Citrus Sinensis ID: 012445

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460---
MYRNAASRLRALKGHVRCRVPSATRFASSSAVASTSSSSGGLFSWLTGERSSSSPSLDFPLPGVSLPPSLPDYVEPGKTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGTTHLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLIDCVRNPVFLDWEVNEQLTKVKSEISEVSNNPQSLLLEAIHSAGYSGALANPLLAPESAINRLNSTLLEEFVAENYTGPRMVLAASGVEHDQLVSVAEPLLSDLPSIHPREEPKSVYTGGDYRCQADSGDQLTHFVLAFELPGGWHKDKDAMTLTVLQMLLGGGGSFSAGGPGKGMYSRLYRRVLNEFPQVQSFSAFSNIYNHSGMFGIQGTTGSDFVSKAIDLAARELISVATPGEVDQVQLDRAKQSTKSAILMNLESRMVVSEDIGRQVLTYGERYGWRPDI
ccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEcccccEEEEEcccccCEEEEEEEcccccccccccccHHHHHHHHcccccccccHHHHHHHHHHcccCEEEEccccCEEEEEEEccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccHHHHccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHccccccccccccccccccccccEEEcccccccEEEEEEEEccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccEEEEEEccccccccccEEEEEEcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccc
******************************************************************************TKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGTTHLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLIDCVRNPVFLDWEVNEQLTKVKSEISEVSNNPQSLLLEAIHSAGYSGALANPLLAPESAINRLNSTLLEEFVAENYTGPRMVLAASGVEHDQLVSVAEPLL**************VYTGGDYRCQADSGDQLTHFVLAFELPGGWHKDKDAMTLTVLQMLLGGGGSFSAGGPGKGMYSRLYRRVLNEFPQVQSFSAFSNIYNHSGMFGIQGTTGSDFVSKAIDLAARELISVATPGEVDQVQLDRAKQSTKSAILMNLESRMVVSEDIGRQVLTYGERYGW****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYRNAASRLRALKGHVRCRVPSATRFASSSAVASTSSSSGGLFSWLTGERSSSSPSLDFPLPGVSLPPSLPDYVEPGKTKISTLPNGVKIASETSVSPVASISLYVGCGSIYESPISFGTTHLLERMAFRSTRNRSHLRIVREVEAIGGNVQASASREQMGYSFDALKTYVPEMVELLIDCVRNPVFLDWEVNEQLTKVKSEISEVSNNPQSLLLEAIHSAGYSGALANPLLAPESAINRLNSTLLEEFVAENYTGPRMVLAASGVEHDQLVSVAEPLLSDLPSIHPREEPKSVYTGGDYRCQADSGDQLTHFVLAFELPGGWHKDKDAMTLTVLQMLLGGGGSFSAGGPGKGMYSRLYRRVLNEFPQVQSFSAFSNIYNHSGMFGIQGTTGSDFVSKAIDLAARELISVATPGEVDQVQLDRAKQSTKSAILMNLESRMVVSEDIGRQVLTYGERYGWRPDI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable mitochondrial-processing peptidase subunit alpha-1 Cleaves presequences (transit peptides) from mitochondrial protein precursors.probableQ9ZU25
Mitochondrial-processing peptidase subunit alpha This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. Mediate formation of the complex between cytochromes c and c1.probableP29677
Cytochrome b-c1 complex subunit 2, mitochondrial This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The core protein 2 is required for the assembly of the complex.probableQ9DB77

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.24.-Metalloendopeptidases.probable
3.4.24.64Mitochondrial processing peptidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HR6, chain A
Confidence level:very confident
Coverage over the Query: 77-458
View the alignment between query and template
View the model in PyMOL