Citrus Sinensis ID: 012352
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 465 | ||||||
| 224107417 | 538 | dehydroquinate dehydratase/ shikimate de | 0.965 | 0.834 | 0.819 | 0.0 | |
| 255551621 | 539 | shikimate dehydrogenase, putative [Ricin | 0.963 | 0.831 | 0.819 | 0.0 | |
| 359477446 | 522 | PREDICTED: bifunctional 3-dehydroquinate | 0.965 | 0.860 | 0.816 | 0.0 | |
| 58047529 | 508 | 3-dehydroquinate dehydratase/shikimate 5 | 0.948 | 0.868 | 0.825 | 0.0 | |
| 76782194 | 536 | putative 3-dehydroquinate dehydratase/sh | 0.984 | 0.854 | 0.776 | 0.0 | |
| 356495945 | 527 | PREDICTED: bifunctional 3-dehydroquinate | 0.989 | 0.872 | 0.765 | 0.0 | |
| 297736925 | 495 | unnamed protein product [Vitis vinifera] | 0.918 | 0.862 | 0.824 | 0.0 | |
| 449503035 | 542 | PREDICTED: bifunctional 3-dehydroquinate | 0.956 | 0.821 | 0.773 | 0.0 | |
| 388521847 | 515 | unknown [Medicago truncatula] | 0.952 | 0.860 | 0.765 | 0.0 | |
| 449461453 | 542 | PREDICTED: bifunctional 3-dehydroquinate | 0.956 | 0.821 | 0.769 | 0.0 |
| >gi|224107417|ref|XP_002314474.1| dehydroquinate dehydratase/ shikimate dehydrogenase [Populus trichocarpa] gi|222863514|gb|EEF00645.1| dehydroquinate dehydratase/ shikimate dehydrogenase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 741 bits (1913), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 368/449 (81%), Positives = 407/449 (90%)
Query: 16 SGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKE 75
SGG+R+NPTLIC PIM +SVDKM + M +A + GADLVEIRLD LK+FNP +IKTLI
Sbjct: 23 SGGVRRNPTLICTPIMADSVDKMAILMAEAKSVGADLVEIRLDSLKDFNPNSDIKTLILH 82
Query: 76 SPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPE 135
SP+PTLFTYRP+WEGGQY+GDE R+D LRLAMELGADYIDVEL+VA EFN+ +RG KP
Sbjct: 83 SPLPTLFTYRPMWEGGQYNGDEKPRLDALRLAMELGADYIDVELKVAHEFNELLRGNKPG 142
Query: 136 KCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVP 195
KCK+IVSSHNY+ TPSVE+L NLVARIQA+GADIVK ATTALDI+DVAR+FQITVHSQVP
Sbjct: 143 KCKLIVSSHNYENTPSVEELGNLVARIQAAGADIVKIATTALDISDVARIFQITVHSQVP 202
Query: 196 IIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKV 255
IIGLVMGERGLISRILCAKFGG+LTFGTLE+G+VSAPGQPTIKDLLDLYNFR +GPDTKV
Sbjct: 203 IIGLVMGERGLISRILCAKFGGYLTFGTLESGVVSAPGQPTIKDLLDLYNFRLIGPDTKV 262
Query: 256 FGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHK 315
FGIIGKPVGHSKSP+L+NEAFKSVG NGV+VHLLVDDIA+F QTYSS DFAGFSCTIPHK
Sbjct: 263 FGIIGKPVGHSKSPVLFNEAFKSVGINGVYVHLLVDDIARFLQTYSSTDFAGFSCTIPHK 322
Query: 316 EAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGV 375
E A KCCDEV VAKSIGAVNCIIRRQ+DGKLFGYNTDYVGAISAIE+GLR NVS V
Sbjct: 323 EDAAKCCDEVHPVAKSIGAVNCIIRRQNDGKLFGYNTDYVGAISAIEEGLRASQNVSNTV 382
Query: 376 SSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYDRARELAETVGGHALSLADLE 435
S LAGKLFVVIGAGGAGKALAYGAK KGARVVIANRTY+RA+ LA+ +GG A++LADLE
Sbjct: 383 GSPLAGKLFVVIGAGGAGKALAYGAKEKGARVVIANRTYERAKVLADIIGGDAITLADLE 442
Query: 436 NFNPEDGMILANTTSIGMQPKVDETPIPK 464
NF+PEDGMILANTTSIGMQPKVDETP+ K
Sbjct: 443 NFHPEDGMILANTTSIGMQPKVDETPVSK 471
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255551621|ref|XP_002516856.1| shikimate dehydrogenase, putative [Ricinus communis] gi|223543944|gb|EEF45470.1| shikimate dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359477446|ref|XP_002277395.2| PREDICTED: bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|58047529|gb|AAW65140.1| 3-dehydroquinate dehydratase/shikimate 5-dehydrogenase [Juglans regia] | Back alignment and taxonomy information |
|---|
| >gi|76782194|gb|ABA54867.1| putative 3-dehydroquinate dehydratase/shikimate dehydrogenase [Fagus sylvatica] | Back alignment and taxonomy information |
|---|
| >gi|356495945|ref|XP_003516831.1| PREDICTED: bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297736925|emb|CBI26126.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449503035|ref|XP_004161812.1| PREDICTED: bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388521847|gb|AFK48985.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449461453|ref|XP_004148456.1| PREDICTED: bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 465 | ||||||
| TAIR|locus:2081036 | 603 | MEE32 "MATERNAL EFFECT EMBRYO | 0.997 | 0.769 | 0.701 | 2.7e-171 | |
| SGD|S000002534 | 1588 | ARO1 "Pentafunctional arom pro | 0.701 | 0.205 | 0.292 | 1e-28 | |
| TIGR_CMR|CBU_2075 | 233 | CBU_2075 "3-dehydroquinate deh | 0.462 | 0.922 | 0.32 | 5e-28 | |
| TIGR_CMR|BA_4561 | 308 | BA_4561 "shikimate 5-dehydroge | 0.421 | 0.636 | 0.333 | 4.3e-26 | |
| POMBASE|SPAC1834.02 | 1573 | aro1 "pentafunctional aromatic | 0.673 | 0.198 | 0.315 | 1.5e-25 | |
| ASPGD|ASPL0000055969 | 1583 | aromA [Emericella nidulans (ta | 0.668 | 0.196 | 0.303 | 2.9e-21 | |
| CGD|CAL0004346 | 1551 | ARO1 [Candida albicans (taxid: | 0.761 | 0.228 | 0.276 | 4.8e-21 | |
| TIGR_CMR|DET_0466 | 222 | DET_0466 "3-dehydroquinate deh | 0.449 | 0.941 | 0.325 | 1.3e-20 | |
| TIGR_CMR|CHY_0623 | 280 | CHY_0623 "shikimate 5-dehydrog | 0.421 | 0.7 | 0.313 | 2.8e-20 | |
| TIGR_CMR|SPO_3891 | 277 | SPO_3891 "shikimate 5-dehydrog | 0.419 | 0.703 | 0.339 | 7.7e-20 |
| TAIR|locus:2081036 MEE32 "MATERNAL EFFECT EMBRYO ARREST 32" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1665 (591.2 bits), Expect = 2.7e-171, P = 2.7e-171
Identities = 329/469 (70%), Positives = 383/469 (81%)
Query: 1 MESPNLLVASGS---KLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRL 57
ME N+ VAS S ++ S + KNP+LIC P+M +S+DKMV++ KA+ GADLVEIRL
Sbjct: 68 MEPSNVYVASNSTEMEIGSHDIVKNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRL 127
Query: 58 DGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDV 117
D LK+FNP E++KT+IK+SP+PTLFTYRP WEGGQY+GDENER DVLRLAMELGADYIDV
Sbjct: 128 DWLKDFNPLEDLKTIIKKSPLPTLFTYRPKWEGGQYEGDENERRDVLRLAMELGADYIDV 187
Query: 118 ELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTAL 177
ELQVA EF SI GKKP K KVIVSSHNYQ TPSVEDL LVARIQ +GADIVK ATTA+
Sbjct: 188 ELQVASEFIKSIDGKKPGKFKVIVSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAV 247
Query: 178 DITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTI 237
DI DVAR+F IT +QVP IGLVMGERGL+SRILC+KFGG+LTFGTL++ VSAPGQPTI
Sbjct: 248 DIADVARMFHITSKAQVPTIGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTI 307
Query: 238 KDLLDLYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFF 297
KDLLDLYNFR++GPDTKV+GIIGKPV HSKSPI++N+AFKSV FNGV+VHLLVD++ F
Sbjct: 308 KDLLDLYNFRRIGPDTKVYGIIGKPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFL 367
Query: 298 QTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGA 357
Q YSS+DFAGFSCTIPHKEAA++CCDEVD +AKSIGAVN I+RR+SDGKL GYNTD +G+
Sbjct: 368 QAYSSSDFAGFSCTIPHKEAALQCCDEVDPLAKSIGAVNTILRRKSDGKLLGYNTDCIGS 427
Query: 358 ISAIEDGLRGRLNVSG--GVSSALAGKLFVVIXXXXXXXXXXXXXXXXXXRVVIANRTYD 415
ISAIEDGLR + S SS LA K VVI +VVIANRTY+
Sbjct: 428 ISAIEDGLRSSGDPSSVPSSSSPLASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYE 487
Query: 416 RARELAETVGGHALSLADLENFNPEDGMILANTTSIGMQPKVDETPIPK 464
RA ELAE +GG ALSL DL+N++PEDGM+LANTTS+GMQP V+ETPI K
Sbjct: 488 RALELAEAIGGKALSLTDLDNYHPEDGMVLANTTSMGMQPNVEETPISK 536
|
|
| SGD|S000002534 ARO1 "Pentafunctional arom protein" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_2075 CBU_2075 "3-dehydroquinate dehydratase, type I" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4561 BA_4561 "shikimate 5-dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC1834.02 aro1 "pentafunctional aromatic polypeptide Aro1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000055969 aromA [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0004346 ARO1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0466 DET_0466 "3-dehydroquinate dehydratase, type I" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0623 CHY_0623 "shikimate 5-dehydrogenase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_3891 SPO_3891 "shikimate 5-dehydrogenase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| DHQD4 | dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25) (518 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| DHQS6 | • | • | • | • | • | 0.971 | |||||
| SK2 | • | • | • | 0.932 | |||||||
| SK3 | • | • | • | 0.931 | |||||||
| SKp | • | • | 0.927 | ||||||||
| SK1 | • | • | • | 0.920 | |||||||
| DHQD5 | • | • | • | 0.903 | |||||||
| DHQD3 | • | • | • | 0.902 | |||||||
| DHQD1 | • | • | • | 0.902 | |||||||
| DHQD2 | • | • | • | 0.901 | |||||||
| EPSPS | • | • | • | • | 0.751 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 465 | |||
| PLN02520 | 529 | PLN02520, PLN02520, bifunctional 3-dehydroquinate | 0.0 | |
| pfam01487 | 222 | pfam01487, DHquinase_I, Type I 3-dehydroquinase | 3e-83 | |
| TIGR01093 | 228 | TIGR01093, aroD, 3-dehydroquinate dehydratase, typ | 3e-72 | |
| cd00502 | 225 | cd00502, DHQase_I, Type I 3-dehydroquinase, (3-deh | 2e-65 | |
| COG0169 | 283 | COG0169, AroE, Shikimate 5-dehydrogenase [Amino ac | 9e-61 | |
| PRK00258 | 278 | PRK00258, aroE, shikimate 5-dehydrogenase; Reviewe | 7e-58 | |
| COG0710 | 231 | COG0710, AroD, 3-dehydroquinate dehydratase [Amino | 2e-52 | |
| PRK09310 | 477 | PRK09310, aroDE, bifunctional 3-dehydroquinate deh | 2e-46 | |
| TIGR00507 | 270 | TIGR00507, aroE, shikimate 5-dehydrogenase | 2e-43 | |
| PRK02412 | 253 | PRK02412, aroD, 3-dehydroquinate dehydratase; Prov | 1e-40 | |
| PRK12548 | 289 | PRK12548, PRK12548, shikimate 5-dehydrogenase; Pro | 9e-30 | |
| pfam08501 | 83 | pfam08501, Shikimate_dh_N, Shikimate dehydrogenase | 2e-28 | |
| PRK13575 | 238 | PRK13575, PRK13575, 3-dehydroquinate dehydratase; | 2e-25 | |
| TIGR01809 | 282 | TIGR01809, Shik-DH-AROM, shikimate-5-dehydrogenase | 2e-21 | |
| PRK12549 | 284 | PRK12549, PRK12549, shikimate 5-dehydrogenase; Rev | 2e-19 | |
| cd01065 | 155 | cd01065, NAD_bind_Shikimate_DH, NAD(P) binding dom | 4e-19 | |
| PRK12749 | 288 | PRK12749, PRK12749, quinate/shikimate dehydrogenas | 1e-17 | |
| pfam01488 | 133 | pfam01488, Shikimate_DH, Shikimate / quinate 5-deh | 5e-15 | |
| PRK12550 | 272 | PRK12550, PRK12550, shikimate 5-dehydrogenase; Rev | 9e-12 | |
| PRK00045 | 423 | PRK00045, hemA, glutamyl-tRNA reductase; Reviewed | 5e-11 | |
| PRK14027 | 283 | PRK14027, PRK14027, quinate/shikimate dehydrogenas | 2e-10 | |
| cd05213 | 311 | cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-bindi | 9e-10 | |
| COG0373 | 414 | COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme m | 5e-09 | |
| TIGR01035 | 417 | TIGR01035, hemA, glutamyl-tRNA reductase | 2e-07 | |
| PRK13576 | 216 | PRK13576, PRK13576, 3-dehydroquinate dehydratase; | 1e-06 | |
| cd08944 | 246 | cd08944, SDR_c12, classical (c) SDR, subgroup 12 | 5e-05 | |
| PRK07890 | 258 | PRK07890, PRK07890, short chain dehydrogenase; Pro | 1e-04 | |
| PRK08277 | 278 | PRK08277, PRK08277, D-mannonate oxidoreductase; Pr | 2e-04 | |
| cd08934 | 243 | cd08934, CAD_SDR_c, clavulanic acid dehydrogenase | 2e-04 | |
| PRK08642 | 253 | PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) | 3e-04 | |
| PRK12823 | 260 | PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1 | 3e-04 | |
| PRK08324 | 681 | PRK08324, PRK08324, short chain dehydrogenase; Val | 5e-04 | |
| cd05188 | 271 | cd05188, MDR, Medium chain reductase/dehydrogenase | 6e-04 | |
| PRK05872 | 296 | PRK05872, PRK05872, short chain dehydrogenase; Pro | 8e-04 | |
| PRK07067 | 257 | PRK07067, PRK07067, sorbitol dehydrogenase; Provis | 0.001 | |
| pfam03807 | 93 | pfam03807, F420_oxidored, NADP oxidoreductase coen | 0.001 | |
| PRK07231 | 251 | PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) | 0.002 | |
| smart01002 | 149 | smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT | 0.002 | |
| cd05305 | 359 | cd05305, L-AlaDH, Alanine dehydrogenase NAD-bindin | 0.002 | |
| PRK12384 | 259 | PRK12384, PRK12384, sorbitol-6-phosphate dehydroge | 0.003 | |
| cd05327 | 269 | cd05327, retinol-DH_like_SDR_c_like, retinol dehyd | 0.004 | |
| PRK07041 | 230 | PRK07041, PRK07041, short chain dehydrogenase; Pro | 0.004 | |
| cd00401 | 402 | cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N | 0.004 |
| >gnl|CDD|178135 PLN02520, PLN02520, bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
Score = 889 bits (2299), Expect = 0.0
Identities = 373/462 (80%), Positives = 410/462 (88%), Gaps = 1/462 (0%)
Query: 3 SPNLLVASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKN 62
+AS SGG+R+NPTLICVPIM +SVDKM+++M KA GADLVEIRLD LKN
Sbjct: 2 VSTASLASDDLQGSGGVRRNPTLICVPIMADSVDKMLIEMAKAKELGADLVEIRLDFLKN 61
Query: 63 FNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVA 122
FNPRE++KTLIK+SP+PTL TYRP WEGGQY+GDEN+R D LRLAMELGADY+DVEL+VA
Sbjct: 62 FNPREDLKTLIKQSPLPTLVTYRPKWEGGQYEGDENKRQDALRLAMELGADYVDVELKVA 121
Query: 123 REFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDV 182
EF +SI GKKPEKCKVIVSSHNY+ TPSVE+L NLVARIQA+GADIVK ATTALDITDV
Sbjct: 122 HEFINSISGKKPEKCKVIVSSHNYENTPSVEELGNLVARIQATGADIVKIATTALDITDV 181
Query: 183 ARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLD 242
AR+FQITVHSQVP IGLVMGERGLISRILC KFGG+LTFGTLE G VSAPGQPTIKDLLD
Sbjct: 182 ARMFQITVHSQVPTIGLVMGERGLISRILCPKFGGYLTFGTLEAGKVSAPGQPTIKDLLD 241
Query: 243 LYNFRQMGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSS 302
LYNFRQ+GPDTKV+GIIGKPVGHSKSPIL+NEAFKSVGFNGV+VHLLVDD+AKF QTYSS
Sbjct: 242 LYNFRQIGPDTKVYGIIGKPVGHSKSPILHNEAFKSVGFNGVYVHLLVDDLAKFLQTYSS 301
Query: 303 NDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIE 362
DFAGFSCTIPHKE A+KCCDEVD +AKSIGA+N IIRR SDGKL GYNTDY+GAISAIE
Sbjct: 302 PDFAGFSCTIPHKEDALKCCDEVDPIAKSIGAINTIIRRPSDGKLVGYNTDYIGAISAIE 361
Query: 363 DGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYDRARELAE 422
DGLR S S LAGKLFVVIGAGGAGKALAYGAK KGARVVIANRTY+RA+ELA+
Sbjct: 362 DGLRA-SGSSPASGSPLAGKLFVVIGAGGAGKALAYGAKEKGARVVIANRTYERAKELAD 420
Query: 423 TVGGHALSLADLENFNPEDGMILANTTSIGMQPKVDETPIPK 464
VGG AL+LADLENF+PE+GMILANTTS+GMQP VDETPI K
Sbjct: 421 AVGGQALTLADLENFHPEEGMILANTTSVGMQPNVDETPISK 462
|
Length = 529 |
| >gnl|CDD|216526 pfam01487, DHquinase_I, Type I 3-dehydroquinase | Back alignment and domain information |
|---|
| >gnl|CDD|233268 TIGR01093, aroD, 3-dehydroquinate dehydratase, type I | Back alignment and domain information |
|---|
| >gnl|CDD|188633 cd00502, DHQase_I, Type I 3-dehydroquinase, (3-dehydroquinate dehydratase or DHQase) | Back alignment and domain information |
|---|
| >gnl|CDD|223247 COG0169, AroE, Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|234703 PRK00258, aroE, shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223782 COG0710, AroD, 3-dehydroquinate dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|137204 PRK09310, aroDE, bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|161904 TIGR00507, aroE, shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|235036 PRK02412, aroD, 3-dehydroquinate dehydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183585 PRK12548, PRK12548, shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|149523 pfam08501, Shikimate_dh_N, Shikimate dehydrogenase substrate binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|184156 PRK13575, PRK13575, 3-dehydroquinate dehydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233580 TIGR01809, Shik-DH-AROM, shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >gnl|CDD|183586 PRK12549, PRK12549, shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|133443 cd01065, NAD_bind_Shikimate_DH, NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|183721 PRK12749, PRK12749, quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|216527 pfam01488, Shikimate_DH, Shikimate / quinate 5-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|183587 PRK12550, PRK12550, shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234592 PRK00045, hemA, glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|172521 PRK14027, PRK14027, quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133452 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >gnl|CDD|223450 COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233242 TIGR01035, hemA, glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >gnl|CDD|237433 PRK13576, PRK13576, 3-dehydroquinate dehydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 | Back alignment and domain information |
|---|
| >gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236216 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202773 pfam03807, F420_oxidored, NADP oxidoreductase coenzyme F420-dependent | Back alignment and domain information |
|---|
| >gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214966 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240630 cd05305, L-AlaDH, Alanine dehydrogenase NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|235914 PRK07041, PRK07041, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 465 | |||
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 100.0 | |
| PRK09310 | 477 | aroDE bifunctional 3-dehydroquinate dehydratase/sh | 100.0 | |
| PRK02412 | 253 | aroD 3-dehydroquinate dehydratase; Provisional | 100.0 | |
| COG0710 | 231 | AroD 3-dehydroquinate dehydratase [Amino acid tran | 100.0 | |
| TIGR01093 | 228 | aroD 3-dehydroquinate dehydratase, type I. Type II | 100.0 | |
| PF01487 | 224 | DHquinase_I: Type I 3-dehydroquinase; InterPro: IP | 100.0 | |
| PRK13575 | 238 | 3-dehydroquinate dehydratase; Provisional | 100.0 | |
| cd00502 | 225 | DHQase_I Type I 3-dehydroquinase, (3-dehydroquinat | 100.0 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 100.0 | |
| PRK13576 | 216 | 3-dehydroquinate dehydratase; Provisional | 100.0 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 100.0 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 100.0 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 100.0 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 100.0 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 100.0 | |
| PRK01261 | 229 | aroD 3-dehydroquinate dehydratase; Provisional | 100.0 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 100.0 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 100.0 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 100.0 | |
| KOG0692 | 595 | consensus Pentafunctional AROM protein [Amino acid | 99.95 | |
| PF08501 | 83 | Shikimate_dh_N: Shikimate dehydrogenase substrate | 99.93 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 99.82 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 99.43 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 99.12 | |
| PRK08291 | 330 | ectoine utilization protein EutC; Validated | 99.1 | |
| TIGR02992 | 326 | ectoine_eutC ectoine utilization protein EutC. Mem | 99.07 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 99.06 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 99.02 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 98.96 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 98.65 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 98.65 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 98.63 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 98.58 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 98.5 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 98.5 | |
| COG4221 | 246 | Short-chain alcohol dehydrogenase of unknown speci | 98.36 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 98.32 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 98.28 | |
| PRK00676 | 338 | hemA glutamyl-tRNA reductase; Validated | 98.15 | |
| KOG1201 | 300 | consensus Hydroxysteroid 17-beta dehydrogenase 11 | 98.14 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 98.12 | |
| KOG1205 | 282 | consensus Predicted dehydrogenase [Secondary metab | 98.11 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 98.06 | |
| PRK06141 | 314 | ornithine cyclodeaminase; Validated | 98.04 | |
| PRK07340 | 304 | ornithine cyclodeaminase; Validated | 98.0 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 98.0 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 97.97 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 97.95 | |
| KOG1208 | 314 | consensus Dehydrogenases with different specificit | 97.93 | |
| KOG0725 | 270 | consensus Reductases with broad range of substrate | 97.88 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 97.87 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 97.86 | |
| KOG1200 | 256 | consensus Mitochondrial/plastidial beta-ketoacyl-A | 97.86 | |
| COG3967 | 245 | DltE Short-chain dehydrogenase involved in D-alani | 97.85 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 97.85 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 97.83 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 97.78 | |
| KOG1207 | 245 | consensus Diacetyl reductase/L-xylulose reductase | 97.78 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 97.77 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 97.74 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.73 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 97.73 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 97.71 | |
| PRK07984 | 262 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.69 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 97.69 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 97.67 | |
| PRK08415 | 274 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.66 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 97.66 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 97.66 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 97.65 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 97.65 | |
| PRK07533 | 258 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.64 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 97.64 | |
| PRK14194 | 301 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.64 | |
| PRK10792 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.64 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 97.63 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 97.62 | |
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.61 | |
| PRK08159 | 272 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.61 | |
| PRK14176 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.6 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 97.59 | |
| PRK06720 | 169 | hypothetical protein; Provisional | 97.59 | |
| PRK05717 | 255 | oxidoreductase; Validated | 97.59 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 97.58 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 97.57 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 97.57 | |
| PRK14188 | 296 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.56 | |
| PRK14189 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.56 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 97.55 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 97.55 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 97.55 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 97.54 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 97.54 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 97.54 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 97.53 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 97.52 | |
| KOG1014 | 312 | consensus 17 beta-hydroxysteroid dehydrogenase typ | 97.52 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 97.52 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 97.51 | |
| PRK08594 | 257 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.51 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 97.5 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 97.5 | |
| PRK07889 | 256 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.5 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 97.5 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 97.49 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 97.49 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 97.49 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 97.49 | |
| PRK06603 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.49 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 97.49 | |
| PRK08690 | 261 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.48 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 97.48 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 97.47 | |
| PRK07453 | 322 | protochlorophyllide oxidoreductase; Validated | 97.47 | |
| PRK07791 | 286 | short chain dehydrogenase; Provisional | 97.44 | |
| PLN02730 | 303 | enoyl-[acyl-carrier-protein] reductase | 97.44 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 97.43 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 97.43 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 97.42 | |
| PRK06997 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.41 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 97.41 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 97.41 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 97.39 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 97.39 | |
| PRK07370 | 258 | enoyl-(acyl carrier protein) reductase; Validated | 97.39 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 97.38 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 97.38 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 97.37 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 97.37 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 97.36 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 97.36 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 97.36 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 97.36 | |
| PRK06940 | 275 | short chain dehydrogenase; Provisional | 97.36 | |
| PRK14191 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.36 | |
| KOG1209 | 289 | consensus 1-Acyl dihydroxyacetone phosphate reduct | 97.36 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 97.35 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 97.34 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 97.34 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 97.33 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 97.32 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 97.32 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 97.31 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 97.31 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 97.31 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 97.31 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 97.31 | |
| PRK08340 | 259 | glucose-1-dehydrogenase; Provisional | 97.3 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 97.3 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 97.3 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 97.3 | |
| TIGR01289 | 314 | LPOR light-dependent protochlorophyllide reductase | 97.28 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 97.28 | |
| PRK08643 | 256 | acetoin reductase; Validated | 97.28 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 97.27 | |
| PRK14178 | 279 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.27 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 97.26 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 97.26 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 97.24 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 97.24 | |
| PRK07677 | 252 | short chain dehydrogenase; Provisional | 97.24 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 97.23 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 97.23 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 97.22 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 97.22 | |
| PRK06483 | 236 | dihydromonapterin reductase; Provisional | 97.22 | |
| PRK14180 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.2 | |
| PRK14179 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.2 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 97.19 | |
| PRK06398 | 258 | aldose dehydrogenase; Validated | 97.18 | |
| TIGR02632 | 676 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc | 97.18 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 97.17 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 97.17 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 97.17 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 97.17 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 97.15 | |
| PRK06300 | 299 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.15 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 97.14 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 97.14 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 97.14 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 97.14 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 97.13 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 97.13 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 97.12 | |
| PRK10538 | 248 | malonic semialdehyde reductase; Provisional | 97.12 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 97.12 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 97.12 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 97.12 | |
| PRK14172 | 278 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.12 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 97.11 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 97.11 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 97.11 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 97.1 | |
| PRK14177 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.1 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 97.09 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 97.09 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 97.09 | |
| PRK07832 | 272 | short chain dehydrogenase; Provisional | 97.09 | |
| PRK08063 | 250 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.08 | |
| PRK14183 | 281 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.08 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 97.08 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 97.07 | |
| PF07991 | 165 | IlvN: Acetohydroxy acid isomeroreductase, catalyti | 97.07 | |
| PRK05599 | 246 | hypothetical protein; Provisional | 97.07 | |
| PLN02928 | 347 | oxidoreductase family protein | 97.06 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 97.04 | |
| KOG4169 | 261 | consensus 15-hydroxyprostaglandin dehydrogenase an | 97.04 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 97.03 | |
| PRK14166 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.03 | |
| PRK14187 | 294 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.03 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 97.02 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 97.02 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 97.02 | |
| PRK05650 | 270 | short chain dehydrogenase; Provisional | 97.02 | |
| PRK14190 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.01 | |
| PRK05884 | 223 | short chain dehydrogenase; Provisional | 97.01 | |
| PRK14182 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.01 | |
| PRK14173 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 97.01 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 97.0 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 97.0 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 96.99 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 96.99 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 96.99 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 96.99 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 96.99 | |
| PLN02494 | 477 | adenosylhomocysteinase | 96.98 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 96.98 | |
| PRK14171 | 288 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.97 | |
| PRK06046 | 326 | alanine dehydrogenase; Validated | 96.97 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 96.96 | |
| PRK14169 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.96 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 96.96 | |
| PRK12747 | 252 | short chain dehydrogenase; Provisional | 96.95 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 96.95 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 96.95 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 96.94 | |
| PLN02516 | 299 | methylenetetrahydrofolate dehydrogenase (NADP+) | 96.93 | |
| PRK14170 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.92 | |
| PRK14186 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.91 | |
| PF02423 | 313 | OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst | 96.89 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 96.88 | |
| PRK12938 | 246 | acetyacetyl-CoA reductase; Provisional | 96.88 | |
| PRK06823 | 315 | ornithine cyclodeaminase; Validated | 96.87 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 96.87 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 96.86 | |
| PRK06407 | 301 | ornithine cyclodeaminase; Provisional | 96.86 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 96.86 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 96.86 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 96.85 | |
| PRK14181 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.85 | |
| PRK07904 | 253 | short chain dehydrogenase; Provisional | 96.83 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 96.83 | |
| PRK06463 | 255 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.83 | |
| PRK14185 | 293 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.82 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 96.82 | |
| PRK08017 | 256 | oxidoreductase; Provisional | 96.82 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.82 | |
| PRK08177 | 225 | short chain dehydrogenase; Provisional | 96.82 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 96.82 | |
| PRK14193 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.8 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.79 | |
| PRK14167 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.78 | |
| PLN02616 | 364 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 96.78 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 96.77 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 96.76 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 96.76 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 96.76 | |
| PRK06101 | 240 | short chain dehydrogenase; Provisional | 96.76 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 96.76 | |
| PRK07775 | 274 | short chain dehydrogenase; Provisional | 96.76 | |
| TIGR02415 | 254 | 23BDH acetoin reductases. One member of this famil | 96.74 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 96.74 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 96.74 | |
| TIGR02685 | 267 | pter_reduc_Leis pteridine reductase. Pteridine red | 96.72 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 96.72 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 96.71 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 96.69 | |
| TIGR02371 | 325 | ala_DH_arch alanine dehydrogenase, Archaeoglobus f | 96.69 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 96.68 | |
| PRK06199 | 379 | ornithine cyclodeaminase; Validated | 96.68 | |
| PRK07589 | 346 | ornithine cyclodeaminase; Validated | 96.66 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 96.66 | |
| COG1028 | 251 | FabG Dehydrogenases with different specificities ( | 96.66 | |
| COG0190 | 283 | FolD 5,10-methylene-tetrahydrofolate dehydrogenase | 96.66 | |
| PRK14184 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.66 | |
| PRK12859 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 96.65 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 96.65 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 96.64 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.64 | |
| PLN02897 | 345 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 96.64 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 96.63 | |
| PRK12744 | 257 | short chain dehydrogenase; Provisional | 96.63 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 96.62 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.6 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 96.59 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 96.59 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 96.58 | |
| PRK12743 | 256 | oxidoreductase; Provisional | 96.58 | |
| PRK09134 | 258 | short chain dehydrogenase; Provisional | 96.58 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 96.58 | |
| PRK12748 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 96.57 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 96.56 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 96.56 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 96.55 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 96.54 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 96.53 | |
| PRK09140 | 206 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R | 96.53 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 96.52 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.51 | |
| PRK07069 | 251 | short chain dehydrogenase; Validated | 96.51 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 96.51 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 96.51 | |
| PRK05579 | 399 | bifunctional phosphopantothenoylcysteine decarboxy | 96.5 | |
| COG2084 | 286 | MmsB 3-hydroxyisobutyrate dehydrogenase and relate | 96.5 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 96.5 | |
| PRK14174 | 295 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.49 | |
| PLN00015 | 308 | protochlorophyllide reductase | 96.48 | |
| PRK06550 | 235 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.47 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 96.44 | |
| TIGR01829 | 242 | AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy | 96.43 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 96.42 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.41 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.41 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 96.4 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 96.4 | |
| PRK15461 | 296 | NADH-dependent gamma-hydroxybutyrate dehydrogenase | 96.39 | |
| PRK12935 | 247 | acetoacetyl-CoA reductase; Provisional | 96.36 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 96.35 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 96.34 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 96.32 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 96.31 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 96.31 | |
| PRK06077 | 252 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.3 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 96.28 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 96.28 | |
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogena | 96.27 | |
| PRK14168 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 96.27 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.26 | |
| PRK09730 | 247 | putative NAD(P)-binding oxidoreductase; Provisiona | 96.26 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 96.26 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 96.25 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.24 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 96.23 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 96.22 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 96.22 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 96.22 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 96.21 | |
| PRK12491 | 272 | pyrroline-5-carboxylate reductase; Reviewed | 96.21 | |
| COG2423 | 330 | Predicted ornithine cyclodeaminase, mu-crystallin | 96.21 | |
| COG2085 | 211 | Predicted dinucleotide-binding enzymes [General fu | 96.2 | |
| PRK07041 | 230 | short chain dehydrogenase; Provisional | 96.19 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 96.19 | |
| PRK12745 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 96.18 | |
| PRK06953 | 222 | short chain dehydrogenase; Provisional | 96.18 | |
| PRK08219 | 227 | short chain dehydrogenase; Provisional | 96.17 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 96.16 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 96.16 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 96.15 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 96.15 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 96.14 | |
| TIGR00465 | 314 | ilvC ketol-acid reductoisomerase. This is the seco | 96.14 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 96.13 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 96.13 | |
| PRK03369 | 488 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 96.12 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 96.11 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 96.1 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 96.09 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 96.08 | |
| cd07937 | 275 | DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar | 96.07 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 96.07 | |
| PRK06947 | 248 | glucose-1-dehydrogenase; Provisional | 96.07 | |
| cd05212 | 140 | NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom | 96.07 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 96.06 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 96.05 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 96.05 | |
| PLN02350 | 493 | phosphogluconate dehydrogenase (decarboxylating) | 96.04 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 95.98 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 95.98 | |
| PRK07102 | 243 | short chain dehydrogenase; Provisional | 95.97 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 95.97 | |
| PRK13656 | 398 | trans-2-enoyl-CoA reductase; Provisional | 95.96 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 95.96 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 95.95 | |
| PRK12825 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 95.93 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 95.93 | |
| PRK07679 | 279 | pyrroline-5-carboxylate reductase; Reviewed | 95.92 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 95.92 | |
| COG0345 | 266 | ProC Pyrroline-5-carboxylate reductase [Amino acid | 95.91 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 95.9 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 95.9 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 95.88 | |
| COG0499 | 420 | SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me | 95.84 | |
| cd00452 | 190 | KDPG_aldolase KDPG and KHG aldolase. This family b | 95.84 | |
| PF13561 | 241 | adh_short_C2: Enoyl-(Acyl carrier protein) reducta | 95.83 | |
| PRK06123 | 248 | short chain dehydrogenase; Provisional | 95.82 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 95.8 | |
| PRK13302 | 271 | putative L-aspartate dehydrogenase; Provisional | 95.79 | |
| PRK07680 | 273 | late competence protein ComER; Validated | 95.78 | |
| PF02719 | 293 | Polysacc_synt_2: Polysaccharide biosynthesis prote | 95.77 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 95.74 | |
| PRK08605 | 332 | D-lactate dehydrogenase; Validated | 95.74 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 95.74 | |
| PRK06476 | 258 | pyrroline-5-carboxylate reductase; Reviewed | 95.73 | |
| PLN00198 | 338 | anthocyanidin reductase; Provisional | 95.72 | |
| PF02882 | 160 | THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl | 95.7 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 95.7 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 95.69 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 95.69 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 95.68 | |
| cd00958 | 235 | DhnA Class I fructose-1,6-bisphosphate (FBP) aldol | 95.67 | |
| PRK12330 | 499 | oxaloacetate decarboxylase; Provisional | 95.66 | |
| COG0287 | 279 | TyrA Prephenate dehydrogenase [Amino acid transpor | 95.65 | |
| PRK12824 | 245 | acetoacetyl-CoA reductase; Provisional | 95.64 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 95.61 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 95.61 | |
| PLN02256 | 304 | arogenate dehydrogenase | 95.59 | |
| PLN02688 | 266 | pyrroline-5-carboxylate reductase | 95.56 | |
| KOG0409 | 327 | consensus Predicted dehydrogenase [General functio | 95.55 | |
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 95.53 | |
| TIGR00873 | 467 | gnd 6-phosphogluconate dehydrogenase, decarboxylat | 95.5 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 95.49 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 95.47 | |
| cd04740 | 296 | DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c | 95.46 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 95.46 | |
| KOG0024 | 354 | consensus Sorbitol dehydrogenase [Secondary metabo | 95.45 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 95.44 | |
| KOG0069 | 336 | consensus Glyoxylate/hydroxypyruvate reductase (D- | 95.44 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 95.44 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 95.44 | |
| PRK13304 | 265 | L-aspartate dehydrogenase; Reviewed | 95.43 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 95.42 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 95.4 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 95.35 | |
| cd04726 | 202 | KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl | 95.33 | |
| PLN02586 | 360 | probable cinnamyl alcohol dehydrogenase | 95.3 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 95.29 | |
| cd00945 | 201 | Aldolase_Class_I Class I aldolases. The class I al | 95.29 | |
| PRK06924 | 251 | short chain dehydrogenase; Provisional | 95.28 | |
| PRK07578 | 199 | short chain dehydrogenase; Provisional | 95.28 | |
| PTZ00142 | 470 | 6-phosphogluconate dehydrogenase; Provisional | 95.28 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 95.28 | |
| cd00958 | 235 | DhnA Class I fructose-1,6-bisphosphate (FBP) aldol | 95.26 | |
| TIGR01692 | 288 | HIBADH 3-hydroxyisobutyrate dehydrogenase. This en | 95.23 | |
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism asso | 95.21 | |
| PRK12331 | 448 | oxaloacetate decarboxylase; Provisional | 95.19 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.13 | |
| KOG1199 | 260 | consensus Short-chain alcohol dehydrogenase/3-hydr | 95.12 | |
| KOG1210 | 331 | consensus Predicted 3-ketosphinganine reductase [S | 95.1 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 95.09 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 95.05 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 95.05 | |
| PRK14620 | 326 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 95.04 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 95.02 | |
| cd08237 | 341 | ribitol-5-phosphate_DH ribitol-5-phosphate dehydro | 95.0 | |
| TIGR03128 | 206 | RuMP_HxlA 3-hexulose-6-phosphate synthase. at the | 94.99 | |
| PRK07455 | 187 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 94.98 | |
| TIGR01500 | 256 | sepiapter_red sepiapterin reductase. This model de | 94.98 | |
| PLN02712 | 667 | arogenate dehydrogenase | 94.96 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.95 | |
| cd03174 | 265 | DRE_TIM_metallolyase DRE-TIM metallolyase superfam | 94.88 | |
| cd00959 | 203 | DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of | 94.85 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 94.85 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 94.84 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 94.84 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 94.82 | |
| cd08293 | 345 | PTGR2 Prostaglandin reductase. Prostaglandins and | 94.8 | |
| TIGR02822 | 329 | adh_fam_2 zinc-binding alcohol dehydrogenase famil | 94.76 | |
| TIGR01472 | 343 | gmd GDP-mannose 4,6-dehydratase. Excluded from thi | 94.72 | |
| PRK14806 | 735 | bifunctional cyclohexadienyl dehydrogenase/ 3-phos | 94.72 | |
| cd00650 | 263 | LDH_MDH_like NAD-dependent, lactate dehydrogenase- | 94.72 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 94.72 | |
| TIGR01777 | 292 | yfcH conserved hypothetical protein TIGR01777. Thi | 94.7 | |
| COG1712 | 255 | Predicted dinucleotide-utilizing enzyme [General f | 94.7 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 94.68 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 94.67 | |
| PLN02178 | 375 | cinnamyl-alcohol dehydrogenase | 94.66 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 94.64 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 94.64 | |
| PRK08507 | 275 | prephenate dehydrogenase; Validated | 94.64 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 94.61 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 94.58 | |
| COG0686 | 371 | Ald Alanine dehydrogenase [Amino acid transport an | 94.57 | |
| cd08281 | 371 | liver_ADH_like1 Zinc-dependent alcohol dehydrogena | 94.55 | |
| cd08242 | 319 | MDR_like Medium chain dehydrogenases/reductase (MD | 94.55 | |
| PLN02712 | 667 | arogenate dehydrogenase | 94.53 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 94.51 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 94.5 | |
| PRK14041 | 467 | oxaloacetate decarboxylase; Provisional | 94.49 | |
| KOG1502 | 327 | consensus Flavonol reductase/cinnamoyl-CoA reducta | 94.46 | |
| PRK08309 | 177 | short chain dehydrogenase; Provisional | 94.43 | |
| PLN02514 | 357 | cinnamyl-alcohol dehydrogenase | 94.41 | |
| cd05188 | 271 | MDR Medium chain reductase/dehydrogenase (MDR)/zin | 94.4 | |
| cd08239 | 339 | THR_DH_like L-threonine dehydrogenase (TDH)-like. | 94.34 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 94.33 | |
| TIGR01202 | 308 | bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl | 94.32 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 94.3 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 94.26 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 94.25 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 94.2 | |
| PLN02740 | 381 | Alcohol dehydrogenase-like | 94.17 |
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-102 Score=833.57 Aligned_cols=454 Identities=82% Similarity=1.257 Sum_probs=406.5
Q ss_pred cccccccccCCCCCCcEEEEeeccCCHHHHHHHHHhhhhcCCCEEEEEecCCCCCCchhHHHHHHhhCCCcEEEEeccCC
Q 012352 9 ASGSKLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIW 88 (465)
Q Consensus 9 ~~~~~~~~~~~~~~~~~icv~l~~~t~~e~~~~~~~~~~~~~D~vElRlD~l~~~~~~~~l~~l~~~~~~PiI~T~R~~~ 88 (465)
||.---|||+++.++|+|||||++++.+|++.+++++...++|+||||+|+|++..+.+++..+++..++|+|||+|+++
T Consensus 8 ~~~~~~~~~~~~~~~~~icv~i~~~~~~e~~~~~~~~~~~~~D~vElRlD~l~~~~~~~~~~~~~~~~~~plI~T~R~~~ 87 (529)
T PLN02520 8 ASDDLQGSGGVRRNPTLICVPIMADSVDKMLIEMAKAKELGADLVEIRLDFLKNFNPREDLKTLIKQSPLPTLVTYRPKW 87 (529)
T ss_pred hhhhhhcccccccCCCEEEEEeCCCCHHHHHHHHHHhhhcCCCEEEEEeccccccCCHHHHHHHHhcCCCcEEEEeccHH
Confidence 44555689999999999999999999999999999887789999999999999876666777777777899999999999
Q ss_pred CCCCCCCCHHHHHHHHHHHHHhCCcEEEEeeccccchhHHHHhcCCCCcEEEEEeccCCCCCCHHHHHHHHHHHHHcCCC
Q 012352 89 EGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGAD 168 (465)
Q Consensus 89 eGG~~~~~~~~~~~~l~~~~~~~~~~iDiEl~~~~~~~~~l~~~~~~~~~iI~S~H~f~~tps~~el~~~~~~~~~~gad 168 (465)
|||.++.++++|+++|+.+++.++||||||++..++..+.+...+..++++|+|||||++||+.+|+.+++++|+++|||
T Consensus 88 eGG~~~~~~~~~~~ll~~~~~~~~d~iDiEl~~~~~~~~~~~~~~~~~~~vI~S~H~f~~tP~~~el~~~~~~~~~~gaD 167 (529)
T PLN02520 88 EGGQYEGDENKRQDALRLAMELGADYVDVELKVAHEFINSISGKKPEKCKVIVSSHNYENTPSVEELGNLVARIQATGAD 167 (529)
T ss_pred HCCCCCCCHHHHHHHHHHHHHhCCCEEEEEcCCchhHHHHHHhhhhcCCEEEEEecCCCCCCCHHHHHHHHHHHHHhCCC
Confidence 99999999999999999999999999999999888776666666668999999999999999999999999999999999
Q ss_pred EEEEEeecCCHHHHHHHHHHhccCCCCEEEEecCccchhhhhhccccCCccccccccCccCCCCCCCChhhHHhhhcccc
Q 012352 169 IVKFATTALDITDVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQ 248 (465)
Q Consensus 169 ivKia~~~~~~~D~~~ll~~~~~~~~p~i~~~MG~~G~~sRi~~~~~Gs~~tf~~~~~~~~sApGQ~~~~~l~~~~~~~~ 248 (465)
|+|||+||++.+|++++++++.+.+.|+|+||||+.|++||+++++|||++||++++++.++||||++++++++++++.+
T Consensus 168 i~Kia~~~~~~~D~~~ll~~~~~~~~p~i~~~MG~~G~~sRi~~~~~GS~lTy~~~~~~~~sAPGQ~~~~~l~~~~~~~~ 247 (529)
T PLN02520 168 IVKIATTALDITDVARMFQITVHSQVPTIGLVMGERGLISRILCPKFGGYLTFGTLEAGKVSAPGQPTIKDLLDLYNFRQ 247 (529)
T ss_pred EEEEecCCCCHHHHHHHHHHHhhcCCCEEEEecCCCCchheecccccCCceeeeecCcccccCCCCCCHHHHHHHhhhhc
Confidence 99999999999999999998777789999999999999999999999999999999865579999999999999999999
Q ss_pred cCCCcceeeecCCCccccccHHHHHHHHHHcCCCeeEeccccccHHHHHHHhhcCCCCeeEeccCchHHHhhhccccCHH
Q 012352 249 MGPDTKVFGIIGKPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTV 328 (465)
Q Consensus 249 ~~~~~~~~~~iG~pi~hS~SP~~hn~~f~~~gl~~~y~~~~~~~l~~~~~~l~~~~~~G~~vT~P~K~~v~~~~d~~~~~ 328 (465)
+.++|++|+|+|+||+||+||.|||++|+++|+|+.|.++++++++++++.++.++|.|+|||||||+++++++|++++.
T Consensus 248 ~~~~t~~~~liG~Pi~hS~SP~ihn~~f~~~gl~~~Y~~~~v~~l~~~~~~l~~~~~~G~nVTiP~K~~v~~~lD~~~~~ 327 (529)
T PLN02520 248 IGPDTKVYGIIGKPVGHSKSPILHNEAFKSVGFNGVYVHLLVDDLAKFLQTYSSPDFAGFSCTIPHKEDALKCCDEVDPI 327 (529)
T ss_pred ccCCceEEEEEcCCcccccCHHHHHHHHHHCCCCcEEEEeehhhHHHHHHHHhhCCCCEEEECcCCHHHHHHHhccCCHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhccceeeEEEeccCCeEEEEeccHHHHHHHHHhhhccCCCCCCCcccccCCcEEEEEccchhHHHHHHHHHHCCCeEE
Q 012352 329 AKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSGGVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVV 408 (465)
Q Consensus 329 A~~~gavNtv~~~~~~g~l~G~NTD~~G~~~~l~~~~~~~~~~~~~~~~~l~~k~vlV~GaGg~g~ai~~~L~~~G~~v~ 408 (465)
|+.+||||||+++..+|+|+||||||.||+++|++.+... +..+..+.++++|+|+|+|+||+|++++++|++.|++|+
T Consensus 328 A~~iGAVNTvv~~~~~g~l~G~NTD~~G~~~~l~~~~~~~-~~~~~~~~~~~~k~vlIlGaGGagrAia~~L~~~G~~V~ 406 (529)
T PLN02520 328 AKSIGAINTIIRRPSDGKLVGYNTDYIGAISAIEDGLRAS-GSSPASGSPLAGKLFVVIGAGGAGKALAYGAKEKGARVV 406 (529)
T ss_pred HHHhCCceEEEEeCCCCEEEEEcccHHHHHHHHHhhhccc-ccccccccCCCCCEEEEECCcHHHHHHHHHHHHCCCEEE
Confidence 9999999999986227899999999999999998643110 000001245778999999999999999999999999999
Q ss_pred EEECCHHHHHHHHHHHCCcccchhcccccCCCCeeEEEecCCCCCCCCCCCCCCC
Q 012352 409 IANRTYDRARELAETVGGHALSLADLENFNPEDGMILANTTSIGMQPKVDETPIP 463 (465)
Q Consensus 409 i~~R~~~~a~~la~~~~~~~~~~~~l~~~~~~~~DilInaT~~gm~~~~~~~p~~ 463 (465)
++||+.+++++++++++...+.++++.+.....+|+||||||+||.+..+.+|++
T Consensus 407 i~nR~~e~a~~la~~l~~~~~~~~~~~~~~~~~~diiINtT~vGm~~~~~~~pl~ 461 (529)
T PLN02520 407 IANRTYERAKELADAVGGQALTLADLENFHPEEGMILANTTSVGMQPNVDETPIS 461 (529)
T ss_pred EEcCCHHHHHHHHHHhCCceeeHhHhhhhccccCeEEEecccCCCCCCCCCCccc
Confidence 9999999999999988654455555432122357999999999999877777765
|
|
| >PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK02412 aroD 3-dehydroquinate dehydratase; Provisional | Back alignment and domain information |
|---|
| >COG0710 AroD 3-dehydroquinate dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01093 aroD 3-dehydroquinate dehydratase, type I | Back alignment and domain information |
|---|
| >PF01487 DHquinase_I: Type I 3-dehydroquinase; InterPro: IPR001381 3-dehydroquinate dehydratase (4 | Back alignment and domain information |
|---|
| >PRK13575 3-dehydroquinate dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd00502 DHQase_I Type I 3-dehydroquinase, (3-dehydroquinate dehydratase or DHQase | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13576 3-dehydroquinate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK01261 aroD 3-dehydroquinate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >KOG0692 consensus Pentafunctional AROM protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08501 Shikimate_dh_N: Shikimate dehydrogenase substrate binding domain; InterPro: IPR013708 This domain is the substrate binding domain of shikimate dehydrogenase [] | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08291 ectoine utilization protein EutC; Validated | Back alignment and domain information |
|---|
| >TIGR02992 ectoine_eutC ectoine utilization protein EutC | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK00676 hemA glutamyl-tRNA reductase; Validated | Back alignment and domain information |
|---|
| >KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK06141 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK07340 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07984 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK08415 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07533 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08159 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06720 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08594 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07889 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK06603 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08690 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07453 protochlorophyllide oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK07791 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02730 enoyl-[acyl-carrier-protein] reductase | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06997 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07370 enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08303 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06940 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08340 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >TIGR01289 LPOR light-dependent protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07677 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06483 dihydromonapterin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06398 aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06300 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10538 malonic semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05693 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07832 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08063 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates | Back alignment and domain information |
|---|
| >PRK05599 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK05650 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05884 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK08936 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK06046 alanine dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12747 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) | Back alignment and domain information |
|---|
| >PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12938 acetyacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06823 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06407 ornithine cyclodeaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06181 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07904 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08017 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08177 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK06101 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PRK07775 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02415 23BDH acetoin reductases | Back alignment and domain information |
|---|
| >PRK12746 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02685 pter_reduc_Leis pteridine reductase | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06199 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK07589 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PRK12744 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK12743 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09134 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07069 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated | Back alignment and domain information |
|---|
| >COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN00015 protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12935 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09730 putative NAD(P)-binding oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK12491 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07041 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06953 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08219 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00465 ilvC ketol-acid reductoisomerase | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK06947 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PLN02350 phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07102 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13656 trans-2-enoyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07679 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd00452 KDPG_aldolase KDPG and KHG aldolase | Back alignment and domain information |
|---|
| >PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B | Back alignment and domain information |
|---|
| >PRK06123 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >PRK13302 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07680 late competence protein ComER; Validated | Back alignment and domain information |
|---|
| >PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08605 D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >PRK06476 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN00198 anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK12330 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12824 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02688 pyrroline-5-carboxylate reductase | Back alignment and domain information |
|---|
| >KOG0409 consensus Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13304 L-aspartate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) | Back alignment and domain information |
|---|
| >PLN02586 probable cinnamyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >cd00945 Aldolase_Class_I Class I aldolases | Back alignment and domain information |
|---|
| >PRK06924 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07578 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00142 6-phosphogluconate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea | Back alignment and domain information |
|---|
| >TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK12331 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase | Back alignment and domain information |
|---|
| >PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01500 sepiapter_red sepiapterin reductase | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily | Back alignment and domain information |
|---|
| >cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >cd08293 PTGR2 Prostaglandin reductase | Back alignment and domain information |
|---|
| >TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR01472 gmd GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >TIGR01777 yfcH conserved hypothetical protein TIGR01777 | Back alignment and domain information |
|---|
| >COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02178 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PRK08507 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >PRK14041 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK08309 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02514 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02740 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 465 | ||||
| 2gpt_A | 523 | Crystal Structure Of Arabidopsis Dehydroquinate Deh | 0.0 | ||
| 2o7q_A | 523 | Crystal Structure Of The A. Thaliana Dhq-Dehydroshi | 0.0 | ||
| 1nvt_A | 287 | Crystal Structure Of Shikimate Dehydrogenase (Aroe | 2e-23 | ||
| 2egg_A | 297 | Crystal Structure Of Shikimate 5-Dehydrogenase (Aro | 6e-23 | ||
| 3js3_A | 258 | Crystal Structure Of Type I 3-Dehydroquinate Dehydr | 5e-22 | ||
| 3l2i_A | 276 | 1.85 Angstrom Crystal Structure Of The 3-Dehydroqui | 4e-19 | ||
| 3m7w_A | 255 | Crystal Structure Of Type I 3-Dehydroquinate Dehydr | 4e-19 | ||
| 3don_A | 277 | Crystal Structure Of Shikimate Dehydrogenase From S | 7e-19 | ||
| 4guf_A | 276 | 1.5 Angstrom Crystal Structure Of The Salmonella En | 2e-18 | ||
| 3nnt_A | 276 | Crystal Structure Of K170m Mutant Of Type I 3-Dehyd | 2e-18 | ||
| 3o1n_A | 276 | 1.03 Angstrom Crystal Structure Of Q236a Mutant Typ | 2e-18 | ||
| 1qfe_A | 252 | The Structure Of Type I 3-Dehydroquinate Dehydratas | 3e-18 | ||
| 2hk7_A | 269 | Crystal Structure Of Shikimate Dehydrogenase From A | 1e-17 | ||
| 2hk9_A | 275 | Crystal Structure Of Shikimate Dehydrogenase From A | 1e-17 | ||
| 1wxd_A | 263 | Crystal Structure Of Shikimate 5-dehydrogenase (aro | 6e-15 | ||
| 2ox1_A | 196 | Archaeal Dehydroquinase Length = 196 | 1e-14 | ||
| 2yr1_A | 257 | Crystal Structure Of 3-Dehydroquinate Dehydratase F | 4e-14 | ||
| 1nyt_A | 271 | Shikimate Dehydrogenase Aroe Complexed With Nadp+ L | 3e-13 | ||
| 3u62_A | 253 | Crystal Structure Of Shikimate Dehydrogenase From T | 5e-13 | ||
| 1sfl_A | 238 | 1.9a Crystal Structure Of Staphylococcus Aureus Typ | 1e-12 | ||
| 3toz_A | 315 | 2.2 Angstrom Crystal Structure Of Shikimate 5-Dehyd | 2e-12 | ||
| 1sfj_A | 238 | 2.4a Crystal Structure Of Staphylococcus Aureus Typ | 3e-12 | ||
| 2egz_A | 219 | Crystal Structure Of The 3-Dehydroquinate Dehydrata | 2e-11 | ||
| 4fq8_A | 271 | Crystal Structure Of Shikimate Dehydrogenase (Aroe) | 3e-11 | ||
| 4fr5_A | 271 | Crystal Structure Of Shikimate Dehydrogenase (Aroe) | 3e-11 | ||
| 4fpx_A | 271 | Crystal Structure Of Shikimate Dehydrogenase (Aroe) | 3e-11 | ||
| 4foo_A | 271 | Crystal Structure Of Shikimate Dehydrogenase (Aroe) | 3e-11 | ||
| 4fos_A | 271 | Crystal Structure Of Shikimate Dehydrogenase (Aroe) | 3e-11 | ||
| 3phg_A | 269 | Crystal Structure Of The Shikimate 5-Dehydrogenase | 3e-11 | ||
| 4fsh_A | 271 | Crystal Structure Of Shikimate Dehydrogenase (aroe) | 3e-11 | ||
| 3fbt_A | 282 | Crystal Structure Of A Chorismate MutaseSHIKIMATE 5 | 1e-10 | ||
| 3t4e_A | 312 | 1.95 Angstrom Crystal Structure Of Shikimate 5-Dehy | 2e-10 | ||
| 3l9c_A | 259 | The Crystal Structure Of Smu.777 From Streptococcus | 2e-10 | ||
| 1npd_A | 288 | X-Ray Structure Of Shikimate Dehydrogenase Complexe | 8e-09 | ||
| 1vi2_A | 300 | Crystal Structure Of Shikimate-5-Dehydrogenase With | 9e-09 | ||
| 1p74_A | 272 | Crystal Structure Of Shikimate Dehydrogenase (Aroe) | 4e-08 | ||
| 3tum_B | 269 | 2.15 Angstrom Resolution Crystal Structure Of A Shi | 5e-08 | ||
| 3o8q_A | 281 | 1.45 Angstrom Resolution Crystal Structure Of Shiki | 4e-07 | ||
| 3pgj_A | 302 | 2.49 Angstrom Resolution Crystal Structure Of Shiki | 4e-07 | ||
| 3o8q_B | 275 | 1.45 Angstrom Resolution Crystal Structure Of Shiki | 6e-07 | ||
| 2ocz_A | 231 | The Structure Of A Putative 3-dehydroquinate Dehydr | 7e-07 | ||
| 3pwz_A | 272 | Crystal Structure Of An Ael1 Enzyme From Pseudomona | 3e-06 | ||
| 3jyo_A | 283 | Quinate Dehydrogenase From Corynebacterium Glutamic | 2e-05 | ||
| 2nlo_A | 302 | Crystal Structure Of The Quinate Dehydrogenase From | 2e-05 | ||
| 1npy_A | 271 | Structure Of Shikimate 5-Dehydrogenase-Like Protein | 5e-05 |
| >pdb|2GPT|A Chain A, Crystal Structure Of Arabidopsis Dehydroquinate Dehydratase- Shikimate Dehydrogenase In Complex With Tartrate And Shikimate Length = 523 | Back alignment and structure |
|
| >pdb|2O7Q|A Chain A, Crystal Structure Of The A. Thaliana Dhq-Dehydroshikimate-Sdh- Shikimate-Nadp(H) Length = 523 | Back alignment and structure |
| >pdb|1NVT|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe Or Mj1084) In Complex With Nadp+ Length = 287 | Back alignment and structure |
| >pdb|2EGG|A Chain A, Crystal Structure Of Shikimate 5-Dehydrogenase (Aroe) From Geobacillus Kaustophilus Length = 297 | Back alignment and structure |
| >pdb|3JS3|A Chain A, Crystal Structure Of Type I 3-Dehydroquinate Dehydratase (Arod) From Clostridium Difficile With Covalent Reaction Intermediate Length = 258 | Back alignment and structure |
| >pdb|3L2I|A Chain A, 1.85 Angstrom Crystal Structure Of The 3-Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Lt2. Length = 276 | Back alignment and structure |
| >pdb|3M7W|A Chain A, Crystal Structure Of Type I 3-Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Lt2 In Covalent Complex With Dehydroquinate Length = 255 | Back alignment and structure |
| >pdb|3DON|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Staphylococcus Epidermidis Length = 277 | Back alignment and structure |
| >pdb|4GUF|A Chain A, 1.5 Angstrom Crystal Structure Of The Salmonella Enterica 3- Dehydroquinate Dehydratase (arod) E86a Mutant Length = 276 | Back alignment and structure |
| >pdb|3NNT|A Chain A, Crystal Structure Of K170m Mutant Of Type I 3-Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Lt2 In Non-Covalent Complex With Dehydroquinate. Length = 276 | Back alignment and structure |
| >pdb|3O1N|A Chain A, 1.03 Angstrom Crystal Structure Of Q236a Mutant Type I Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Length = 276 | Back alignment and structure |
| >pdb|1QFE|A Chain A, The Structure Of Type I 3-Dehydroquinate Dehydratase From Salmonella Typhi Length = 252 | Back alignment and structure |
| >pdb|2HK7|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Aquifex Aeolicus In Complex With Mercury At 2.5 Angstrom Resolution Length = 269 | Back alignment and structure |
| >pdb|2HK9|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Aquifex Aeolicus In Complex With Shikimate And Nadp+ At 2.2 Angstrom Resolution Length = 275 | Back alignment and structure |
| >pdb|1WXD|A Chain A, Crystal Structure Of Shikimate 5-dehydrogenase (aroe) From Thermus Thermophilus Hb8 Length = 263 | Back alignment and structure |
| >pdb|2OX1|A Chain A, Archaeal Dehydroquinase Length = 196 | Back alignment and structure |
| >pdb|2YR1|A Chain A, Crystal Structure Of 3-Dehydroquinate Dehydratase From Geobacillus Kaustophilus Hta426 Length = 257 | Back alignment and structure |
| >pdb|1NYT|A Chain A, Shikimate Dehydrogenase Aroe Complexed With Nadp+ Length = 271 | Back alignment and structure |
| >pdb|3U62|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Thermotoga Maritima Length = 253 | Back alignment and structure |
| >pdb|1SFL|A Chain A, 1.9a Crystal Structure Of Staphylococcus Aureus Type I 3- Dehydroquinase, Apo Form Length = 238 | Back alignment and structure |
| >pdb|3TOZ|A Chain A, 2.2 Angstrom Crystal Structure Of Shikimate 5-Dehydrogenase From Listeria Monocytogenes In Complex With Nad. Length = 315 | Back alignment and structure |
| >pdb|1SFJ|A Chain A, 2.4a Crystal Structure Of Staphylococcus Aureus Type I 3- Dehydroquinase, With 3-Dehydroquinate Bound Length = 238 | Back alignment and structure |
| >pdb|2EGZ|A Chain A, Crystal Structure Of The 3-Dehydroquinate Dehydratase From Aquifex Aeolicus Vf5 Length = 219 | Back alignment and structure |
| >pdb|4FQ8|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Y210a Mutant From Helicobacter Pylori In Complex With Shikimate Length = 271 | Back alignment and structure |
| >pdb|4FR5|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Y210s Mutant From Helicobacter Pylori In Complex With Shikimate Length = 271 | Back alignment and structure |
| >pdb|4FPX|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Q237n Mutant From Helicobacter Pylori Length = 271 | Back alignment and structure |
| >pdb|4FOO|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Q237k Mutant From Helicobacter Pylori Length = 271 | Back alignment and structure |
| >pdb|4FOS|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Q237a Mutant From Helicobacter Pylori In Complex With Shikimate Length = 271 | Back alignment and structure |
| >pdb|3PHG|A Chain A, Crystal Structure Of The Shikimate 5-Dehydrogenase (Aroe) From Helicobacter Pylori Length = 269 | Back alignment and structure |
| >pdb|4FSH|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (aroe) Clinical Variant V2356 From Helicobacter Pylori In Complex With Shikimate Length = 271 | Back alignment and structure |
| >pdb|3FBT|A Chain A, Crystal Structure Of A Chorismate MutaseSHIKIMATE 5- Dehydrogenase Fusion Protein From Clostridium Acetobutylicum Length = 282 | Back alignment and structure |
| >pdb|3T4E|A Chain A, 1.95 Angstrom Crystal Structure Of Shikimate 5-Dehydrogenase (Aroe) From Salmonella Enterica Subsp. Enterica Serovar Typhimurium In Complex With Nad Length = 312 | Back alignment and structure |
| >pdb|3L9C|A Chain A, The Crystal Structure Of Smu.777 From Streptococcus Mutans Ua159 Length = 259 | Back alignment and structure |
| >pdb|1NPD|A Chain A, X-Ray Structure Of Shikimate Dehydrogenase Complexed With Nad+ From E.Coli (Ydib) Northeast Structural Genomics Research Consortium (Nesg) Target Er24 Length = 288 | Back alignment and structure |
| >pdb|1VI2|A Chain A, Crystal Structure Of Shikimate-5-Dehydrogenase With Nad Length = 300 | Back alignment and structure |
| >pdb|1P74|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) From Haemophilus Influenzae Length = 272 | Back alignment and structure |
| >pdb|3O8Q|A Chain A, 1.45 Angstrom Resolution Crystal Structure Of Shikimate 5- Dehydrogenase (Aroe) From Vibrio Cholerae Length = 281 | Back alignment and structure |
| >pdb|3PGJ|A Chain A, 2.49 Angstrom Resolution Crystal Structure Of Shikimate 5- Dehydrogenase (Aroe) From Vibrio Cholerae O1 Biovar Eltor Str. N16961 In Complex With Shikimate Length = 302 | Back alignment and structure |
| >pdb|3O8Q|B Chain B, 1.45 Angstrom Resolution Crystal Structure Of Shikimate 5- Dehydrogenase (Aroe) From Vibrio Cholerae Length = 275 | Back alignment and structure |
| >pdb|2OCZ|A Chain A, The Structure Of A Putative 3-dehydroquinate Dehydratase From Streptococcus Pyogenes Length = 231 | Back alignment and structure |
| >pdb|3PWZ|A Chain A, Crystal Structure Of An Ael1 Enzyme From Pseudomonas Putida Length = 272 | Back alignment and structure |
| >pdb|3JYO|A Chain A, Quinate Dehydrogenase From Corynebacterium Glutamicum In Complex With Nad Length = 283 | Back alignment and structure |
| >pdb|2NLO|A Chain A, Crystal Structure Of The Quinate Dehydrogenase From Corynebacterium Glutamicum Length = 302 | Back alignment and structure |
| >pdb|1NPY|A Chain A, Structure Of Shikimate 5-Dehydrogenase-Like Protein Hi0607 Length = 271 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 465 | |||
| 2o7s_A | 523 | DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat | 0.0 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 2e-83 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 8e-78 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 5e-77 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 3e-76 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 7e-75 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 2e-74 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 1e-71 | |
| 2egz_A | 219 | 3-dehydroquinate dehydratase; aquifex aeolicus VF5 | 2e-71 | |
| 1sfl_A | 238 | 3-dehydroquinate dehydratase; 3-dehydroquinase, en | 1e-70 | |
| 2yr1_A | 257 | 3-dehydroquinate dehydratase; amino acid biosynthe | 2e-70 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 3e-70 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 5e-69 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 4e-68 | |
| 3js3_A | 258 | 3-dehydroquinate dehydratase; AROD, covalent react | 6e-67 | |
| 2ocz_A | 231 | 3-dehydroquinate dehydratase; structural genomics, | 6e-67 | |
| 3o1n_A | 276 | 3-dehydroquinate dehydratase; structural genomics, | 2e-66 | |
| 3l9c_A | 259 | 3-dehydroquinate dehydratase; AROD, amino-acid bio | 1e-65 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 8e-65 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 1e-61 | |
| 2ox1_A | 196 | 3-dehydroquinate dehydratase; (beta-alpha)8 barrel | 4e-61 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 3e-56 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 4e-56 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 4e-56 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 1e-55 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 2e-12 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 5e-10 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 8e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-04 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 2e-06 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 3e-06 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 7e-06 | |
| 2i76_A | 276 | Hypothetical protein; NADP, dehydrogenase, TM1727, | 2e-05 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 3e-05 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 3e-05 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 5e-05 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 6e-05 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 8e-05 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 8e-05 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 9e-05 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 1e-04 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 1e-04 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 1e-04 | |
| 2yjz_A | 201 | Metalloreductase steap4; oxidoreductase, metabolic | 1e-04 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 1e-04 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 1e-04 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 2e-04 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 2e-04 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 2e-04 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 2e-04 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 2e-04 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 2e-04 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 3e-04 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 3e-04 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 3e-04 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 3e-04 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 4e-04 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 4e-04 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 4e-04 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 4e-04 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 4e-04 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 5e-04 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 5e-04 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 5e-04 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 6e-04 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 6e-04 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 7e-04 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 7e-04 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 7e-04 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 7e-04 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 7e-04 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 8e-04 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 9e-04 |
| >2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Length = 523 | Back alignment and structure |
|---|
Score = 604 bits (1558), Expect = 0.0
Identities = 338/446 (75%), Positives = 388/446 (86%), Gaps = 2/446 (0%)
Query: 21 KNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPT 80
KNP+LIC P+M +S+DKMV++ KA+ GADLVEIRLD LK+FNP E++KT+IK+SP+PT
Sbjct: 2 KNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKDFNPLEDLKTIIKKSPLPT 61
Query: 81 LFTYRPIWEGGQYDGDENERVDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVI 140
LFTYRP WEGGQY+GDENER DVLRLAMELGADYIDVELQVA EF SI GKKP K KVI
Sbjct: 62 LFTYRPKWEGGQYEGDENERRDVLRLAMELGADYIDVELQVASEFIKSIDGKKPGKFKVI 121
Query: 141 VSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVHSQVPIIGLV 200
VSSHNYQ TPSVEDL LVARIQ +GADIVK ATTA+DI DVAR+F IT +QVP IGLV
Sbjct: 122 VSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIADVARMFHITSKAQVPTIGLV 181
Query: 201 MGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIG 260
MGERGL+SRILC+KFGG+LTFGTL++ VSAPGQPTIKDLLDLYNFR++GPDTKV+GIIG
Sbjct: 182 MGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFRRIGPDTKVYGIIG 241
Query: 261 KPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVK 320
KPV HSKSPI++N+AFKSV FNGV+VHLLVD++ F Q YSS+DFAGFSCTIPHKEAA++
Sbjct: 242 KPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFLQAYSSSDFAGFSCTIPHKEAALQ 301
Query: 321 CCDEVDTVAKSIGAVNCIIRRQSDGKLFGYNTDYVGAISAIEDGLR--GRLNVSGGVSSA 378
CCDEVD +AKSIGAVN I+RR+SDGKL GYNTD +G+ISAIEDGLR G + SS
Sbjct: 302 CCDEVDPLAKSIGAVNTILRRKSDGKLLGYNTDCIGSISAIEDGLRSSGDPSSVPSSSSP 361
Query: 379 LAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYDRARELAETVGGHALSLADLENFN 438
LA K VVIGAGGAGKALAYGAK KGA+VVIANRTY+RA ELAE +GG ALSL DL+N++
Sbjct: 362 LASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYERALELAEAIGGKALSLTDLDNYH 421
Query: 439 PEDGMILANTTSIGMQPKVDETPIPK 464
PEDGM+LANTTS+GMQP V+ETPI K
Sbjct: 422 PEDGMVLANTTSMGMQPNVEETPISK 447
|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Length = 312 | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Length = 287 | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Length = 315 | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Length = 297 | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Length = 275 | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Length = 271 | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Length = 282 | Back alignment and structure |
|---|
| >2egz_A 3-dehydroquinate dehydratase; aquifex aeolicus VF5, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TLA; 1.75A {Aquifex aeolicus} PDB: 2ysw_A Length = 219 | Back alignment and structure |
|---|
| >1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* Length = 238 | Back alignment and structure |
|---|
| >2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Length = 257 | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Length = 263 | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Length = 283 | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* Length = 269 | Back alignment and structure |
|---|
| >3js3_A 3-dehydroquinate dehydratase; AROD, covalent reaction intermediate, amino-acid biosynthesis, aromatic amino acid biosynthesis, lyase; HET: DHS; 2.20A {Clostridium difficile} Length = 258 | Back alignment and structure |
|---|
| >2ocz_A 3-dehydroquinate dehydratase; structural genomics, DH streptococcus pyogenes, dehydroshikimate, PSI-2, protein ST initiative; HET: MSE; 1.85A {Streptococcus pyogenes serotype M1} Length = 231 | Back alignment and structure |
|---|
| >3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 3nnt_A* 3oex_A 3m7w_A 1gqn_A 1l9w_A* 1qfe_A* Length = 276 | Back alignment and structure |
|---|
| >3l9c_A 3-dehydroquinate dehydratase; AROD, amino-acid biosynthesis, aromatic amino acid biosynthe schiff base, lyase; 1.60A {Streptococcus mutans} Length = 259 | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Length = 277 | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Length = 253 | Back alignment and structure |
|---|
| >2ox1_A 3-dehydroquinate dehydratase; (beta-alpha)8 barrel, lyase; 2.33A {Archaeoglobus fulgidus} Length = 196 | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Length = 272 | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Length = 281 | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Length = 271 | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Length = 272 | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Length = 144 | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Length = 404 | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Length = 291 | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 | Back alignment and structure |
|---|
| >2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Length = 276 | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Length = 300 | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Length = 215 | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Length = 266 | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 | Back alignment and structure |
|---|
| >2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Length = 201 | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Length = 245 | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Length = 287 | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 465 | |||
| 2o7s_A | 523 | DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat | 100.0 | |
| 4h3d_A | 258 | 3-dehydroquinate dehydratase; structural genomics, | 100.0 | |
| 2yr1_A | 257 | 3-dehydroquinate dehydratase; amino acid biosynthe | 100.0 | |
| 3o1n_A | 276 | 3-dehydroquinate dehydratase; structural genomics, | 100.0 | |
| 1sfl_A | 238 | 3-dehydroquinate dehydratase; 3-dehydroquinase, en | 100.0 | |
| 3l9c_A | 259 | 3-dehydroquinate dehydratase; AROD, amino-acid bio | 100.0 | |
| 2ocz_A | 231 | 3-dehydroquinate dehydratase; structural genomics, | 100.0 | |
| 2egz_A | 219 | 3-dehydroquinate dehydratase; aquifex aeolicus VF5 | 100.0 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 100.0 | |
| 2ox1_A | 196 | 3-dehydroquinate dehydratase; (beta-alpha)8 barrel | 100.0 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 100.0 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 100.0 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 100.0 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 100.0 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 100.0 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 100.0 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 100.0 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 100.0 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 100.0 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 100.0 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 100.0 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 100.0 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 100.0 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 100.0 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 100.0 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 100.0 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 99.94 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 99.92 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 99.6 | |
| 3l07_A | 285 | Bifunctional protein fold; structural genomics, ID | 99.03 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 99.02 | |
| 4a5o_A | 286 | Bifunctional protein fold; oxidoreductase, hydrola | 98.96 | |
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 98.93 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 98.64 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 98.6 | |
| 1x7d_A | 350 | Ornithine cyclodeaminase; binds NAD+, binds L-orni | 98.59 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 98.53 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 98.52 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 98.48 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 98.48 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 98.38 | |
| 4hp8_A | 247 | 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi | 98.32 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 98.31 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 98.24 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 98.23 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 98.21 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 98.2 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 98.2 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 98.17 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 98.17 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 98.16 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 98.14 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 98.12 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 98.12 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 98.1 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 98.09 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 98.08 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 98.08 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 98.08 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 98.07 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 98.07 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 98.05 | |
| 3vh1_A | 598 | Ubiquitin-like modifier-activating enzyme ATG7; au | 98.04 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 98.03 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 98.03 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 98.02 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 98.02 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 98.02 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 98.01 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 98.01 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 98.01 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 98.0 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 97.98 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 97.98 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 97.98 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 97.97 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 97.97 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 97.97 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 97.97 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 97.97 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 97.97 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 97.96 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 97.96 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 97.96 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 97.95 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 97.95 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 97.95 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 97.95 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 97.94 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 97.94 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 97.94 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 97.93 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 97.93 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 97.93 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 97.93 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 97.93 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 97.93 | |
| 4h15_A | 261 | Short chain alcohol dehydrogenase-related dehydro; | 97.93 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 97.92 | |
| 1zmo_A | 244 | Halohydrin dehalogenase; haloalcohol dehalogenase, | 97.92 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 97.92 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 97.92 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 97.92 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 97.91 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 97.91 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 97.91 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 97.91 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 97.9 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 97.9 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 97.9 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 97.89 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 97.89 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 97.89 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 97.87 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 97.87 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 97.86 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 97.85 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 97.85 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 97.85 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 97.85 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 97.84 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 97.84 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 97.84 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 97.84 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 97.84 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 97.83 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 97.83 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 97.83 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 97.83 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 97.82 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 97.82 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 97.82 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 97.82 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 97.81 | |
| 2c2x_A | 281 | Methylenetetrahydrofolate dehydrogenase- methenylt | 97.81 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 97.81 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 97.81 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 97.81 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 97.8 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 97.8 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 97.8 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 97.8 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 97.8 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 97.8 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 97.79 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 97.79 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 97.79 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 97.79 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 97.79 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 97.78 | |
| 1e7w_A | 291 | Pteridine reductase; dihydrofolate reductase, shor | 97.78 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 97.78 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 97.78 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 97.77 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 97.77 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 97.76 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 97.76 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 97.76 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 97.76 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 97.76 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 97.75 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 97.75 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 97.74 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 97.74 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 97.74 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 97.73 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 97.73 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 97.72 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 97.72 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 97.72 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 97.71 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 97.71 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 97.71 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 97.71 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 97.7 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 97.7 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 97.69 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 97.69 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 97.69 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 97.68 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 97.68 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 97.68 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 97.68 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 97.67 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 97.67 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 97.66 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 97.66 | |
| 2h7i_A | 269 | Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi | 97.66 | |
| 1qsg_A | 265 | Enoyl-[acyl-carrier-protein] reductase; enoyl redu | 97.66 | |
| 2pd4_A | 275 | Enoyl-[acyl-carrier-protein] reductase [NADH]; ant | 97.65 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 97.65 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 97.65 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 97.65 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 97.64 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 97.64 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 97.64 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 97.64 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 97.64 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 97.63 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 97.63 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 97.62 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 97.62 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 97.62 | |
| 2wyu_A | 261 | Enoyl-[acyl carrier protein] reductase; oxidoreduc | 97.61 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 97.61 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 97.61 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 97.61 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 97.6 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 97.6 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 97.59 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 97.58 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 97.58 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 97.58 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 97.58 | |
| 1b0a_A | 288 | Protein (fold bifunctional protein); folate, dehyd | 97.58 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 97.57 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 97.57 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 97.57 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 97.57 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 97.56 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 97.56 | |
| 1tt5_B | 434 | Ubiquitin-activating enzyme E1C isoform 1; cell cy | 97.56 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 97.56 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 97.56 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 97.56 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 97.55 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 97.55 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 97.55 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 97.53 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 97.52 | |
| 3hdj_A | 313 | Probable ornithine cyclodeaminase; APC62486, borde | 97.52 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 97.51 | |
| 1gz6_A | 319 | Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF | 97.51 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 97.5 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 97.49 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 97.49 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 97.48 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 97.48 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 97.48 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 97.46 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 97.45 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 97.45 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 97.45 | |
| 3icc_A | 255 | Putative 3-oxoacyl-(acyl carrier protein) reducta; | 97.45 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 97.44 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 97.43 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 97.43 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 97.42 | |
| 1edo_A | 244 | Beta-keto acyl carrier protein reductase; nucleoti | 97.42 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 97.42 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 97.41 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 97.41 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 97.4 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 97.4 | |
| 2ph3_A | 245 | 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 | 97.39 | |
| 3s8m_A | 422 | Enoyl-ACP reductase; rossmann fold, oxidoreductase | 97.39 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 97.39 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 97.39 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 97.38 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 97.37 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 97.37 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 97.36 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 97.36 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 97.35 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 97.35 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 97.35 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 97.33 | |
| 3uce_A | 223 | Dehydrogenase; rossmann fold, oxidoreductase; HET: | 97.33 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 97.33 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 97.33 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 97.33 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 97.32 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 97.32 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 97.31 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 97.31 | |
| 1c1d_A | 355 | L-phenylalanine dehydrogenase; amino acid dehydrog | 97.3 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 97.29 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 97.29 | |
| 3zu3_A | 405 | Putative reductase YPO4104/Y4119/YP_4011; oxidored | 97.28 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 97.27 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 97.27 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 97.27 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 97.27 | |
| 4eue_A | 418 | Putative reductase CA_C0462; TER, biofuel, synthet | 97.26 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 97.26 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 97.24 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 97.23 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 97.22 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 97.2 | |
| 1yqg_A | 263 | Pyrroline-5-carboxylate reductase; structural geno | 97.2 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 97.2 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 97.2 | |
| 1u7z_A | 226 | Coenzyme A biosynthesis bifunctional protein coabc | 97.17 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 97.15 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 97.14 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 97.14 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 97.14 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 97.13 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 97.13 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 97.12 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 97.12 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 97.12 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 97.11 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 97.09 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 97.08 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 97.06 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 97.06 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 97.05 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 97.05 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 97.04 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 97.04 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 97.02 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 97.02 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 97.02 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 97.02 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 97.02 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 97.0 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 97.0 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 97.0 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 96.97 | |
| 3lt0_A | 329 | Enoyl-ACP reductase; triclosan, triclosan variant, | 96.97 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 96.97 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 96.96 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 96.96 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 96.96 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 96.95 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 96.95 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 96.95 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 96.93 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 96.92 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 96.92 | |
| 3u0b_A | 454 | Oxidoreductase, short chain dehydrogenase/reducta | 96.92 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 96.92 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 96.91 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 96.9 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 96.9 | |
| 1d7o_A | 297 | Enoyl-[acyl-carrier protein] reductase (NADH) PRE; | 96.89 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 96.88 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 96.88 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 96.87 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 96.87 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 96.86 | |
| 2o2s_A | 315 | Enoyl-acyl carrier reductase; enoyl reductase, tri | 96.85 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 96.85 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.84 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 96.84 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 96.84 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 96.82 | |
| 2v82_A | 212 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l | 96.82 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 96.81 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 96.81 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 96.81 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 96.81 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 96.8 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 96.8 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 96.8 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 96.76 | |
| 4e4y_A | 244 | Short chain dehydrogenase family protein; structur | 96.76 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 96.75 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 96.75 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 96.75 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 96.74 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 96.72 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 96.72 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 96.71 | |
| 2zb4_A | 357 | Prostaglandin reductase 2; rossmann fold, alternat | 96.71 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 96.71 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 96.71 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 96.7 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 96.7 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 96.68 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 96.67 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 96.67 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 96.67 | |
| 1v8b_A | 479 | Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 | 96.67 | |
| 3d64_A | 494 | Adenosylhomocysteinase; structural genomics, ssgci | 96.66 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 96.65 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 96.64 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 96.63 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.62 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 96.62 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 96.61 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 96.61 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 96.6 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 96.6 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 96.6 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 96.59 | |
| 1jtv_A | 327 | 17 beta-hydroxysteroid dehydrogenase type 1; stero | 96.59 | |
| 1wbh_A | 214 | KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} | 96.58 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 96.57 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 96.56 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 96.56 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 96.55 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 96.54 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 96.53 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 96.53 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 96.53 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 96.53 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 96.52 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 96.52 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 96.51 | |
| 4gsl_A | 615 | Ubiquitin-like modifier-activating enzyme ATG7; ub | 96.49 | |
| 1pgj_A | 478 | 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o | 96.49 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 96.49 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 96.49 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 96.48 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 96.48 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 96.48 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 96.47 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 96.47 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 96.46 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 96.46 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 96.45 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 96.45 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 96.45 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 96.44 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 96.43 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 96.43 | |
| 4b4u_A | 303 | Bifunctional protein fold; oxidoreductase; HET: NA | 96.42 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 96.42 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 96.42 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 96.41 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 96.4 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 96.4 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 96.4 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 96.39 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 96.38 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 96.37 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 96.37 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 96.36 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 96.35 | |
| 3qp9_A | 525 | Type I polyketide synthase pikaii; rossmann fold, | 96.33 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.33 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 96.33 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 96.32 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 96.31 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 96.31 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.31 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 96.3 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 96.3 | |
| 1vhc_A | 224 | Putative KHG/KDPG aldolase; structural genomics, u | 96.28 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 96.28 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 96.27 | |
| 4ggo_A | 401 | Trans-2-enoyl-COA reductase; rossmann fold, oxidor | 96.27 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 96.26 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 96.24 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 96.24 | |
| 3uuw_A | 308 | Putative oxidoreductase with NAD(P)-binding rossm | 96.24 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 96.23 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 96.23 | |
| 2i76_A | 276 | Hypothetical protein; NADP, dehydrogenase, TM1727, | 96.22 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 96.21 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 96.21 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 96.2 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 96.2 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 96.2 | |
| 3euw_A | 344 | MYO-inositol dehydrogenase; protein structure init | 96.19 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 96.17 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 96.16 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 96.16 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 96.15 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 96.15 | |
| 3rc1_A | 350 | Sugar 3-ketoreductase; sugar biosynthesis, TDP bin | 96.15 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 96.14 | |
| 1y8q_A | 346 | Ubiquitin-like 1 activating enzyme E1A; SUMO, hete | 96.14 | |
| 1i36_A | 264 | Conserved hypothetical protein MTH1747; NADP bindi | 96.14 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 96.14 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 96.13 | |
| 2yjz_A | 201 | Metalloreductase steap4; oxidoreductase, metabolic | 95.12 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 96.12 | |
| 2dph_A | 398 | Formaldehyde dismutase; dismutation of aldehydes, | 96.11 | |
| 3fr7_A | 525 | Putative ketol-acid reductoisomerase (OS05G057370 | 96.1 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 96.1 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 96.09 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 96.09 | |
| 1kol_A | 398 | Formaldehyde dehydrogenase; oxidoreductase; HET: N | 96.09 | |
| 4hkt_A | 331 | Inositol 2-dehydrogenase; structural genomics, nys | 96.09 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 96.09 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 96.09 | |
| 1h2b_A | 359 | Alcohol dehydrogenase; oxidoreductase, archaea, hy | 96.09 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 96.09 | |
| 3db2_A | 354 | Putative NADPH-dependent oxidoreductase; two domai | 96.08 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 96.08 | |
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 96.08 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 96.07 | |
| 2gk4_A | 232 | Conserved hypothetical protein; alpha-beta-alpha s | 96.07 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 96.06 | |
| 2pgd_A | 482 | 6-phosphogluconate dehydrogenase; oxidoreductase ( | 96.06 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 96.06 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 96.06 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 96.04 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 96.04 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 96.03 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 96.03 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 96.02 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 96.01 | |
| 4a0s_A | 447 | Octenoyl-COA reductase/carboxylase; oxidoreductase | 95.99 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 95.99 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 95.98 | |
| 1wa3_A | 205 | 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, | 95.97 |
| >2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=3.1e-98 Score=801.36 Aligned_cols=443 Identities=76% Similarity=1.189 Sum_probs=390.0
Q ss_pred CCCcEEEEeeccCCHHHHHHHHHhhhhcCCCEEEEEecCCCCCCchhHHHHHHhhCCCcEEEEeccCCCCCCCCCCHHHH
Q 012352 21 KNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKESPVPTLFTYRPIWEGGQYDGDENER 100 (465)
Q Consensus 21 ~~~~~icv~l~~~t~~e~~~~~~~~~~~~~D~vElRlD~l~~~~~~~~l~~l~~~~~~PiI~T~R~~~eGG~~~~~~~~~ 100 (465)
+++|+|||||+++|++|++.++++....++|+||||+|+|++.++.++++.+++..++|+|||+|+++|||.++.++++|
T Consensus 2 ~~~~~icv~l~~~~~~~~~~~~~~~~~~g~D~vElRvD~l~~~~~~~~l~~l~~~~~~PiI~T~R~~~eGG~~~~~~~~~ 81 (523)
T 2o7s_A 2 KNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKDFNPLEDLKTIIKKSPLPTLFTYRPKWEGGQYEGDENER 81 (523)
T ss_dssp CSCCEEEEEECCSSHHHHHHHHHHHHHHTCSEEEEEGGGCSSCCHHHHHHHHHHHCSSCEEEECCBGGGTSSBCSCHHHH
T ss_pred CCCCEEEEEecCCCHHHHHHHHHHhhhcCCCEEEEEEecccccChHHHHHHHHhcCCCcEEEEecccccCCCCCCCHHHH
Confidence 67999999999999999999999888889999999999999877667898888888999999999999999999999999
Q ss_pred HHHHHHHHHhCCcEEEEeeccccchhHHHHhcCCCCcEEEEEeccCCCCCCHHHHHHHHHHHHHcCCCEEEEEeecCCHH
Q 012352 101 VDVLRLAMELGADYIDVELQVAREFNDSIRGKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDIT 180 (465)
Q Consensus 101 ~~~l~~~~~~~~~~iDiEl~~~~~~~~~l~~~~~~~~~iI~S~H~f~~tps~~el~~~~~~~~~~gadivKia~~~~~~~ 180 (465)
+++|+.+++.|+||||||++.+++.++.+...+..++|||+|||||++||+++++.+++++|.++||||+|||+||++.+
T Consensus 82 ~~ll~~~~~~~~~yiDvEl~~~~~~~~~~~~~~~~~~kiI~S~H~f~~tp~~~~~~~~~~~~~~~gaDivKia~~a~~~~ 161 (523)
T 2o7s_A 82 RDVLRLAMELGADYIDVELQVASEFIKSIDGKKPGKFKVIVSSHNYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIA 161 (523)
T ss_dssp HHHHHHHHHHTCSEEEEEHHHHHHHHHHTTTCCCTTCEEEEEEECSSCCCCHHHHHHHHHHHHTTTCSEEEEEEECSSGG
T ss_pred HHHHHHHHHhCCCEEEEECCCchHHHHHHHHhccCCCEEEEEcccCCCCcCHHHHHHHHHHHHHhCCCEEEEEecCCCHH
Confidence 99999999999999999999988888777655556899999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhccCCCCEEEEecCccchhhhhhccccCCccccccccCccCCCCCCCChhhHHhhhcccccCCCcceeeecC
Q 012352 181 DVARVFQITVHSQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYNFRQMGPDTKVFGIIG 260 (465)
Q Consensus 181 D~~~ll~~~~~~~~p~i~~~MG~~G~~sRi~~~~~Gs~~tf~~~~~~~~sApGQ~~~~~l~~~~~~~~~~~~~~~~~~iG 260 (465)
|+++|++++.+.+.|+|+|+||+.|++||+++++|||++||++++++.++||||+++++++++|++.+++++|++|||||
T Consensus 162 D~~~l~~~~~~~~~p~i~~~MG~~G~~SRil~~~~gs~lt~~~l~~~~~sApGQ~~~~~l~~~~~~~~~~~~~~~~~viG 241 (523)
T 2o7s_A 162 DVARMFHITSKAQVPTIGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFRRIGPDTKVYGIIG 241 (523)
T ss_dssp GHHHHHHHHHHCSSCEEEEEESGGGTHHHHCTTTTTCSEEECBSSTTCCSSTTCCBHHHHHHTSCGGGCCTTCEEEEEEE
T ss_pred HHHHHHHHHhhcCCCEEEEEcCCCCchhhhhhhhcCCceeecCCCccccCCCCCCcHHHHHHHHhhhhccccceEEEEEC
Confidence 99999999888889999999999999999999999999999999865558999999999999999999999999999999
Q ss_pred CCccccccHHHHHHHHHHcCCCeeEeccccccHHHHHHHhhcCCCCeeEeccCchHHHhhhccccCHHHHhccceeeEEE
Q 012352 261 KPVGHSKSPILYNEAFKSVGFNGVFVHLLVDDIAKFFQTYSSNDFAGFSCTIPHKEAAVKCCDEVDTVAKSIGAVNCIIR 340 (465)
Q Consensus 261 ~pi~hS~SP~~hn~~f~~~gl~~~y~~~~~~~l~~~~~~l~~~~~~G~~vT~P~K~~v~~~~d~~~~~A~~~gavNtv~~ 340 (465)
+||+||+||.|||++|+++|+|+.|.+++++++.++++.++.++|.|+|||||||++|++++|++++.|+.+||||||++
T Consensus 242 ~pi~hS~SP~~hn~~f~~~gl~~~Y~~~~~~~l~~~~~~~~~~~~~G~nVTiP~K~~i~~~ld~~~~~A~~iGAvNti~~ 321 (523)
T 2o7s_A 242 KPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFLQAYSSSDFAGFSCTIPHKEAALQCCDEVDPLAKSIGAVNTILR 321 (523)
T ss_dssp SSCTTCCHHHHHHHHHHHTTCSEEEEEEECSCHHHHHHHTCSTTEEEEEECTTCHHHHHHHCSEECHHHHHHTCCSEEEE
T ss_pred CCccCCccHHHHHHHHHHcCCCcEEEeEEcchHHHHHHHHhcCCCCEEEECCCCHHHHHHHhcccCHHHHHhCCCeEEEE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred eccCCeEEEEeccHHHHHHHHHhhhccCCCCCC--CcccccCCcEEEEEccchhHHHHHHHHHHCCCeEEEEECCHHHHH
Q 012352 341 RQSDGKLFGYNTDYVGAISAIEDGLRGRLNVSG--GVSSALAGKLFVVIGAGGAGKALAYGAKAKGARVVIANRTYDRAR 418 (465)
Q Consensus 341 ~~~~g~l~G~NTD~~G~~~~l~~~~~~~~~~~~--~~~~~l~~k~vlV~GaGg~g~ai~~~L~~~G~~v~i~~R~~~~a~ 418 (465)
+..+|+++|+||||.|++.+++..+....+... .....+++|+++|+|+||+|++++++|++.|++|+++||+.++++
T Consensus 322 ~~~~gk~~g~nTD~~G~~~~l~~~~~~~~~~~~~~~~~~~l~~k~vlV~GaGGig~aia~~L~~~G~~V~i~~R~~~~a~ 401 (523)
T 2o7s_A 322 RKSDGKLLGYNTDCIGSISAIEDGLRSSGDPSSVPSSSSPLASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYERAL 401 (523)
T ss_dssp CTTTCCEEEECCHHHHHHHHHHHHC-------------------CEEEECCSHHHHHHHHHHHHHCC-CEEEESSHHHHH
T ss_pred ecCCCeEEEEcCCHHHHHHHHHHhhhhccccccccccccccCCCEEEEECCcHHHHHHHHHHHHCCCEEEEEECCHHHHH
Confidence 622789999999999999999875421000000 001346789999999999999999999999999999999999999
Q ss_pred HHHHHHCCcccchhcccccCCCCeeEEEecCCCCCCCCCCCCCCC
Q 012352 419 ELAETVGGHALSLADLENFNPEDGMILANTTSIGMQPKVDETPIP 463 (465)
Q Consensus 419 ~la~~~~~~~~~~~~l~~~~~~~~DilInaT~~gm~~~~~~~p~~ 463 (465)
+++++++.....++++.++....+|+||||||+||.+..+..|++
T Consensus 402 ~la~~~~~~~~~~~dl~~~~~~~~DilVN~agvg~~~~~~~~~~~ 446 (523)
T 2o7s_A 402 ELAEAIGGKALSLTDLDNYHPEDGMVLANTTSMGMQPNVEETPIS 446 (523)
T ss_dssp HHHHHTTC-CEETTTTTTC--CCSEEEEECSSTTCTTCTTCCSSC
T ss_pred HHHHHcCCceeeHHHhhhccccCceEEEECCCCCCCCCCCCCCCC
Confidence 999988654445555543223458999999999997654444543
|
| >4h3d_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, aldolase class I; HET: PGE SHL; 1.95A {Clostridium difficile} PDB: 3js3_A* | Back alignment and structure |
|---|
| >2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* | Back alignment and structure |
|---|
| >1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* | Back alignment and structure |
|---|
| >3l9c_A 3-dehydroquinate dehydratase; AROD, amino-acid biosynthesis, aromatic amino acid biosynthe schiff base, lyase; 1.60A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2ocz_A 3-dehydroquinate dehydratase; structural genomics, DH streptococcus pyogenes, dehydroshikimate, PSI-2, protein ST initiative; HET: MSE; 1.85A {Streptococcus pyogenes serotype M1} | Back alignment and structure |
|---|
| >2egz_A 3-dehydroquinate dehydratase; aquifex aeolicus VF5, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TLA; 1.75A {Aquifex aeolicus} PDB: 2ysw_A | Back alignment and structure |
|---|
| >2ox1_A 3-dehydroquinate dehydratase; (beta-alpha)8 barrel, lyase; 2.33A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... | Back alignment and structure |
|---|
| >1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* | Back alignment and structure |
|---|
| >2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 | Back alignment and structure |
|---|
| >3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... | Back alignment and structure |
|---|
| >1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A | Back alignment and structure |
|---|
| >1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* | Back alignment and structure |
|---|
| >1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 465 | ||||
| d1gqna_ | 252 | c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase | 7e-72 | |
| d1sfla_ | 236 | c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase | 1e-70 | |
| d1p77a2 | 101 | c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE | 3e-28 | |
| d1vi2a2 | 102 | c.58.1.5 (A:5-106) Putative shikimate dehydrogenas | 4e-28 | |
| d1nyta2 | 101 | c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE | 4e-27 | |
| d1nvta2 | 110 | c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE | 5e-26 | |
| d1npya2 | 102 | c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like | 2e-25 | |
| d1k2wa_ | 256 | c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s | 1e-06 | |
| d1ulsa_ | 242 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 3e-06 | |
| d1pr9a_ | 244 | c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie | 4e-06 | |
| d1ydea1 | 250 | c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase | 4e-06 | |
| d1nffa_ | 244 | c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob | 7e-06 | |
| d1jaya_ | 212 | c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase | 7e-06 | |
| d2a4ka1 | 241 | c.2.1.2 (A:2-242) beta-keto acyl carrier protein r | 1e-05 | |
| d1hdca_ | 254 | c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr | 1e-05 | |
| d1cyda_ | 242 | c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul | 1e-05 | |
| d1hxha_ | 253 | c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge | 1e-05 | |
| d1bdba_ | 276 | c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy | 2e-05 | |
| d1p77a1 | 171 | c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE | 2e-05 | |
| d1q7ba_ | 243 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 3e-05 | |
| d1gpja2 | 159 | c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle | 3e-05 | |
| d1fmca_ | 255 | c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase | 5e-05 | |
| d1yb1a_ | 244 | c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase | 6e-05 | |
| d2o23a1 | 248 | c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr | 6e-05 | |
| d2d1ya1 | 248 | c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T | 6e-05 | |
| d1xhla_ | 274 | c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh | 7e-05 | |
| d2ag5a1 | 245 | c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami | 8e-05 | |
| d1yxma1 | 297 | c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re | 1e-04 | |
| d1zk4a1 | 251 | c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase | 1e-04 | |
| d1vl8a_ | 251 | c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga | 1e-04 | |
| d2bgka1 | 268 | c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de | 2e-04 | |
| d1zema1 | 260 | c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba | 2e-04 | |
| d1w6ua_ | 294 | c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr | 2e-04 | |
| d1ae1a_ | 258 | c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu | 3e-04 | |
| d1oaaa_ | 259 | c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus | 3e-04 | |
| d1h5qa_ | 260 | c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga | 3e-04 | |
| d2h7ma1 | 268 | c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacteri | 3e-04 | |
| d1spxa_ | 264 | c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato | 4e-04 | |
| d1xkqa_ | 272 | c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh | 4e-04 | |
| d1e5qa1 | 182 | c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase | 4e-04 | |
| d1xu9a_ | 269 | c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase | 4e-04 | |
| d1xg5a_ | 257 | c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 | 5e-04 | |
| d1ooea_ | 235 | c.2.1.2 (A:) Dihydropteridin reductase (pteridine | 5e-04 | |
| d1iy8a_ | 258 | c.2.1.2 (A:) Levodione reductase {Corynebacterium | 5e-04 | |
| d2ae2a_ | 259 | c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu | 6e-04 | |
| d2ew8a1 | 247 | c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas | 7e-04 | |
| d1xq1a_ | 259 | c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara | 7e-04 | |
| d1ja9a_ | 259 | c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc | 8e-04 | |
| d1o5ia_ | 234 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 8e-04 | |
| d1gega_ | 255 | c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl | 8e-04 | |
| d1sbya1 | 254 | c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase | 0.001 | |
| d1nyta1 | 170 | c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE | 0.001 | |
| d2c07a1 | 251 | c.2.1.2 (A:54-304) beta-keto acyl carrier protein | 0.001 | |
| d1uzma1 | 237 | c.2.1.2 (A:9-245) beta-keto acyl carrier protein r | 0.001 | |
| d1g0oa_ | 272 | c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase | 0.001 | |
| d1geea_ | 261 | c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat | 0.002 | |
| d1li4a1 | 163 | c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolas | 0.002 | |
| d1qsga_ | 258 | c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli | 0.002 | |
| d2rhca1 | 257 | c.2.1.2 (A:5-261) beta-keto acyl carrier protein r | 0.002 | |
| d2gdza1 | 254 | c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog | 0.003 |
| >d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Length = 252 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: Aldolase family: Class I aldolase domain: Type I 3-dehydroquinate dehydratase species: Salmonella typhi [TaxId: 90370]
Score = 225 bits (575), Expect = 7e-72
Identities = 62/234 (26%), Positives = 110/234 (47%), Gaps = 14/234 (5%)
Query: 24 TLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIKTLIKE-----SPV 78
I V +MG ++ + + + D++E R+D + +++ T + +
Sbjct: 16 PKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDI 75
Query: 79 PTLFTYRPIWEGGQYDGDENERVDVLRLAMELG-ADYIDVELQVA-REFNDSIRGKKPEK 136
P LFT+R EGG+ + + R A++ G D ID+EL + ++
Sbjct: 76 PLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHN 135
Query: 137 CKVIVSSHNYQYTPSVEDLSNLVARIQASGADIVKFATTALDITDVARVFQITVH----- 191
V++S+H++ TPS E++ + + ++QA GADI K A DV + T+
Sbjct: 136 VYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHY 195
Query: 192 SQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDLLDLYN 245
+ P+I + M + G+ISR+ FG TFG ++ SAPGQ + DL +
Sbjct: 196 ADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQA--SAPGQIAVNDLRSVLM 247
|
| >d1sfla_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus [TaxId: 1280]} Length = 236 | Back information, alignment and structure |
|---|
| >d1p77a2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Length = 101 | Back information, alignment and structure |
|---|
| >d1vi2a2 c.58.1.5 (A:5-106) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Length = 102 | Back information, alignment and structure |
|---|
| >d1nyta2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Length = 101 | Back information, alignment and structure |
|---|
| >d1nvta2 c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 110 | Back information, alignment and structure |
|---|
| >d1npya2 c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Length = 102 | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 212 | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Length = 171 | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 159 | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Length = 268 | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 182 | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Length = 170 | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 163 | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 465 | |||
| d1gqna_ | 252 | Type I 3-dehydroquinate dehydratase {Salmonella ty | 100.0 | |
| d1sfla_ | 236 | Type I 3-dehydroquinate dehydratase {Staphylococcu | 100.0 | |
| d1vi2a2 | 102 | Putative shikimate dehydrogenase YdiB {Escherichia | 99.97 | |
| d1p77a2 | 101 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 99.97 | |
| d1nyta2 | 101 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 99.97 | |
| d1nvta2 | 110 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 99.96 | |
| d1npya2 | 102 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 99.96 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 99.65 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 99.63 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 99.56 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 99.55 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 99.46 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 99.25 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 99.22 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 98.59 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 98.58 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 98.56 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 98.56 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 98.53 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 98.51 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 98.51 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 98.5 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 98.48 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 98.46 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 98.45 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 98.44 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 98.43 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 98.42 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 98.42 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 98.41 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 98.4 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 98.39 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 98.38 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 98.37 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 98.37 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 98.34 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 98.33 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 98.32 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 98.32 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 98.32 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 98.31 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 98.31 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 98.3 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 98.29 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 98.28 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 98.28 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 98.27 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 98.26 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 98.26 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 98.25 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 98.23 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 98.23 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 98.15 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 98.14 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 98.14 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 98.09 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 98.03 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 98.02 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 98.0 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 97.97 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 97.95 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 97.94 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 97.87 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 97.84 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 97.82 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 97.78 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 97.71 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 97.71 | |
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 97.7 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 97.66 | |
| d1e7wa_ | 284 | Dihydropteridin reductase (pteridine reductase) {L | 97.59 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 97.59 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 97.57 | |
| d1zmta1 | 252 | Halohydrin dehalogenase HheC {Agrobacterium tumefa | 97.54 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 97.53 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 97.52 | |
| d1mxha_ | 266 | Dihydropteridin reductase (pteridine reductase) {T | 97.52 | |
| d1snya_ | 248 | Carbonyl reductase sniffer {Fruit fly (Drosophila | 97.49 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 97.41 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 97.39 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 97.38 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 97.38 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 97.37 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 97.35 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 97.34 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 97.33 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 97.29 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 97.27 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 97.25 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 97.25 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 97.25 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 97.24 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 97.22 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 97.21 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 97.21 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 97.21 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 97.21 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 97.2 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 97.19 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 97.19 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 97.19 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 97.19 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 97.19 | |
| d2i76a2 | 153 | Hypothetical protein TM1727 {Thermotoga maritima [ | 97.18 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 97.15 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 97.12 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 97.11 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 97.08 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 97.07 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 97.07 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 97.05 | |
| d1jtva_ | 285 | Human estrogenic 17beta-hydroxysteroid dehydrogena | 97.04 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 97.0 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 96.96 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 96.95 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 96.93 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 96.93 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 96.92 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 96.9 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 96.9 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 96.88 | |
| d1uh5a_ | 329 | Enoyl-ACP reductase {Malaria parasite (Plasmodium | 96.88 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 96.87 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 96.86 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 96.8 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 96.79 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 96.78 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 96.77 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 96.77 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 96.75 | |
| d2fr1a1 | 259 | Erythromycin synthase, eryAI, 1st ketoreductase mo | 96.74 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 96.7 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 96.63 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 96.62 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 96.59 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 96.59 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 96.54 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 96.48 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 96.45 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 96.45 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 96.45 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 96.44 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 96.37 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 96.34 | |
| d1omoa_ | 320 | Archaeal alanine dehydrogenase {Archaeon Archaeogl | 96.32 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 96.27 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 96.25 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 96.24 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 96.23 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 96.19 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 96.19 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 96.18 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 96.16 | |
| d1vj1a2 | 187 | Putative zinc-binding alcohol dehydrogenase {Mouse | 96.15 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 96.12 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 96.06 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 96.03 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 96.02 | |
| d1x7da_ | 340 | Ornithine cyclodeaminase {Pseudomonas putida [TaxI | 96.01 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 95.91 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 95.89 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 95.87 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 95.8 | |
| d1tt7a2 | 167 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 95.78 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 95.77 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 95.73 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 95.72 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 95.62 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 95.6 | |
| d1a4ia1 | 170 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 95.57 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 95.56 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 95.54 | |
| d1o89a2 | 177 | Hypothetical protein YhdH {Escherichia coli [TaxId | 95.54 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 95.45 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 95.33 | |
| d1b0aa1 | 166 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 95.17 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 95.15 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 95.13 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 95.02 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 95.01 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 95.01 | |
| d1nvmb1 | 157 | Acetaldehyde dehydrogenase (acylating) {Pseudomona | 94.84 | |
| d1zh8a1 | 181 | Hypothetical protein TM0312 {Thermotoga maritima [ | 94.83 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 94.82 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 94.81 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 94.76 | |
| d1ub3a_ | 211 | Deoxyribose-phosphate aldolase DeoC {Thermus therm | 94.72 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 94.68 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 94.68 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 94.64 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 94.59 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 94.58 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 94.46 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 94.46 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 94.43 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 94.38 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 94.37 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 94.31 | |
| d1np3a2 | 182 | Class I ketol-acid reductoisomerase (KARI) {Pseudo | 94.26 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 94.24 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 94.21 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 94.19 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 94.08 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 94.0 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 93.97 | |
| d1h6da1 | 221 | Glucose-fructose oxidoreductase, N-terminal domain | 93.96 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 93.95 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 93.85 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 93.76 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 93.75 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 93.71 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 93.67 | |
| d1tlta1 | 164 | Virulence factor MviM {Escherichia coli [TaxId: 56 | 93.63 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 93.59 | |
| d1o0ya_ | 251 | Deoxyribose-phosphate aldolase DeoC {Thermotoga ma | 93.56 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 93.46 | |
| d1twda_ | 247 | Copper homeostasis protein CutC {Shigella flexneri | 93.44 | |
| d1xi3a_ | 206 | Thiamin phosphate synthase {Archaeon (Pyrococcus f | 93.43 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 93.24 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 93.21 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 93.11 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 93.02 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 92.95 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 92.93 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 92.9 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 92.87 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 92.8 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 92.7 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 92.7 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 92.54 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 92.45 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 92.37 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 92.37 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 92.27 | |
| d1gu7a2 | 189 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 92.23 | |
| d2gv8a2 | 107 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 92.11 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 92.01 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 91.9 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 91.79 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 91.78 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 91.77 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 91.74 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 91.7 | |
| d1vjta1 | 193 | Putative alpha-glucosidase TM0752 {Thermotoga mari | 91.62 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 91.55 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 91.55 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 91.54 | |
| d1ad1a_ | 264 | Dihydropteroate synthetase {Staphylococcus aureus | 91.5 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 91.31 | |
| d1s6ya1 | 169 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 91.31 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 91.28 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 91.23 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 91.18 | |
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 91.1 | |
| d2nvwa1 | 237 | Galactose/lactose metabolism regulatory protein GA | 91.05 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 91.03 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 90.59 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 90.44 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 90.38 | |
| d1w4xa2 | 235 | Phenylacetone monooxygenase {Thermobifida fusca [T | 90.36 | |
| d1yx1a1 | 250 | Hypothetical protein PA2260 {Pseudomonas aeruginos | 90.25 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 90.24 | |
| d1ojxa_ | 251 | Archaeal fructose 1,6-bisphosphate aldolase {Archa | 90.23 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 90.23 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 90.12 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 90.1 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 90.07 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 90.01 | |
| d2q02a1 | 271 | Putative cytoplasmic protein STM4435 {Salmonella t | 90.0 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 89.93 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 89.89 | |
| d1wa3a1 | 202 | KDPG aldolase {Thermotoga maritima [TaxId: 2336]} | 89.88 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 89.87 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 89.75 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 89.37 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 89.34 | |
| d1a9xa4 | 121 | Carbamoyl phosphate synthetase (CPS), large subuni | 89.32 | |
| d1lqta1 | 216 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 89.17 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 89.04 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 88.86 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 88.67 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 88.55 | |
| d1cjca1 | 225 | Adrenodoxin reductase of mitochondrial p450 system | 88.45 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 88.45 | |
| d1a9xa3 | 127 | Carbamoyl phosphate synthetase (CPS), large subuni | 88.44 | |
| d1rqba2 | 303 | Transcarboxylase 5S subunit, N-terminal domain {Pr | 88.3 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 88.21 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 88.19 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 88.15 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 87.79 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 87.64 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 87.62 | |
| d1rp0a1 | 278 | Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara | 87.55 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 87.49 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 87.24 | |
| d1ajza_ | 282 | Dihydropteroate synthetase {Escherichia coli [TaxI | 87.17 | |
| d1b26a1 | 234 | Glutamate dehydrogenase {Thermotoga maritima [TaxI | 87.12 | |
| d1n7ka_ | 234 | Deoxyribose-phosphate aldolase DeoC {Archaeon Aero | 87.1 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 87.09 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 87.04 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 86.99 | |
| d1edza1 | 171 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 86.81 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 86.64 | |
| d2ax3a2 | 211 | Hypothetical protein TM0922, N-terminal domain {Th | 86.61 | |
| d1onfa1 | 259 | Glutathione reductase {Plasmodium falciparum [TaxI | 85.93 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 85.88 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 85.6 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 85.53 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 85.16 | |
| d1n2sa_ | 298 | dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S | 85.07 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 84.97 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 84.79 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 84.73 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 84.41 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 84.34 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 84.2 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 84.02 | |
| d1q6oa_ | 213 | 3-keto-L-gulonate 6-phosphate decarboxylase {Esche | 84.02 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 83.81 | |
| d1qmga2 | 226 | Class II ketol-acid reductoisomerase (KARI) {Spina | 83.78 | |
| d1vkza2 | 90 | Glycinamide ribonucleotide synthetase (GAR-syn), N | 83.61 | |
| d1tx2a_ | 273 | Dihydropteroate synthetase {Bacillus anthracis [Ta | 83.56 | |
| d1b7go1 | 178 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 83.56 | |
| d1ad1a_ | 264 | Dihydropteroate synthetase {Staphylococcus aureus | 83.37 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 83.25 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 83.23 | |
| d1km4a_ | 212 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 82.54 | |
| d1pvva2 | 163 | Ornithine transcarbamoylase {Archaeon Pyrococcus f | 82.43 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 82.34 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 81.84 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 81.77 | |
| d1neka2 | 330 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 81.65 | |
| d1yova1 | 529 | Amyloid beta precursor protein-binding protein 1, | 81.58 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 81.57 | |
| d1wdda1 | 325 | Ribulose 1,5-bisphosphate carboxylase-oxygenase {R | 81.3 | |
| d2czca2 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 81.23 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 80.8 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 80.12 | |
| d1gtma1 | 239 | Glutamate dehydrogenase {Archaeon Pyrococcus furio | 80.07 |
| >d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: Aldolase family: Class I aldolase domain: Type I 3-dehydroquinate dehydratase species: Salmonella typhi [TaxId: 90370]
Probab=100.00 E-value=5.4e-57 Score=436.45 Aligned_cols=233 Identities=26% Similarity=0.412 Sum_probs=209.2
Q ss_pred cccccCCCCCCcEEEEeeccCCHHHHHHHHHhhhhcCCCEEEEEecCCCCCCchhHHH----HHHhhC-CCcEEEEeccC
Q 012352 13 KLVSGGMRKNPTLICVPIMGESVDKMVVDMGKANASGADLVEIRLDGLKNFNPRENIK----TLIKES-PVPTLFTYRPI 87 (465)
Q Consensus 13 ~~~~~~~~~~~~~icv~l~~~t~~e~~~~~~~~~~~~~D~vElRlD~l~~~~~~~~l~----~l~~~~-~~PiI~T~R~~ 87 (465)
|+..-+++..+|+|||||++++.+++++++.++...++|+||||+|+|.+..+.+.+. .+++.. ++|+|||+|++
T Consensus 5 ~v~~~~~g~g~pkIcv~l~~~~~~~~~~~~~~~~~~~aD~vE~RlD~l~~~~~~~~l~~~~~~lr~~~~~~PiI~T~R~~ 84 (252)
T d1gqna_ 5 TVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSA 84 (252)
T ss_dssp EETTEEETSSSCEEEEEECCSSHHHHHHHHHHHTTSCCSEEEEEGGGCSCTTCHHHHHHHHHHHHHHCTTSCEEEECCBG
T ss_pred EECCEEecCCCCEEEEEeCCCCHHHHHHHHHHHhhcCCCEEEEEEccccccCCHHHHHHHHHHHHHhcCCCCEEEEEech
Confidence 4455667789999999999999999999999988889999999999999876544443 344443 69999999999
Q ss_pred CCCCCCCCCHHHHHHHHHHHHHhC-CcEEEEeeccccchhHHHH-hcCCCCcEEEEEeccCCCCCCHHHHHHHHHHHHHc
Q 012352 88 WEGGQYDGDENERVDVLRLAMELG-ADYIDVELQVAREFNDSIR-GKKPEKCKVIVSSHNYQYTPSVEDLSNLVARIQAS 165 (465)
Q Consensus 88 ~eGG~~~~~~~~~~~~l~~~~~~~-~~~iDiEl~~~~~~~~~l~-~~~~~~~~iI~S~H~f~~tps~~el~~~~~~~~~~ 165 (465)
+|||.+++++++|+++|+.+++.| +||||||++..++....+. ..+..++++|+|||||++||+.+++.+++++|.++
T Consensus 85 ~eGG~~~~~~~~~~~ll~~~~~~~~~d~iDiEl~~~~~~~~~li~~a~~~~~~vI~S~Hdf~~TP~~~~l~~~~~~m~~~ 164 (252)
T d1gqna_ 85 KEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVSRLRKMQAL 164 (252)
T ss_dssp GGTCSBCCCHHHHHHHHHHHHHHSCCSEEEEEGGGCHHHHHHHHHHHHHTTCEEEEEEEESSCCCCHHHHHHHHHHHHHT
T ss_pred hhCCCCCCCHHHHHHHHHHHHHcCCCceEeccccccHHHHHHHHHHhhcCCCeEEEEecCCCCCCCHHHHHHHHHHHHHh
Confidence 999999999999999999999998 8999999999887766665 34568999999999999999999999999999999
Q ss_pred CCCEEEEEeecCCHHHHHHHHHHhcc-----CCCCEEEEecCccchhhhhhccccCCccccccccCccCCCCCCCChhhH
Q 012352 166 GADIVKFATTALDITDVARVFQITVH-----SQVPIIGLVMGERGLISRILCAKFGGFLTFGTLENGIVSAPGQPTIKDL 240 (465)
Q Consensus 166 gadivKia~~~~~~~D~~~ll~~~~~-----~~~p~i~~~MG~~G~~sRi~~~~~Gs~~tf~~~~~~~~sApGQ~~~~~l 240 (465)
||||+|+|+||++.+|++++++++.+ .+.|+|+||||+.|++||+++++|||++||++++++ +||||+++++|
T Consensus 165 gaDivKia~~a~~~~D~~~ll~~~~~~~~~~~~~P~I~~~MG~~G~~SRi~~~~~GS~~tya~~~~~--sAPGQ~~~~~l 242 (252)
T d1gqna_ 165 GADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQA--SAPGQIAVNDL 242 (252)
T ss_dssp TCSEEEEEECCSSHHHHHHHHHHHHHHHHHTCSSCCEEEECTTTTHHHHHCHHHHTCCEEECBSSSC--CSTTCCBHHHH
T ss_pred CCCeEEEEecCCCHHHHHHHHHHHHHHHHhCCCCCEEEEecCCcchhHHHHHHHhCCceEeccCCCC--CCCCCCCHHHH
Confidence 99999999999999999999988643 378999999999999999999999999999999865 99999999999
Q ss_pred Hhhhccc
Q 012352 241 LDLYNFR 247 (465)
Q Consensus 241 ~~~~~~~ 247 (465)
+++++++
T Consensus 243 ~~~l~~l 249 (252)
T d1gqna_ 243 RSVLMIL 249 (252)
T ss_dssp HHHHHHH
T ss_pred HHHHHHH
Confidence 9999864
|
| >d1sfla_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1vi2a2 c.58.1.5 (A:5-106) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p77a2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nyta2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nvta2 c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1npya2 c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1ajza_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ax3a2 c.104.1.1 (A:1-211) Hypothetical protein TM0922, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis [TaxId: 1392]} | Back information, alignment and structure |
|---|
| >d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wdda1 c.1.14.1 (A:151-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|