Citrus Sinensis ID: 012419

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460----

MTDAGLYEFEYGDCESSGLLHDENGFPSFQDNDDDDDDDEEEEEKEESFADDFYRCGTDWSCLLQTERKLKQANLFDMWGLKSNSESEANCLFSPPMKKLKASNGKSTATHLKKIVDRSCPFYKKIPGTPFTVDAFRYGSIKGCSAYFLTHFHYDHYGGLGKRWSHGPIYCSPLTARLVRMCLLVNPSYIHPLELNTEHVIDGVKVTLLEANHCPGAALIHFRLQDGQCYLHTGDFRASRLMQSYPLLVNHRVNVLYLDTTYCNPKYKFPSKEDVLNYVVRLTKNCLKKQPKTLVVVGAYSIGKESVFLAISKALGVKIYANASRRRVLQSFDWPELSGNLCTQGNDTLLHVLPMSSLKFETLKDYLKPYGNQYAAVLAFRPTGWTYSETVGNQLDLIRPLSRGNITIYGVPYSEHSSFTELREFVQFLRPDKIIPTVNVWNAASREKMQSFFREWLSCKKLMI

ccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccECccccEEEccccccccccccEEEEcccccHcccccccccccccEEccHHHHHHHHHHHccccccEEccccccEEEEccEEEEEEEcccccccEEEEEEECccEEEEECcccccccccccccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHcccEEEEcHHHHHHHHHcccccccccccccccccCEEEEccccccHHHHHHHHHHcccccccEEEEEEcccccccccccccccccccccccEEEEEEECcccccHHHHHHHHHHccccCEEEECccccHHHHHHHHHHHHHHHHHHHccc

******Y*FEYGDCESSGLLHDENG*************************DDFYRCGTDWSCLLQTERKLKQANLFDMWGL***********************************DRSCPFYKKIPGTPFTVDAFRYGSIKGCSAYFLTHFHYDHYGGLGKRWSHGPIYCSPLTARLVRMCLLVNPSYIHPLELNTEHVIDGVKVTLLEANHCPGAALIHFRLQDGQCYLHTGDFRASRLMQSYPLLVNHRVNVLYLDTTYCNPKYKFPSKEDVLNYVVRLTKNCLKKQPKTLVVVGAYSIGKESVFLAISKALGVKIYANASRRRVLQSFDWPELSGNLCTQGNDTLLHVLPMSSLKFETLKDYLKPYGNQYAAVLAFRPTGWTYSETVGNQLDLIRPLSRGNITIYGVPYSEHSSFTELREFVQFLRPDKIIPTVNVWNAASREKMQSFFREWLSCKKLM*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DNA cross-link repair protein SNM1	May be required for repair of DNA lesions formed after exposure to oxidative stress.	probable	Q38961

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B87, chain A
Confidence level:very confident
Coverage over the Query: 118-384,396-460
View the alignment between query and template
View the model in PyMOL

Template: 3BV6, chain A
Confidence level:confident
Coverage over the Query: 58-262
View the alignment between query and template
View the model in PyMOL