Citrus Sinensis ID: 012379


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-----
MHGSSIHASNSVLGSTRMDNSFVVLPKQRPQSHGVPPRPRGSSAQSEASQSGKAMDESFVVIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNNNTYELFGPVNLFWSTRYDKAMTLFLSCLKDFAEFANSKDQENNIPPDKCFKLPYKIENDKVENYSITQSFNKQENWTKALKYTLCNLKWALFWFVGNTNFQPVSAMSSPAEVSAVGSLYAKRGADLKSVGRNLSKP
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEECccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEcccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccc
**********************************************************************************************HSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVL**********************************************FKELEERYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNNNTYELFGPVNLFWSTRYDKAMTLFLSCLKDFAEFAN*********PDKCFKLPYKIENDKVENYSITQSFNKQENWTKALKYTLCNLKWALFWFVGNT**************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHGSSIHASNSVLGSTRMDNSFVVLPKQRPQSHGVPPRPRGSSAQSEASQSGKAMDESFVVIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYWQEFNNFQFQLIAHQEERDAISSKIEVSQAHLELLKRTNVLNDAFPIWHDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMCQYFRPKFPYRIKIIPMGSYPRIMDSNNNTYELFGPVNLFWSTRYDKAMTLFLSCLKDFAEFANSKDQENNIPPDKCFKLPYKIENDKVENYSITQSFNKQENWTKALKYTLCNLKWALFWFVGNTNFQPVSAMSSPAEVSAVGSLYAKRGADLKSVGRNLSKP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beclin-1-like protein confidentQ9M367
Beclin-1 Plays a central role in autophagy. Required for the abcission step in cytokinesis. May play a role in antiviral host defense.probableQ5R878
Beclin-1 Plays a central role in autophagy. Required for the abcission step in cytokinesis. May play a role in antiviral host defense.probableQ91XJ1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DDP, chain A
Confidence level:very confident
Coverage over the Query: 232-426
View the alignment between query and template
View the model in PyMOL
Template: 1C1G, chain A
Confidence level:very confident
Coverage over the Query: 130-149
View the alignment between query and template
View the model in PyMOL
Template: 3Q8T, chain A
Confidence level:confident
Coverage over the Query: 179-251
View the alignment between query and template
View the model in PyMOL
Template: 2P1L, chain B
Confidence level:probable
Coverage over the Query: 91-110
View the alignment between query and template
View the model in PyMOL
Template: 1G8X, chain A
Confidence level:probable
Coverage over the Query: 100-232
View the alignment between query and template
View the model in PyMOL