Citrus Sinensis ID: 012393


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460----
MKNADQQRHILRMLEKSLARELDLEKKISELNQNEEQLKLKLHHTEQVAFRMEEAAEVVWGRFLEAENSAEVLMGISKEMLGRFQIVQFNLNGSLQRESELKSKLGDFIEQLKAKDMVLQKLESTKNSEVLTMKEKVKSLEEQLKESEIRLQNANACFQTSQEQLNEMDNFIESLKESLYGAESRAESAEEKVTQLTDTNLELSEEINFLKGNNDSNTKKVGILENQLRDLEIQLQQAKVSSEASQEQQSMLYSAIWDMETLIEDLKSKVSKAESKTESVEEQCIVLSEDNFELKNKQSFMRDKIKILESSLNRANIEKAASAKEVNHRTKLMMEMVMQLATQRELIQKQVYSLTSENKLLVEKLQYSGKSSSATMYNAGDTDDKELLINPTNNLAGATVKTSEDAVSLMKSVQAGTHLNICRIYTRGLAYPEFVKKVIAMMMILLILIMSYTITGLTFQVLLA
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcc
***************************************LKLHHTEQVAFRMEEAAEVVWGRFLEAENSAEVLMGISKEMLGRFQIVQFNLNGS*************FI**********************************************************************************************************************************************LYSAIWDMETLIE*******************CIVLS*******************************************LMMEMVMQLATQRELIQKQVYSLTSENKLLVEKL**********************LI*****LAGATV*****AVSLMKSVQAGTHLNICRIYTRGLAYPEFVKKVIAMMMILLILIMSYTITGLTFQVLLA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNADQQRHILRMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAFRMEEAAEVVWGRFLEAENSAEVLMGISKEMLGRFQIVQFNLNGSLQRESELKSKLGDFIEQLKAKDMVLQKLESTKNSExxxxxxxxxxxxxxxxxxxxxxxxxxxxFQTSQEQLNEMDNFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxINFLKGNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQSMLYSAxxxxxxxxxxxxxxxxxxxxxxxxxxxxCIVLSEDNFELKNKQSFMRDKIKILESSLNRANIEKAASAKEVNHRTKLMMEMVMQLATQRELIQKQVYSLTSENKLLVEKLQYSGKSSSATMYNAGDTDDKELLINPTNNLAGATVKTSEDAVSLMKSVQAGTHLNICRIYTRGLAYPEFVKKVIAMMMILLILIMSYTITGLTFQVLLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WPP domain-interacting tail-anchored protein 2 Together with WIT1, required for the nuclear envelope docking of RANGAP proteins in root tips.probableA8MQR0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 295-317,329-340
View the alignment between query and template
View the model in PyMOL
Template: 2EFR, chain A
Confidence level:confident
Coverage over the Query: 136-299
View the alignment between query and template
View the model in PyMOL
Template: 2B9C, chain A
Confidence level:confident
Coverage over the Query: 90-232
View the alignment between query and template
View the model in PyMOL
Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 44-109,128-209
View the alignment between query and template
View the model in PyMOL