Citrus Sinensis ID: 012439

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460---

MVGLIDLNKTKDDENPSSGSLASASGVSSELWHACAGPLISLPKRGSVVVYFPQGHLEHVSDFSAAASAAYDIPPHLFCRVADVKLHADAASDEVYAQVSLVHDELIEQKVRKGKIKEDGDEESVEVAAKSSTPHMFCKTLTASDTSTCGGFSVPRRAAEDCFPPLDYMQQRPSQQLVAKDLHGVEWKFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGEDGELKIGIRRAAQVKNGATFPSFCNQHSSTSSVTEVVDAIARKRAFSISYNPRASASEFVIPVNKFLKSLDHPFAEGMRFKMRSETEDAAEQRCSGLIVGVSDMDPVRWPGSKWRCLLVRWDDVESNRHNRVSPWEIEPSGSNILVTSGLRRTRIGLPLWRPEFPVPEGIGVTDFGESLRFQTVLQGQEISPKSPYGRAPTNNEAHDIAALESLTVFRYQDLFIIGTCTRYRSAVS

ccccccccccccccccccccccccccccHHHHHHHccccccccccccEEEEcccccccccccccccccccccccccccEEEEEEEEccccccHHHHHHHcccccHHHHHHHHcccccccccccHHHHHccccccCEEEEEEEccccccccccCEEcccHHHcccccccccccccEEEEEEEccccEEEEEEEECccccCEEEccccHHHHcccccccccEEEEEEccccccEEEEEEHHccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHcccccccccEEEEEECcccccccEEEEEEEECcccccccccccccEEEEEECccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccc

*****************************ELWHACAGPLISLPKRGSVVVYFPQGHLEHVSDFSAAASAAYDIPPHLFCRVADVKLHADAASDEVYAQVSLVHDELIE***************************MFCKTLTASDTSTCGGFSVPRRAAEDCFPPLDYMQ***SQQLVAKDLHGVEWKFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGEDGELKIGIRRAAQVKNGATF*******SSTSSVTEVVDAIARKRAFSISYNPRASASEFVIPVNKFLKSLDHPFAEGMRFKMRSETEDAAEQRCSGLIVGVSDMDPVRWPGSKWRCLLVRWDDVESNRHNRVSPWEIEPSGSNILVTSGLR*****************************************************************FRYQ*LFIIGTCTR******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Auxin response factor 3	Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Involved in the establishment or elaboration of tissue patterning during gynoecial development.	probable	O23661

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WID, chain A
Confidence level:very confident
Coverage over the Query: 131-242
View the alignment between query and template
View the model in PyMOL