ F Q YSS+DFAGFSCTIPHKEAA++ Sbjct: 242 KPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFLQAYSSSDFAGFSCTIPHKEAALQ 301 Query: 321 CCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLR--GRLNVSGGVSSA 378 CCDEVD +AKSIGAVN I+RR+SDGKL GYNTD +G+ISAIEDGLR G + SS Sbjct: 302 CCDEVDPLAKSIGAVNTILRRKSDGKLLGYNTDCIGSISAIEDGLRSSGDPSSVPSSSSP 361 Query: 379 LAGKLFVVIXXXXXXXXXXXXXXXXXXRVVIANRTYDRARELAETVGGHALSLADLENFN 438 LA K VVI +VVIANRTY+RA ELAE +GG ALSL DL+N++ Sbjct: 362 LASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYERALELAEAIGGKALSLTDLDNYH 421 Query: 439 PEDGMILANTTSIGMQPKVDETPIPK 464 PEDGM+LANTTS+GMQP V+ETPI K Sbjct: 422 PEDGMVLANTTSMGMQPNVEETPISK 447
>pdb|2O7Q|A Chain A, Crystal Structure Of The A. Thaliana Dhq-Dehydroshikimate-Sdh- Shikimate-Nadp(H) Length = 523 Back     alignment and structure
>pdb|1NVT|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe Or Mj1084) In Complex With Nadp+ Length = 287 Back     alignment and structure
>pdb|2EGG|A Chain A, Crystal Structure Of Shikimate 5-Dehydrogenase (Aroe) From Geobacillus Kaustophilus Length = 297 Back     alignment and structure
>pdb|3JS3|A Chain A, Crystal Structure Of Type I 3-Dehydroquinate Dehydratase (Arod) From Clostridium Difficile With Covalent Reaction Intermediate Length = 258 Back     alignment and structure
>pdb|3L2I|A Chain A, 1.85 Angstrom Crystal Structure Of The 3-Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Lt2. Length = 276 Back     alignment and structure
>pdb|3M7W|A Chain A, Crystal Structure Of Type I 3-Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Lt2 In Covalent Complex With Dehydroquinate Length = 255 Back     alignment and structure
>pdb|3DON|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Staphylococcus Epidermidis Length = 277 Back     alignment and structure
>pdb|4GUF|A Chain A, 1.5 Angstrom Crystal Structure Of The Salmonella Enterica 3- Dehydroquinate Dehydratase (arod) E86a Mutant Length = 276 Back     alignment and structure
>pdb|3NNT|A Chain A, Crystal Structure Of K170m Mutant Of Type I 3-Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Lt2 In Non-Covalent Complex With Dehydroquinate. Length = 276 Back     alignment and structure
>pdb|3O1N|A Chain A, 1.03 Angstrom Crystal Structure Of Q236a Mutant Type I Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Length = 276 Back     alignment and structure
>pdb|1QFE|A Chain A, The Structure Of Type I 3-Dehydroquinate Dehydratase From Salmonella Typhi Length = 252 Back     alignment and structure
>pdb|2HK7|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Aquifex Aeolicus In Complex With Mercury At 2.5 Angstrom Resolution Length = 269 Back     alignment and structure
>pdb|2HK9|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Aquifex Aeolicus In Complex With Shikimate And Nadp+ At 2.2 Angstrom Resolution Length = 275 Back     alignment and structure
>pdb|1WXD|A Chain A, Crystal Structure Of Shikimate 5-dehydrogenase (aroe) From Thermus Thermophilus Hb8 Length = 263 Back     alignment and structure
>pdb|2OX1|A Chain A, Archaeal Dehydroquinase Length = 196 Back     alignment and structure
>pdb|2YR1|A Chain A, Crystal Structure Of 3-Dehydroquinate Dehydratase From Geobacillus Kaustophilus Hta426 Length = 257 Back     alignment and structure
>pdb|1NYT|A Chain A, Shikimate Dehydrogenase Aroe Complexed With Nadp+ Length = 271 Back     alignment and structure
>pdb|3U62|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Thermotoga Maritima Length = 253 Back     alignment and structure
>pdb|1SFL|A Chain A, 1.9a Crystal Structure Of Staphylococcus Aureus Type I 3- Dehydroquinase, Apo Form Length = 238 Back     alignment and structure
>pdb|3TOZ|A Chain A, 2.2 Angstrom Crystal Structure Of Shikimate 5-Dehydrogenase From Listeria Monocytogenes In Complex With Nad. Length = 315 Back     alignment and structure
>pdb|1SFJ|A Chain A, 2.4a Crystal Structure Of Staphylococcus Aureus Type I 3- Dehydroquinase, With 3-Dehydroquinate Bound Length = 238 Back     alignment and structure
>pdb|2EGZ|A Chain A, Crystal Structure Of The 3-Dehydroquinate Dehydratase From Aquifex Aeolicus Vf5 Length = 219 Back     alignment and structure
>pdb|4FQ8|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Y210a Mutant From Helicobacter Pylori In Complex With Shikimate Length = 271 Back     alignment and structure
>pdb|4FR5|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Y210s Mutant From Helicobacter Pylori In Complex With Shikimate Length = 271 Back     alignment and structure
>pdb|4FPX|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Q237n Mutant From Helicobacter Pylori Length = 271 Back     alignment and structure
>pdb|4FOO|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Q237k Mutant From Helicobacter Pylori Length = 271 Back     alignment and structure
>pdb|4FOS|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Q237a Mutant From Helicobacter Pylori In Complex With Shikimate Length = 271 Back     alignment and structure
>pdb|3PHG|A Chain A, Crystal Structure Of The Shikimate 5-Dehydrogenase (Aroe) From Helicobacter Pylori Length = 269 Back     alignment and structure
>pdb|4FSH|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (aroe) Clinical Variant V2356 From Helicobacter Pylori In Complex With Shikimate Length = 271 Back     alignment and structure
>pdb|3FBT|A Chain A, Crystal Structure Of A Chorismate MutaseSHIKIMATE 5- Dehydrogenase Fusion Protein From Clostridium Acetobutylicum Length = 282 Back     alignment and structure
>pdb|3T4E|A Chain A, 1.95 Angstrom Crystal Structure Of Shikimate 5-Dehydrogenase (Aroe) From Salmonella Enterica Subsp. Enterica Serovar Typhimurium In Complex With Nad Length = 312 Back     alignment and structure
>pdb|3L9C|A Chain A, The Crystal Structure Of Smu.777 From Streptococcus Mutans Ua159 Length = 259 Back     alignment and structure
>pdb|1NPD|A Chain A, X-Ray Structure Of Shikimate Dehydrogenase Complexed With Nad+ From E.Coli (Ydib) Northeast Structural Genomics Research Consortium (Nesg) Target Er24 Length = 288 Back     alignment and structure
>pdb|1VI2|A Chain A, Crystal Structure Of Shikimate-5-Dehydrogenase With Nad Length = 300 Back     alignment and structure
>pdb|1P74|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) From Haemophilus Influenzae Length = 272 Back     alignment and structure
>pdb|3O8Q|A Chain A, 1.45 Angstrom Resolution Crystal Structure Of Shikimate 5- Dehydrogenase (Aroe) From Vibrio Cholerae Length = 281 Back     alignment and structure
>pdb|3PGJ|A Chain A, 2.49 Angstrom Resolution Crystal Structure Of Shikimate 5- Dehydrogenase (Aroe) From Vibrio Cholerae O1 Biovar Eltor Str. N16961 In Complex With Shikimate Length = 302 Back     alignment and structure
>pdb|3O8Q|B Chain B, 1.45 Angstrom Resolution Crystal Structure Of Shikimate 5- Dehydrogenase (Aroe) From Vibrio Cholerae Length = 275 Back     alignment and structure
>pdb|2OCZ|A Chain A, The Structure Of A Putative 3-dehydroquinate Dehydratase From Streptococcus Pyogenes Length = 231 Back     alignment and structure
>pdb|3PWZ|A Chain A, Crystal Structure Of An Ael1 Enzyme From Pseudomonas Putida Length = 272 Back     alignment and structure
>pdb|3JYO|A Chain A, Quinate Dehydrogenase From Corynebacterium Glutamicum In Complex With Nad Length = 283 Back     alignment and structure
>pdb|2NLO|A Chain A, Crystal Structure Of The Quinate Dehydrogenase From Corynebacterium Glutamicum Length = 302 Back     alignment and structure
>pdb|1NPY|A Chain A, Structure Of Shikimate 5-Dehydrogenase-Like Protein Hi0607 Length = 271 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query465
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 0.0
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 2e-83
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 8e-78
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 5e-77
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 3e-76
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 7e-75
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 2e-74
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 1e-71
2egz_A219 3-dehydroquinate dehydratase; aquifex aeolicus VF5 2e-71
1sfl_A238 3-dehydroquinate dehydratase; 3-dehydroquinase, en 1e-70
2yr1_A257 3-dehydroquinate dehydratase; amino acid biosynthe 2e-70
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 3e-70
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 5e-69
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 4e-68
3js3_A258 3-dehydroquinate dehydratase; AROD, covalent react 6e-67
2ocz_A231 3-dehydroquinate dehydratase; structural genomics, 6e-67
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 2e-66
3l9c_A259 3-dehydroquinate dehydratase; AROD, amino-acid bio 1e-65
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 8e-65
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 1e-61
2ox1_A196 3-dehydroquinate dehydratase; (beta-alpha)8 barrel 4e-61
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 3e-56
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 4e-56
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 4e-56
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 1e-55
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 2e-12
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 5e-10
3l6e_A 235 Oxidoreductase, short-chain dehydrogenase/reducta; 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 2e-06
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 3e-06
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 7e-06
2i76_A 276 Hypothetical protein; NADP, dehydrogenase, TM1727, 2e-05
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 3e-05
2rir_A300 Dipicolinate synthase, A chain; structural genomic 3e-05
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 5e-05
2vns_A 215 Metalloreductase steap3; metal-binding, transmembr 6e-05
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 8e-05
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 8e-05
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 9e-05
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 1e-04
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 1e-04
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 1e-04
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 1e-04
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 1e-04
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 1e-04
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 2e-04
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 2e-04
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 2e-04
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 2e-04
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 2e-04
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 2e-04
4dqx_A 277 Probable oxidoreductase protein; structural genomi 3e-04
3imf_A 257 Short chain dehydrogenase; structural genomics, in 3e-04
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 3e-04
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 3e-04
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 4e-04
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 4e-04
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 4e-04
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 4e-04
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 4e-04
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 5e-04
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 5e-04
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 5e-04
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 6e-04
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 6e-04
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 7e-04
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 7e-04
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 7e-04
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 7e-04
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 7e-04
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 8e-04
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 9e-04
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Length = 523 Back     alignment and structure
 Score =  604 bits (1558), Expect = 0.0
 Identities = 338/446 (75%), Positives = 388/446 (86%), Gaps = 2/446 (0%)

Query: 21  KNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPT 80
           KNP+LIC P+M +S+DKMV++  KA+  GADLVEIRLD LK+FNP E++KT+IK+SP+PT
Sbjct: 2   KNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKDFNPLEDLKTIIKKSPLPT 61

Query: 81  LFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVI 140
           LFTYRP WEGGQY+GDENER DVLRLAMELGADYIDVELQVA EF  SI GKKP K KVI
Sbjct: 62  LFTYRPKWEGGQYEGDENERRDVLRLAMELGADYIDVELQVASEFIKSIDGKKPGKFKVI 121

Query: 141 VSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLV 200
           VSSHNYQ TPSVEDL  LVARIQ +GADIVK ATTA+DI DVAR+F IT  +QVP IGLV
Sbjct: 122 VSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIADVARMFHITSKAQVPTIGLV 181

Query: 201 MGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIG 260
           MGERGL+SRILC+KFGG+LTFGTL++  VSAPGQPTIKDLLDLYNFR++GPDTKV+GIIG
Sbjct: 182 MGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFRRIGPDTKVYGIIG 241

Query: 261 KPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVK 320
           KPV HSKSPI++N+AFKSV FNGV+VHLLVD++  F Q YSS+DFAGFSCTIPHKEAA++
Sbjct: 242 KPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFLQAYSSSDFAGFSCTIPHKEAALQ 301

Query: 321 CCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLR--GRLNVSGGVSSA 378
           CCDEVD +AKSIGAVN I+RR+SDGKL GYNTD +G+ISAIEDGLR  G  +     SS 
Sbjct: 302 CCDEVDPLAKSIGAVNTILRRKSDGKLLGYNTDCIGSISAIEDGLRSSGDPSSVPSSSSP 361

Query: 379 LAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYDRARELAETVGGHALSLADLENFN 438
           LA K  VVIGAGGAGKALAYGAK KGA+VVIANRTY+RA ELAE +GG ALSL DL+N++
Sbjct: 362 LASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYERALELAEAIGGKALSLTDLDNYH 421

Query: 439 PEDGMILANTTSIGMQPKVDETPIPK 464
           PEDGM+LANTTS+GMQP V+ETPI K
Sbjct: 422 PEDGMVLANTTSMGMQPNVEETPISK 447


>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Length = 312 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Length = 287 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Length = 315 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Length = 297 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Length = 275 Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Length = 271 Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Length = 282 Back     alignment and structure
>2egz_A 3-dehydroquinate dehydratase; aquifex aeolicus VF5, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TLA; 1.75A {Aquifex aeolicus} PDB: 2ysw_A Length = 219 Back     alignment and structure
>1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* Length = 238 Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Length = 257 Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Length = 263 Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Length = 283 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* Length = 269 Back     alignment and structure
>3js3_A 3-dehydroquinate dehydratase; AROD, covalent reaction intermediate, amino-acid biosynthesis, aromatic amino acid biosynthesis, lyase; HET: DHS; 2.20A {Clostridium difficile} Length = 258 Back     alignment and structure
>2ocz_A 3-dehydroquinate dehydratase; structural genomics, DH streptococcus pyogenes, dehydroshikimate, PSI-2, protein ST initiative; HET: MSE; 1.85A {Streptococcus pyogenes serotype M1} Length = 231 Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 3nnt_A* 3oex_A 3m7w_A 1gqn_A 1l9w_A* 1qfe_A* Length = 276 Back     alignment and structure
>3l9c_A 3-dehydroquinate dehydratase; AROD, amino-acid biosynthesis, aromatic amino acid biosynthe schiff base, lyase; 1.60A {Streptococcus mutans} Length = 259 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Length = 277 Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Length = 253 Back     alignment and structure
>2ox1_A 3-dehydroquinate dehydratase; (beta-alpha)8 barrel, lyase; 2.33A {Archaeoglobus fulgidus} Length = 196 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Length = 272 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Length = 281 Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Length = 271 Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Length = 272 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Length = 144 Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Length = 404 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Length = 291 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Length = 276 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Length = 300 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Length = 215 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Length = 266 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Length = 201 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Length = 245 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Length = 287 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query465
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 100.0
4h3d_A258 3-dehydroquinate dehydratase; structural genomics, 100.0
2yr1_A257 3-dehydroquinate dehydratase; amino acid biosynthe 100.0
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 100.0
1sfl_A238 3-dehydroquinate dehydratase; 3-dehydroquinase, en 100.0
3l9c_A259 3-dehydroquinate dehydratase; AROD, amino-acid bio 100.0
2ocz_A231 3-dehydroquinate dehydratase; structural genomics, 100.0
2egz_A219 3-dehydroquinate dehydratase; aquifex aeolicus VF5 100.0
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 100.0
2ox1_A196 3-dehydroquinate dehydratase; (beta-alpha)8 barrel 100.0
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 100.0
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 100.0
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 100.0
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 100.0
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 100.0
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 100.0
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 100.0
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 100.0
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 100.0
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 100.0
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 100.0
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 100.0
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 100.0
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 100.0
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 100.0
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 100.0
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 99.94
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 99.92
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 99.6
3l07_A285 Bifunctional protein fold; structural genomics, ID 99.03
3p2o_A285 Bifunctional protein fold; structural genomics, ce 99.02
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 98.96
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 98.93
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 98.64
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.6
1x7d_A 350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 98.59
1omo_A 322 Alanine dehydrogenase; two-domain, beta-sandwich-d 98.53
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 98.52
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 98.48
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.48
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 98.38
4hp8_A 247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 98.32
3ged_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.31
2rir_A300 Dipicolinate synthase, A chain; structural genomic 98.24
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 98.23
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 98.21
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 98.2
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 98.2
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 98.17
4dqx_A 277 Probable oxidoreductase protein; structural genomi 98.17
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 98.16
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 98.14
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 98.12
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 98.12
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 98.1
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.09
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 98.08
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 98.08
3l6e_A 235 Oxidoreductase, short-chain dehydrogenase/reducta; 98.08
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 98.07
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 98.07
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 98.05
3vh1_A 598 Ubiquitin-like modifier-activating enzyme ATG7; au 98.04
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 98.03
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 98.03
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 98.02
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 98.02
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 98.02
4b79_A 242 PA4098, probable short-chain dehydrogenase; oxidor 98.01
2jah_A 247 Clavulanic acid dehydrogenase; short-chain dehydro 98.01
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 98.01
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 98.0
3l77_A 235 Short-chain alcohol dehydrogenase; oxidoreductase; 97.98
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 97.98
3imf_A 257 Short chain dehydrogenase; structural genomics, in 97.98
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 97.97
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 97.97
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 97.97
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 97.97
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 97.97
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 97.97
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 97.96
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 97.96
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 97.96
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 97.95
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 97.95
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.95
3rih_A 293 Short chain dehydrogenase or reductase; structural 97.95
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 97.94
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 97.94
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 97.94
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 97.93
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.93
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 97.93
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 97.93
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 97.93
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 97.93
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 97.93
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 97.92
1zmo_A 244 Halohydrin dehalogenase; haloalcohol dehalogenase, 97.92
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 97.92
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 97.92
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 97.92
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 97.91
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 97.91
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 97.91
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 97.91
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 97.9
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 97.9
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 97.9
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 97.89
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 97.89
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 97.89
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 97.87
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 97.87
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 97.86
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 97.85
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 97.85
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 97.85
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 97.85
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 97.84
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 97.84
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 97.84
3cxt_A 291 Dehydrogenase with different specificities; rossma 97.84
3guy_A 230 Short-chain dehydrogenase/reductase SDR; structura 97.84
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 97.83
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.83
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 97.83
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 97.83
1mxh_A 276 Pteridine reductase 2; SDR topology, protein-subst 97.82
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 97.82
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 97.82
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 97.82
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 97.81
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 97.81
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 97.81
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 97.81
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 97.81
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 97.8
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 97.8
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 97.8
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 97.8
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 97.8
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 97.8
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 97.79
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.79
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 97.79
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 97.79
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 97.79
1spx_A 278 Short-chain reductase family member (5L265); paral 97.78
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 97.78
2uvd_A 246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 97.78
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 97.78
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 97.77
1xkq_A 280 Short-chain reductase family member (5D234); parra 97.77
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 97.76
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 97.76
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 97.76
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 97.76
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 97.76
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 97.75
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 97.75
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.74
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 97.74
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 97.74
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 97.73
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.73
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 97.72
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 97.72
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 97.72
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 97.71
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 97.71
1xq1_A 266 Putative tropinone reducatse; structural genomics, 97.71
1xhl_A 297 Short-chain dehydrogenase/reductase family member 97.71
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 97.7
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 97.7
2pnf_A 248 3-oxoacyl-[acyl-carrier-protein] reductase; short 97.69
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 97.69
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 97.69
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 97.68
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 97.68
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 97.68
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 97.68
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 97.67
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 97.67
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 97.66
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.66
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 97.66
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 97.66
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 97.65
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 97.65
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 97.65
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.65
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 97.64
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 97.64
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 97.64
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.64
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 97.64
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.63
2ehd_A 234 Oxidoreductase, oxidoreductase, short-chain dehydr 97.63
1oaa_A 259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 97.62
3osu_A 246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.62
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 97.62
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 97.61
3tl3_A 257 Short-chain type dehydrogenase/reductase; ssgcid, 97.61
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.61
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 97.61
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 97.6
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 97.6
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 97.59
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 97.58
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 97.58
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 97.58
2bd0_A 244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 97.58
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 97.58
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 97.57
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 97.57
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 97.57
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 97.57
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 97.56
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 97.56
1tt5_B 434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 97.56
3r6d_A 221 NAD-dependent epimerase/dehydratase; structural ge 97.56
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 97.56
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 97.56
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 97.55
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 97.55
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 97.55
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 97.53
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 97.52
3hdj_A 313 Probable ornithine cyclodeaminase; APC62486, borde 97.52
2ekp_A 239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 97.51
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 97.51
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 97.5
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 97.49
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 97.49
2hq1_A 247 Glucose/ribitol dehydrogenase; CTH-1438, structura 97.48
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 97.48
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 97.48
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 97.46
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 97.45
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.45
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.45
3icc_A 255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 97.45
1jay_A 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.44
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 97.43
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 97.43
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.42
1edo_A 244 Beta-keto acyl carrier protein reductase; nucleoti 97.42
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 97.42
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 97.41
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.41
1zud_1 251 Adenylyltransferase THIF; thiamin, thiazole, prote 97.4
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 97.4
2ph3_A 245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 97.39
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 97.39
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 97.39
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.39
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.38
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.37
3ezl_A 256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 97.37
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 97.36
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 97.36
1vl6_A 388 Malate oxidoreductase; TM0542, NAD-dependent malic 97.35
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 97.35
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 97.35
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 97.33
3uce_A 223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 97.33
1xq6_A 253 Unknown protein; structural genomics, protein stru 97.33
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 97.33
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 97.33
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 97.32
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 97.32
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.31
2vns_A 215 Metalloreductase steap3; metal-binding, transmembr 97.31
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 97.3
3l4b_C 218 TRKA K+ channel protien TM1088B; potassium channel 97.29
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.29
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 97.28
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.27
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 97.27
2yut_A 207 Putative short-chain oxidoreductase; alpha and bet 97.27
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 97.27
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 97.26
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.26
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 97.24
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.23
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.22
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 97.2
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 97.2
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 97.2
1ooe_A 236 Dihydropteridine reductase; structural genomics, P 97.2
1u7z_A 226 Coenzyme A biosynthesis bifunctional protein coabc 97.17
4huj_A 220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.15
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 97.14
1dhr_A 241 Dihydropteridine reductase; oxidoreductase(acting 97.14
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 97.14
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 97.13
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.13
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.12
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 97.12
2ahr_A 259 Putative pyrroline carboxylate reductase; pyrrolin 97.12
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.11
1hdo_A 206 Biliverdin IX beta reductase; foetal metabolism, H 97.09
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 97.08
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 97.06
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 97.06
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.05
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 97.05
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 97.04
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.04
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 97.02
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.02
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 97.02
3gt0_A 247 Pyrroline-5-carboxylate reductase; structural geno 97.02
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 97.02
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 97.0
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 97.0
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.0
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 96.97
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 96.97
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 96.97
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 96.96
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 96.96
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 96.96
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 96.95
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 96.95
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 96.95
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 96.93
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 96.92
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 96.92
3u0b_A 454 Oxidoreductase, short chain dehydrogenase/reducta 96.92
3d7l_A 202 LIN1944 protein; APC89317, structural genomics, PS 96.92
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 96.91
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 96.9
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 96.9
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 96.89
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 96.88
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 96.88
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 96.87
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 96.87
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 96.86
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 96.85
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 96.85
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 96.84
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 96.84
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 96.84
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrio 96.82
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 96.82
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 96.81
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 96.81
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 96.81
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 96.81
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 96.8
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 96.8
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 96.8
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 96.76
4e4y_A 244 Short chain dehydrogenase family protein; structur 96.76
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 96.75
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 96.75
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 96.75
3h5n_A 353 MCCB protein; ubiquitin-activating enzyme, microci 96.74
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 96.72
4hy3_A 365 Phosphoglycerate oxidoreductase; PSI-biology, stru 96.72
4e5n_A 330 Thermostable phosphite dehydrogenase; D-2-hydroxya 96.71
2zb4_A 357 Prostaglandin reductase 2; rossmann fold, alternat 96.71
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 96.71
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 96.71
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 96.7
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 96.7
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 96.68
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 96.67
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.67
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 96.67
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 96.67
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 96.66
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 96.65
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 96.64
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 96.63
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 96.62
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 96.62
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 96.61
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 96.61
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 96.6
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 96.6
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 96.6
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 96.59
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 96.59
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 96.58
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 96.57
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.56
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 96.56
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 96.55
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 96.54
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 96.53
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 96.53
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 96.53
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 96.53
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 96.52
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 96.52
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 96.51
4gsl_A 615 Ubiquitin-like modifier-activating enzyme ATG7; ub 96.49
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 96.49
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 96.49
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 96.49
3qha_A 296 Putative oxidoreductase; seattle structural genomi 96.48
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 96.48
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 96.48
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 96.47
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 96.47
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 96.46
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 96.46
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 96.45
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 96.45
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductas 96.45
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 96.44
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 96.43
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 96.43
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 96.42
4g65_A 461 TRK system potassium uptake protein TRKA; structur 96.42
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 96.42
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 96.41
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 96.4
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 96.4
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 96.4
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 96.39
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 96.38
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 96.37
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 96.37
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 96.36
4ezb_A 317 Uncharacterized conserved protein; structural geno 96.35
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 96.33
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 96.33
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 96.33
2yq5_A 343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 96.32
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 96.31
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 96.31
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 96.31
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 96.3
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 96.3
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 96.28
4eye_A342 Probable oxidoreductase; structural genomics, niai 96.28
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 96.27
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 96.27
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 96.26
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 96.24
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 96.24
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 96.24
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 96.23
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 96.23
2i76_A 276 Hypothetical protein; NADP, dehydrogenase, TM1727, 96.22
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 96.21
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 96.21
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 96.2
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 96.2
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 96.2
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 96.19
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 96.17
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 96.16
3tl2_A 315 Malate dehydrogenase; center for structural genomi 96.16
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 96.15
2raf_A 209 Putative dinucleotide-binding oxidoreductase; NP_7 96.15
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 96.15
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 96.14
1y8q_A 346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 96.14
1i36_A 264 Conserved hypothetical protein MTH1747; NADP bindi 96.14
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 96.14
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 96.13
2yjz_A 201 Metalloreductase steap4; oxidoreductase, metabolic 95.12
2a35_A 215 Hypothetical protein PA4017; alpha-beta-alpha sand 96.12
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 96.11
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 96.1
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 96.1
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 96.09
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 96.09
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 96.09
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 96.09
2aef_A 234 Calcium-gated potassium channel MTHK; rossmann fol 96.09
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 96.09
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 96.09
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 96.09
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 96.08
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 96.08
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 96.08
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 96.07
2gk4_A 232 Conserved hypothetical protein; alpha-beta-alpha s 96.07
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 96.06
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 96.06
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 96.06
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 96.06
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 96.04
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 96.04
3gms_A 340 Putative NADPH:quinone reductase; structural genom 96.03
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 96.03
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 96.02
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 96.01
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 95.99
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 95.99
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 95.98
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 95.97
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
Probab=100.00  E-value=3.1e-98  Score=801.36  Aligned_cols=443  Identities=76%  Similarity=1.189  Sum_probs=390.0

Q ss_pred             CCCcEEEEeeccCCHHHHHHHHHhhhhcCCCEEEEEecCCCCCCchhHHHHHHhhCCCcEEEEeccCCCCCCCCCCHHHH
Q 012352           21 KNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENER  100 (465)
Q Consensus        21 ~~~~~icv~l~~~t~~e~~~~~~~~~~~~~D~vElRlD~l~~~~~~~~l~~l~~~~~~PiI~T~R~~~eGG~~~~~~~~~  100 (465)
                      +++|+|||||+++|++|++.++++....++|+||||+|+|++.++.++++.+++..++|+|||+|+++|||.++.++++|
T Consensus         2 ~~~~~icv~l~~~~~~~~~~~~~~~~~~g~D~vElRvD~l~~~~~~~~l~~l~~~~~~PiI~T~R~~~eGG~~~~~~~~~   81 (523)
T 2o7s_A            2 KNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKDFNPLEDLKTIIKKSPLPTLFTYRPKWEGGQYEGDENER   81 (523)
T ss_dssp             CSCCEEEEEECCSSHHHHHHHHHHHHHHTCSEEEEEGGGCSSCCHHHHHHHHHHHCSSCEEEECCBGGGTSSBCSCHHHH
T ss_pred             CCCCEEEEEecCCCHHHHHHHHHHhhhcCCCEEEEEEecccccChHHHHHHHHhcCCCcEEEEecccccCCCCCCCHHHH
Confidence            67999999999999999999999888889999999999999877667898888888999999999999999999999999


Q ss_pred             HHHHHHHHHhCCcEEEEeeccccchhHHHHhcCCCCcEEEEEeccCCCCCCHHHHHHHHHHHHHcCCCEEEEEeecCCHH
Q 012352          101 VDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDIT  180 (465)
Q Consensus       101 ~~~l~~~~~~~~~~iDiEl~~~~~~~~~l~~~~~~~~~iI~S~H~f~~tps~~el~~~~~~~~~~gadivKia~~~~~~~  180 (465)
                      +++|+.+++.|+||||||++.+++.++.+...+..++|||+|||||++||+++++.+++++|.++||||+|||+||++.+
T Consensus        82 ~~ll~~~~~~~~~yiDvEl~~~~~~~~~~~~~~~~~~kiI~S~H~f~~tp~~~~~~~~~~~~~~~gaDivKia~~a~~~~  161 (523)
T 2o7s_A           82 RDVLRLAMELGADYIDVELQVASEFIKSIDGKKPGKFKVIVSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIA  161 (523)
T ss_dssp             HHHHHHHHHHTCSEEEEEHHHHHHHHHHTTTCCCTTCEEEEEEECSSCCCCHHHHHHHHHHHHTTTCSEEEEEEECSSGG
T ss_pred             HHHHHHHHHhCCCEEEEECCCchHHHHHHHHhccCCCEEEEEcccCCCCcCHHHHHHHHHHHHHhCCCEEEEEecCCCHH
Confidence            99999999999999999999988888777655556899999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhccCCCCEEEEecCccchhhhhhccccCCccccccccCccCCCCCCCChhhHHhhhcccccCCCcceeeecC
Q 012352          181 DVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIG  260 (465)
Q Consensus       181 D~~~ll~~~~~~~~p~i~~~MG~~G~~sRi~~~~~Gs~~tf~~~~~~~~sApGQ~~~~~l~~~~~~~~~~~~~~~~~~iG  260 (465)
                      |+++|++++.+.+.|+|+|+||+.|++||+++++|||++||++++++.++||||+++++++++|++.+++++|++|||||
T Consensus       162 D~~~l~~~~~~~~~p~i~~~MG~~G~~SRil~~~~gs~lt~~~l~~~~~sApGQ~~~~~l~~~~~~~~~~~~~~~~~viG  241 (523)
T 2o7s_A          162 DVARMFHITSKAQVPTIGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFRRIGPDTKVYGIIG  241 (523)
T ss_dssp             GHHHHHHHHHHCSSCEEEEEESGGGTHHHHCTTTTTCSEEECBSSTTCCSSTTCCBHHHHHHTSCGGGCCTTCEEEEEEE
T ss_pred             HHHHHHHHHhhcCCCEEEEEcCCCCchhhhhhhhcCCceeecCCCccccCCCCCCcHHHHHHHHhhhhccccceEEEEEC
Confidence            99999999888889999999999999999999999999999999865558999999999999999999999999999999


Q ss_pred             CCccccccHHHHHHHHHHcCCCeeEeccccccHHHHHHHhhcCCCCeeEeccCchHHHhhhccccCHHHHhccceeeEEE
Q 012352          261 KPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIR  340 (465)
Q Consensus       261 ~pi~hS~SP~~hn~~f~~~gl~~~y~~~~~~~l~~~~~~l~~~~~~G~~vT~P~K~~v~~~~d~~~~~A~~~gavNtv~~  340 (465)
                      +||+||+||.|||++|+++|+|+.|.+++++++.++++.++.++|.|+|||||||++|++++|++++.|+.+||||||++
T Consensus       242 ~pi~hS~SP~~hn~~f~~~gl~~~Y~~~~~~~l~~~~~~~~~~~~~G~nVTiP~K~~i~~~ld~~~~~A~~iGAvNti~~  321 (523)
T 2o7s_A          242 KPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFLQAYSSSDFAGFSCTIPHKEAALQCCDEVDPLAKSIGAVNTILR  321 (523)
T ss_dssp             SSCTTCCHHHHHHHHHHHTTCSEEEEEEECSCHHHHHHHTCSTTEEEEEECTTCHHHHHHHCSEECHHHHHHTCCSEEEE
T ss_pred             CCccCCccHHHHHHHHHHcCCCcEEEeEEcchHHHHHHHHhcCCCCEEEECCCCHHHHHHHhcccCHHHHHhCCCeEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             eccCCeEEEEeccHHHHHHHHHhhhccCCCCCC--CcccccCCcEEEEEccchhHHHHHHHHHHCCCeEEEEECCHHHHH
Q 012352          341 RQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSG--GVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYDRAR  418 (465)
Q Consensus       341 ~~~~g~l~G~NTD~~G~~~~l~~~~~~~~~~~~--~~~~~l~~k~vlV~GaGg~g~ai~~~L~~~G~~v~i~~R~~~~a~  418 (465)
                      +..+|+++|+||||.|++.+++..+....+...  .....+++|+++|+|+||+|++++++|++.|++|+++||+.++++
T Consensus       322 ~~~~gk~~g~nTD~~G~~~~l~~~~~~~~~~~~~~~~~~~l~~k~vlV~GaGGig~aia~~L~~~G~~V~i~~R~~~~a~  401 (523)
T 2o7s_A          322 RKSDGKLLGYNTDCIGSISAIEDGLRSSGDPSSVPSSSSPLASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYERAL  401 (523)
T ss_dssp             CTTTCCEEEECCHHHHHHHHHHHHC-------------------CEEEECCSHHHHHHHHHHHHHCC-CEEEESSHHHHH
T ss_pred             ecCCCeEEEEcCCHHHHHHHHHHhhhhccccccccccccccCCCEEEEECCcHHHHHHHHHHHHCCCEEEEEECCHHHHH
Confidence            622789999999999999999875421000000  001346789999999999999999999999999999999999999


Q ss_pred             HHHHHHCCcccchhcccccCCCCeeEEEecCCCCCCCCCCCCCCC
Q 012352          419 ELAETVGGHALSLADLENFNPEDGMILANTTSIGMQPKVDETPIP  463 (465)
Q Consensus       419 ~la~~~~~~~~~~~~l~~~~~~~~DilInaT~~gm~~~~~~~p~~  463 (465)
                      +++++++.....++++.++....+|+||||||+||.+..+..|++
T Consensus       402 ~la~~~~~~~~~~~dl~~~~~~~~DilVN~agvg~~~~~~~~~~~  446 (523)
T 2o7s_A          402 ELAEAIGGKALSLTDLDNYHPEDGMVLANTTSMGMQPNVEETPIS  446 (523)
T ss_dssp             HHHHHTTC-CEETTTTTTC--CCSEEEEECSSTTCTTCTTCCSSC
T ss_pred             HHHHHcCCceeeHHHhhhccccCceEEEECCCCCCCCCCCCCCCC
Confidence            999988654445555543223458999999999997654444543



>4h3d_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, aldolase class I; HET: PGE SHL; 1.95A {Clostridium difficile} PDB: 3js3_A* Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* Back     alignment and structure
>3l9c_A 3-dehydroquinate dehydratase; AROD, amino-acid biosynthesis, aromatic amino acid biosynthe schiff base, lyase; 1.60A {Streptococcus mutans} Back     alignment and structure
>2ocz_A 3-dehydroquinate dehydratase; structural genomics, DH streptococcus pyogenes, dehydroshikimate, PSI-2, protein ST initiative; HET: MSE; 1.85A {Streptococcus pyogenes serotype M1} Back     alignment and structure
>2egz_A 3-dehydroquinate dehydratase; aquifex aeolicus VF5, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TLA; 1.75A {Aquifex aeolicus} PDB: 2ysw_A Back     alignment and structure
>2ox1_A 3-dehydroquinate dehydratase; (beta-alpha)8 barrel, lyase; 2.33A {Archaeoglobus fulgidus} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 465
d1gqna_252 c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase 7e-72
d1sfla_236 c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase 1e-70
d1p77a2101 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE 3e-28
d1vi2a2102 c.58.1.5 (A:5-106) Putative shikimate dehydrogenas 4e-28
d1nyta2101 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE 4e-27
d1nvta2110 c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE 5e-26
d1npya2102 c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like 2e-25
d1k2wa_ 256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 1e-06
d1ulsa_ 242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 3e-06
d1pr9a_ 244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 4e-06
d1ydea1 250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 4e-06
d1nffa_ 244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 7e-06
d1jaya_ 212 c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase 7e-06
d2a4ka1 241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 1e-05
d1hdca_ 254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 1e-05
d1cyda_ 242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 1e-05
d1hxha_ 253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 1e-05
d1bdba_ 276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 2e-05
d1p77a1171 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE 2e-05
d1q7ba_ 243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 3e-05
d1gpja2159 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle 3e-05
d1fmca_ 255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 5e-05
d1yb1a_ 244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 6e-05
d2o23a1 248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 6e-05
d2d1ya1 248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 6e-05
d1xhla_ 274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 7e-05
d2ag5a1 245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 8e-05
d1yxma1 297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 1e-04
d1zk4a1 251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 1e-04
d1vl8a_ 251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 1e-04
d2bgka1 268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 2e-04
d1zema1 260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 2e-04
d1w6ua_ 294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 2e-04
d1ae1a_ 258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 3e-04
d1oaaa_ 259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 3e-04
d1h5qa_ 260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 3e-04
d2h7ma1 268 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacteri 3e-04
d1spxa_ 264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 4e-04
d1xkqa_ 272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 4e-04
d1e5qa1182 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase 4e-04
d1xu9a_ 269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 4e-04
d1xg5a_ 257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 5e-04
d1ooea_ 235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 5e-04
d1iy8a_ 258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 5e-04
d2ae2a_ 259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 6e-04
d2ew8a1 247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 7e-04
d1xq1a_ 259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 7e-04
d1ja9a_ 259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 8e-04
d1o5ia_ 234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 8e-04
d1gega_ 255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 8e-04
d1sbya1 254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 0.001
d1nyta1170 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE 0.001
d2c07a1 251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 0.001
d1uzma1 237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 0.001
d1g0oa_ 272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 0.001
d1geea_ 261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 0.002
d1li4a1163 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolas 0.002
d1qsga_ 258 c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli 0.002
d2rhca1 257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 0.002
d2gdza1 254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 0.003
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Length = 252 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Type I 3-dehydroquinate dehydratase
species: Salmonella typhi [TaxId: 90370]
 Score =  225 bits (575), Expect = 7e-72
 Identities = 62/234 (26%), Positives = 110/234 (47%), Gaps = 14/234 (5%)

Query: 24  TLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKE-----SPV 78
             I V +MG  ++ +  +      +  D++E R+D   +    +++ T  +        +
Sbjct: 16  PKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDI 75

Query: 79  PTLFTYRPIWEGGQYDGDENERVDVLRLAMELG-ADYIDVELQVA-REFNDSIRGKKPEK 136
           P LFT+R   EGG+        + + R A++ G  D ID+EL     +   ++       
Sbjct: 76  PLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHN 135

Query: 137 CKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVH----- 191
             V++S+H++  TPS E++ + + ++QA GADI K A       DV  +   T+      
Sbjct: 136 VYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHY 195

Query: 192 SQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYN 245
           +  P+I + M + G+ISR+    FG   TFG ++    SAPGQ  + DL  +  
Sbjct: 196 ADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQA--SAPGQIAVNDLRSVLM 247


>d1sfla_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus [TaxId: 1280]} Length = 236 Back     information, alignment and structure
>d1p77a2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Length = 101 Back     information, alignment and structure
>d1vi2a2 c.58.1.5 (A:5-106) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Length = 102 Back     information, alignment and structure
>d1nyta2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Length = 101 Back     information, alignment and structure
>d1nvta2 c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 110 Back     information, alignment and structure
>d1npya2 c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Length = 102 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 212 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Length = 171 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 159 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Length = 268 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 182 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query465
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 100.0
d1sfla_236 Type I 3-dehydroquinate dehydratase {Staphylococcu 100.0
d1vi2a2102 Putative shikimate dehydrogenase YdiB {Escherichia 99.97
d1p77a2101 Shikimate 5-dehydrogenase AroE {Haemophilus influe 99.97
d1nyta2101 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 99.97
d1nvta2110 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 99.96
d1npya2102 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 99.96
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 99.65
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 99.63
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 99.56
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 99.55
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 99.46
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.25
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 99.22
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 98.59
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 98.58
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 98.56
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 98.56
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 98.53
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 98.51
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 98.51
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 98.5
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 98.48
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 98.46
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 98.45
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 98.44
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 98.43
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 98.42
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 98.42
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 98.41
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 98.4
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.39
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 98.38
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 98.37
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 98.37
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 98.34
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 98.33
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 98.32
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 98.32
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 98.32
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 98.31
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 98.31
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 98.3
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 98.29
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 98.28
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 98.28
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 98.27
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 98.26
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 98.26
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 98.25
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 98.23
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 98.23
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 98.15
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 98.14
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 98.14
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 98.09
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 98.03
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 98.02
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 98.0
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 97.97
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 97.95
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 97.94
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 97.87
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 97.84
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 97.82
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 97.78
d1yo6a1 250 Putative carbonyl reductase sniffer {Caenorhabditi 97.71
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.71
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 97.7
d1jaya_ 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.66
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 97.59
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.59
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.57
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 97.54
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.53
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.52
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 97.52
d1snya_ 248 Carbonyl reductase sniffer {Fruit fly (Drosophila 97.49
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 97.41
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.39
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 97.38
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.38
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.37
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.35
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 97.34
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 97.33
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.29
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.27
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.25
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 97.25
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 97.25
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.24
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 97.22
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.21
d1ooea_ 235 Dihydropteridin reductase (pteridine reductase) {N 97.21
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 97.21
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 97.21
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 97.2
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.19
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.19
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 97.19
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 97.19
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.19
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 97.18
d1hdoa_ 205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.15
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 97.12
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 97.11
d1f0ya2 192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 97.08
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.07
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.07
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 97.05
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 97.04
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.0
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.96
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 96.95
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.93
d1leha1 230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 96.93
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.92
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 96.9
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 96.9
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.88
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 96.88
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.87
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.86
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.8
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.79
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.78
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.77
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.77
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 96.75
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 96.74
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 96.7
d1uaya_ 241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 96.63
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.62
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 96.59
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 96.59
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 96.54
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.48
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.45
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 96.45
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.45
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.44
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 96.37
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 96.34
d1omoa_ 320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 96.32
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.27
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 96.25
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 96.24
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 96.23
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.19
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.19
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.18
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.16
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 96.15
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.12
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 96.06
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.03
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.02
d1x7da_ 340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 96.01
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 95.91
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.89
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 95.87
d1gtea4 196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.8
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 95.78
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 95.77
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.73
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 95.72
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 95.62
d2bkaa1 232 TAT-interacting protein TIP30 {Human (Homo sapiens 95.6
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.57
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 95.56
d1id1a_153 Rck domain from putative potassium channel Kch {Es 95.54
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 95.54
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 95.45
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 95.33
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.17
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 95.15
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.13
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 95.02
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 95.01
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 95.01
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 94.84
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 94.83
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.82
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 94.81
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.76
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 94.72
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.68
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.68
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.64
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 94.59
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 94.58
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 94.46
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 94.46
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 94.43
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 94.38
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 94.37
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 94.31
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 94.26
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 94.24
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 94.21
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.19
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.08
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 94.0
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 93.97
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 93.96
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.95
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 93.85
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 93.76
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 93.75
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 93.71
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 93.67
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 93.63
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 93.59
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 93.56
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 93.46
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 93.44
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 93.43
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 93.24
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 93.21
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 93.11
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 93.02
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 92.95
d1v9la1 242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 92.93
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 92.9
d2a35a1 212 Hypothetical protein PA4017 {Pseudomonas aeruginos 92.87
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 92.8
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 92.7
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 92.7
d1lqta2 239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 92.54
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 92.45
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 92.37
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 92.37
d1trba1 190 Thioredoxin reductase {Escherichia coli [TaxId: 56 92.27
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 92.23
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 92.11
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 92.01
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.9
d1cjca2 230 Adrenodoxin reductase of mitochondrial p450 system 91.79
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 91.78
d1vl6a1 222 Malate oxidoreductase (malic enzyme) {Thermotoga m 91.77
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 91.74
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 91.7
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 91.62
d2i0za1 251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 91.55
d2gqfa1 253 Hypothetical protein HI0933 {Haemophilus influenza 91.55
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.54
d1ad1a_264 Dihydropteroate synthetase {Staphylococcus aureus 91.5
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 91.31
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 91.31
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 91.28
d1mv8a2 202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 91.23
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 91.18
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 91.1
d2nvwa1 237 Galactose/lactose metabolism regulatory protein GA 91.05
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.03
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 90.59
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 90.44
d1vdca1 192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 90.38
d1w4xa2 235 Phenylacetone monooxygenase {Thermobifida fusca [T 90.36
d1yx1a1250 Hypothetical protein PA2260 {Pseudomonas aeruginos 90.25
d1dxla1 221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 90.24
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 90.23
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.23
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 90.12
d1gesa1 217 Glutathione reductase {Escherichia coli [TaxId: 56 90.1
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 90.07
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 90.01
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 90.0
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 89.93
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 89.89
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 89.88
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 89.87
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 89.75
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 89.37
d1v59a1 233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 89.34
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 89.32
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 89.17
d1ojta1 229 Dihydrolipoamide dehydrogenase {Neisseria meningit 89.04
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 88.86
d1ebda1 223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 88.67
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 88.55
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 88.45
d3lada1 229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 88.45
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 88.44
d1rqba2303 Transcarboxylase 5S subunit, N-terminal domain {Pr 88.3
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 88.21
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 88.19
d1lvla1 220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 88.15
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 87.79
d1h6va1 235 Mammalian thioredoxin reductase {Rat (Rattus norve 87.64
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 87.62
d1rp0a1 278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 87.55
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 87.49
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 87.24
d1ajza_282 Dihydropteroate synthetase {Escherichia coli [TaxI 87.17
d1b26a1 234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 87.12
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 87.1
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 87.09
d3grsa1 221 Glutathione reductase {Human (Homo sapiens) [TaxId 87.04
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 86.99
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 86.81
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 86.64
d2ax3a2211 Hypothetical protein TM0922, N-terminal domain {Th 86.61
d1onfa1 259 Glutathione reductase {Plasmodium falciparum [TaxI 85.93
d1kifa1 246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 85.88
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 85.6
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 85.53
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 85.16
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 85.07
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 84.97
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 84.79
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 84.73
d2gjca1 311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 84.41
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 84.34
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 84.2
d1nhpa1 198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 84.02
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 84.02
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 83.81
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 83.78
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 83.61
d1tx2a_273 Dihydropteroate synthetase {Bacillus anthracis [Ta 83.56
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 83.56
d1ad1a_264 Dihydropteroate synthetase {Staphylococcus aureus 83.37
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 83.25
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 83.23
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 82.54
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 82.43
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 82.34
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 81.84
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 81.77
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 81.65
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 81.58
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 81.57
d1wdda1325 Ribulose 1,5-bisphosphate carboxylase-oxygenase {R 81.3
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 81.23
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 80.8
d1dlja2 196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 80.12
d1gtma1 239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 80.07
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Type I 3-dehydroquinate dehydratase
species: Salmonella typhi [TaxId: 90370]
Probab=100.00  E-value=5.4e-57  Score=436.45  Aligned_cols=233  Identities=26%  Similarity=0.412  Sum_probs=209.2

Q ss_pred             cccccCCCCCCcEEEEeeccCCHHHHHHHHHhhhhcCCCEEEEEecCCCCCCchhHHH----HHHhhC-CCcEEEEeccC
Q 012352           13 KLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIK----TLIKES-PVPTLFTYRPI   87 (465)
Q Consensus        13 ~~~~~~~~~~~~~icv~l~~~t~~e~~~~~~~~~~~~~D~vElRlD~l~~~~~~~~l~----~l~~~~-~~PiI~T~R~~   87 (465)
                      |+..-+++..+|+|||||++++.+++++++.++...++|+||||+|+|.+..+.+.+.    .+++.. ++|+|||+|++
T Consensus         5 ~v~~~~~g~g~pkIcv~l~~~~~~~~~~~~~~~~~~~aD~vE~RlD~l~~~~~~~~l~~~~~~lr~~~~~~PiI~T~R~~   84 (252)
T d1gqna_           5 TVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSA   84 (252)
T ss_dssp             EETTEEETSSSCEEEEEECCSSHHHHHHHHHHHTTSCCSEEEEEGGGCSCTTCHHHHHHHHHHHHHHCTTSCEEEECCBG
T ss_pred             EECCEEecCCCCEEEEEeCCCCHHHHHHHHHHHhhcCCCEEEEEEccccccCCHHHHHHHHHHHHHhcCCCCEEEEEech
Confidence            4455667789999999999999999999999988889999999999999876544443    344443 69999999999


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHhC-CcEEEEeeccccchhHHHH-hcCCCCcEEEEEeccCCCCCCHHHHHHHHHHHHHc
Q 012352           88 WEGGQYDGDENERVDVLRLAMELG-ADYIDVELQVAREFNDSIR-GKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQAS  165 (465)
Q Consensus        88 ~eGG~~~~~~~~~~~~l~~~~~~~-~~~iDiEl~~~~~~~~~l~-~~~~~~~~iI~S~H~f~~tps~~el~~~~~~~~~~  165 (465)
                      +|||.+++++++|+++|+.+++.| +||||||++..++....+. ..+..++++|+|||||++||+.+++.+++++|.++
T Consensus        85 ~eGG~~~~~~~~~~~ll~~~~~~~~~d~iDiEl~~~~~~~~~li~~a~~~~~~vI~S~Hdf~~TP~~~~l~~~~~~m~~~  164 (252)
T d1gqna_          85 KEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQAL  164 (252)
T ss_dssp             GGTCSBCCCHHHHHHHHHHHHHHSCCSEEEEEGGGCHHHHHHHHHHHHHTTCEEEEEEEESSCCCCHHHHHHHHHHHHHT
T ss_pred             hhCCCCCCCHHHHHHHHHHHHHcCCCceEeccccccHHHHHHHHHHhhcCCCeEEEEecCCCCCCCHHHHHHHHHHHHHh
Confidence            999999999999999999999998 8999999999887766665 34568999999999999999999999999999999


Q ss_pred             CCCEEEEEeecCCHHHHHHHHHHhcc-----CCCCEEEEecCccchhhhhhccccCCccccccccCccCCCCCCCChhhH
Q 012352          166 GADIVKFATTALDITDVARVFQITVH-----SQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDL  240 (465)
Q Consensus       166 gadivKia~~~~~~~D~~~ll~~~~~-----~~~p~i~~~MG~~G~~sRi~~~~~Gs~~tf~~~~~~~~sApGQ~~~~~l  240 (465)
                      ||||+|+|+||++.+|++++++++.+     .+.|+|+||||+.|++||+++++|||++||++++++  +||||+++++|
T Consensus       165 gaDivKia~~a~~~~D~~~ll~~~~~~~~~~~~~P~I~~~MG~~G~~SRi~~~~~GS~~tya~~~~~--sAPGQ~~~~~l  242 (252)
T d1gqna_         165 GADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQA--SAPGQIAVNDL  242 (252)
T ss_dssp             TCSEEEEEECCSSHHHHHHHHHHHHHHHHHTCSSCCEEEECTTTTHHHHHCHHHHTCCEEECBSSSC--CSTTCCBHHHH
T ss_pred             CCCeEEEEecCCCHHHHHHHHHHHHHHHHhCCCCCEEEEecCCcchhHHHHHHHhCCceEeccCCCC--CCCCCCCHHHH
Confidence            99999999999999999999988643     378999999999999999999999999999999865  99999999999


Q ss_pred             Hhhhccc
Q 012352          241 LDLYNFR  247 (465)
Q Consensus       241 ~~~~~~~  247 (465)
                      +++++++
T Consensus       243 ~~~l~~l  249 (252)
T d1gqna_         243 RSVLMIL  249 (252)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
Confidence            9999864



>d1sfla_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vi2a2 c.58.1.5 (A:5-106) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nyta2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta2 c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1npya2 c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1ajza_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ax3a2 c.104.1.1 (A:1-211) Hypothetical protein TM0922, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdda1 c.1.14.1 (A:151-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure