Citrus Sinensis ID: 012571


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460
MRSPWFNKLSVILGRGPPLSWLLLCFLSIVALIAVLGSSTSNTLDFVTSSSKPDIYSSYRRLKEQAAVDYLELRTLSLGTTRPKELDLCGKERENFVPCYNVSANLLAGFKEGEEFDRHCGMSGLGDRCLVRPPKDYKIPLRWPAGRDVIWSANVKITKDQFLSSGSMTKRLMLLEENQIAFHSEDGLVFDGVKDYSRQIAEMIGLGTDSEFLQAGVQSVLDVGCGFGSFGAHLVSLKLMAVCVAVYEATGSQVQLALERGLPAMIGNFISRQLPYPSLSFDMVHCAQCGIIWDKKEGIFLIEADRLLKPGGYFVLTSPESKPRGSSSSRKNKSLLKVMEEFTEKICWSLIAQQDETFIWQKTVDAHCYTSRKHGLPLCKEEHDAVPYYHPLVSCISATNSKRWISIQNRSSGSQLSSAELEVHGKYCFKIIFSQCIVLVVLHAVCVLIPYWCVVPVPVF
cccccccccEEEccccccccEEHHHHHHHHHHHEEEcccccccccEEEccccccccccccccccccccHHHHHccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccEEEEEccccccccccHHHHHHHHHHHHcccccccccccEEEEEEEcccccHHHHHHHHcccEEEEEEcccccHHHHHHHHHccccEEEEEccccccccccccEEEEEEccccccccccHHHHHHHHHcccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHcHHHcEEEccEEEEEEcccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccc
cccccccHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccHHHHHcccHHHcHHHHcccccccccccccccccccccccccccccccEEEHcccccccccHHEEEcccccEEEEcccEEEcccccccccccHHHHHHHHHHHcccccccccccccEEEEEEccccHccHHHHHHcccEEEEEEcccccHHHHHHHHHHccccEEEEEHcccccccccccEcEHHHccccccccccccEEEEEEcEEEccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHcccccccccccccccccEcccHHccccccccccccccccccccccccccccccccHcccccHHHHHHEEEEHHEEEEEccEEEcccccc
MRSPWFNKLSVilgrgpplsWLLLCFLSIVALIAVLgsstsntldfvtssskpdiyssYRRLKEQAAVDYLELRtlslgttrpkeldlcgkerenfvpcynvSANLlagfkegeefdrhcgmsglgdrclvrppkdykiplrwpagrdviwSANVkitkdqflssgsMTKRLMLLEENQiafhsedglvfdgVKDYSRQIAEMIGLGTDSEFLQAGVQSVLdvgcgfgsfgaHLVSLKLMAVCVAVYEATGSQVQLALERGLPAMIGNFisrqlpypslsfdmvhCAQCGIIWDKKEGIFLIEAdrllkpggyfvltspeskprgssssrknKSLLKVMEEFTEKICWSLIAQQDETFIWqktvdahcytsrkhglplckeehdavpyyhplvscisatnskrWISIqnrssgsqlssaELEVHGKYCFKIIFSQCIVLVVLHAVCVLIpywcvvpvpvf
MRSPWFNKLSVILGRGPPLSWLLLCFLSIVALIAVLGsstsntldfvtssskpdiyssYRRLKEQAAVDYLElrtlslgttrpkELDLCGKERENFVPCYNVSANLLAGFKEGEEFDRHCGMSglgdrclvrppkdykiplrwpagrdvIWSANVKITKDQFLSSGSMTKRLMLLEENQIAFHSEDGLVFDGVKDYSRQIAEMIGLGTDSEFLQAGVQSVLDVGCGFGSFGAHLVSLKLMAVCVAVYEATGSQVQLALERGLPAMIGNFISRQLPYPSLSFDMVHCAQCGIIWDKKEGIFLIEADRLLKPGGYFVltspeskprgssssrknkSLLKVMEEFTEKICWSLIAQQDETFIWQKTVDAHCYTSRKHGLPLCKEEHDAVPYYHPLVSCISATNSKRWISIQNRSSGSQLSSAELEVHGKYCFKIIFSQCIVLVVLHAVCVLIPYWCVVPVPVF
MRSPWFNKLSVILGRGPPLSWLLLCFLSIVALIAVLGSSTSNTLDFVTSSSKPDIYSSYRRLKEQAAVDYLELRTLSLGTTRPKELDLCGKERENFVPCYNVSANLLAGFKEGEEFDRHCGMSGLGDRCLVRPPKDYKIPLRWPAGRDVIWSANVKITKDQFLSSGSMTKRLMLLEENQIAFHSEDGLVFDGVKDYSRQIAEMIGLGTDSEFLQAGVQSVLDVGCGFGSFGAHLVSLKLMAVCVAVYEATGSQVQLALERGLPAMIGNFISRQLPYPSLSFDMVHCAQCGIIWDKKEGIFLIEADRLLKPGGYFVLTspeskprgssssrknksllkVMEEFTEKICWSLIAQQDETFIWQKTVDAHCYTSRKHGLPLCKEEHDAVPYYHPLVSCISATNSKRWISIQNRSSGSQLSSAELEVHGKYCFKIIFSQCIVLVVLHAVCVLIPYWCVVPVPVF
****WFNKLSVILGRGPPLSWLLLCFLSIVALIAVLGSSTSNTLDFVTS****DIYSSYRRLKEQAAVDYLELRTLSLGTTRPKELDLCGKERENFVPCYNVSANLLAGFKEGEEFDRHCGMSGLGDRCLVRPPKDYKIPLRWPAGRDVIWSANVKITKDQFLSSGSMTKRLMLLEENQIAFHSEDGLVFDGVKDYSRQIAEMIGLGTDSEFLQAGVQSVLDVGCGFGSFGAHLVSLKLMAVCVAVYEATGSQVQLALERGLPAMIGNFISRQLPYPSLSFDMVHCAQCGIIWDKKEGIFLIEADRLLKPGGYFVL*******************LKVMEEFTEKICWSLIAQQDETFIWQKTVDAHCYTSRKHGLPLCKEEHDAVPYYHPLVSCISATNSKRWISIQ***********ELEVHGKYCFKIIFSQCIVLVVLHAVCVLIPYWCVVPVP**
**************RGPPLSWLLLCFLSIVALIAVLGSSTSNTLDF***************************************LDLCGKERENFVPCYNVSANLLAGFKEGEEFDRHCGMSGLGDRCLVRPPKDYKIPLRWPAGRDVIWSANVKITKDQFLSSGSMTKRLMLLEENQIAFHSEDGLVFDGVKDYSRQIAEMIGLGTDSEFLQAGVQSVLDVGCGFGSFGAHLVSLKLMAVCVAVYEATGSQVQLALERGLPAMIGNFISRQLPYPSLSFDMVHCAQCGIIWDKKEGIFLIEADRLLKPGGYFVLTSPESKPRGSSSSRKNKSLLKVMEEFTEKICWSLIAQQDETFIWQKTVDAH**************EHDAVPYYHPLVSCISATN***********************HGKYCFKIIFSQCIVLVVLHAVCVLIPYWCVVPVPVF
MRSPWFNKLSVILGRGPPLSWLLLCFLSIVALIAVLGSSTSNTLDFVTSSSKPDIYSSYRRLKEQAAVDYLELRTLSLGTTRPKELDLCGKERENFVPCYNVSANLLAGFKEGEEFDRHCGMSGLGDRCLVRPPKDYKIPLRWPAGRDVIWSANVKITKDQFLSSGSMTKRLMLLEENQIAFHSEDGLVFDGVKDYSRQIAEMIGLGTDSEFLQAGVQSVLDVGCGFGSFGAHLVSLKLMAVCVAVYEATGSQVQLALERGLPAMIGNFISRQLPYPSLSFDMVHCAQCGIIWDKKEGIFLIEADRLLKPGGYFVLTS**************KSLLKVMEEFTEKICWSLIAQQDETFIWQKTVDAHCYTSRKHGLPLCKEEHDAVPYYHPLVSCISATNSKRWISIQ**********AELEVHGKYCFKIIFSQCIVLVVLHAVCVLIPYWCVVPVPVF
****WFNKLSVILGRGPPLSWLLLCFLSIVALIAVLGSS*******************************************PKELDLCGKERENFVPCYNVSANLLAGFKEGEEFDRHCGMSGLGDRCLVRPPKDYKIPLRWPAGRDVIWSANVKITKDQFLSSGSMTKRLMLLEENQIAFHSEDGLVFDGVKDYSRQIAEMIGLGTDSEFLQAGVQSVLDVGCGFGSFGAHLVSLKLMAVCVAVYEATGSQVQLALERGLPAMIGNFISRQLPYPSLSFDMVHCAQCGIIWDKKEGIFLIEADRLLKPGGYFVLTSPESKPRGSSSSRKNKSLLKVMEEFTEKICWSLIAQQDETFIWQKTVDAHCYTSRKHGLPLCKEEHDAVPYYHPLVSCISATNSKRWISIQNRSSGS*L*SAELEVHGKYCFKIIFSQCIVLVVLHAVCVLIPYWCVVPVPVF
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiii
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSPWFNKLSVILGRGPPLSWLLLCFLSIVALIAVLGSSTSNTLDFVTSSSKPDIYSSYRRLKEQAAVDYLELRTLSLGTTRPKELDLCGKERENFVPCYNVSANLLAGFKEGEEFDRHCGMSGLGDRCLVRPPKDYKIPLRWPAGRDVIWSANVKITKDQFLSSGSMTKRLMLLEENQIAFHSEDGLVFDGVKDYSRQIAEMIGLGTDSEFLQAGVQSVLDVGCGFGSFGAHLVSLKLMAVCVAVYEATGSQVQLALERGLPAMIGNFISRQLPYPSLSFDMVHCAQCGIIWDKKEGIFLIEADRLLKPGGYFVLTSPESKPRGSSSSRKNKSLLKVMEEFTEKICWSLIAQQDETFIWQKTVDAHCYTSRKHGLPLCKEEHDAVPYYHPLVSCISATNSKRWISIQNRSSGSQLSSAELEVHGKYCFKIIFSQCIVLVVLHAVCVLIPYWCVVPVPVF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query460 2.2.26 [Sep-21-2011]
Q3EC77 606 Probable methyltransferas yes no 0.952 0.722 0.656 1e-165
Q8GYW9 603 Probable methyltransferas no no 0.882 0.673 0.635 1e-158
Q9C9Q8 684 Probable pectin methyltra no no 0.856 0.576 0.520 1e-120
Q8VZV7 612 Probable methyltransferas no no 0.810 0.609 0.312 5e-53
Q93YV7 608 Probable methyltransferas no no 0.636 0.481 0.322 8e-51
Q940J9 623 Probable methyltransferas no no 0.639 0.471 0.332 2e-50
Q8H118 611 Probable methyltransferas no no 0.652 0.490 0.319 2e-50
O22285 694 Probable methyltransferas no no 0.684 0.453 0.338 3e-50
Q9FG39 682 Probable methyltransferas no no 0.652 0.439 0.354 4e-50
Q94KE1 655 Probable methyltransferas no no 0.654 0.459 0.338 2e-49
>sp|Q3EC77|PMT5_ARATH Probable methyltransferase PMT5 OS=Arabidopsis thaliana GN=At2g03480 PE=2 SV=2 Back     alignment and function desciption
 Score =  581 bits (1497), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 290/442 (65%), Positives = 351/442 (79%), Gaps = 4/442 (0%)

Query: 1   MRSPWFNKLSVILGRGPPLSWLLLCFLSIVALIAVLGSSTSNTLDFVTSSS-KPDIYSSY 59
           MR  W+  +S + G  P +  LL   + +VAL+ +L   TSN+ D  +SS+  P+IYS+Y
Sbjct: 1   MRGSWYKSVSSVFGLRPRIRGLLFFIVGVVALVTILAPLTSNSYDSSSSSTLVPNIYSNY 60

Query: 60  RRLKEQAAVDYLELRTLSLGTTRPKELDLCGKERENFVPCYNVSANLLAGFKEGEEFDRH 119
           RR+KEQAAVDYL+LR+LSLG +  KE   CGKERE++VPCYN++ NLLAG +EGEE DRH
Sbjct: 61  RRIKEQAAVDYLDLRSLSLGASL-KEFPFCGKERESYVPCYNITGNLLAGLQEGEELDRH 119

Query: 120 CGMSGLGDRCLVRPPKDYKIPLRWPAGRDVIWSANVKITKDQFLSSGSMTKRLMLLEENQ 179
           C      +RC+VRPP+DYKIPLRWP GRD+IWS NVKITKDQFLSSG++T RLMLLEENQ
Sbjct: 120 CEFEREKERCVVRPPRDYKIPLRWPLGRDIIWSGNVKITKDQFLSSGTVTTRLMLLEENQ 179

Query: 180 IAFHSEDGLVFDGVKDYSRQIAEMIGLGTDSEFLQAGVQSVLDVGCGFGSFGAHLVSLKL 239
           I FHSEDGLVFDGVKDY+RQIAEMIGLG+D+EF QAGV++VLD+GCGFGSFGAHLVSLKL
Sbjct: 180 ITFHSEDGLVFDGVKDYARQIAEMIGLGSDTEFAQAGVRTVLDIGCGFGSFGAHLVSLKL 239

Query: 240 MAVCVAVYEATGSQVQLALERGLPAMIGNFISRQLPYPSLSFDMVHCAQCGIIWDKKEGI 299
           M +C+A YEATGSQVQLALERGLPAMIGNF S+QLPYP+LSFDMVHCAQCG  WD K+ +
Sbjct: 240 MPICIAEYEATGSQVQLALERGLPAMIGNFFSKQLPYPALSFDMVHCAQCGTTWDIKDAM 299

Query: 300 FLIEADRLLKPGGYFVLTSPESKPRGSSSSRKNKSLLKVMEEFTEKICWSLIAQQDETFI 359
            L+E DR+LKPGGYFVLTSP +K +G+    K  S+   + E ++KICWSL AQQDETF+
Sbjct: 300 LLLEVDRVLKPGGYFVLTSPTNKAQGNLPDTKKTSISTRVNELSKKICWSLTAQQDETFL 359

Query: 360 WQKTVDAHCYTSRKHG-LPLCKEEHDAVPYYHPLVSCISATNSKRWISIQNRSSGSQLSS 418
           WQKT D+ CY+SR    +PLCK + D+VPYYHPLV CIS T SKRWISIQNRS+ +  +S
Sbjct: 360 WQKTSDSSCYSSRSQASIPLCK-DGDSVPYYHPLVPCISGTTSKRWISIQNRSAVAGTTS 418

Query: 419 AELEVHGKYCFKIIFSQCIVLV 440
           A LE+HGK   K  +S    L+
Sbjct: 419 AGLEIHGKSALKNYWSLLTPLI 440





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q8GYW9|PMT4_ARATH Probable methyltransferase PMT4 OS=Arabidopsis thaliana GN=At1g13860 PE=2 SV=2 Back     alignment and function description
>sp|Q9C9Q8|PMTT_ARATH Probable pectin methyltransferase QUA2 OS=Arabidopsis thaliana GN=QUA2 PE=1 SV=2 Back     alignment and function description
>sp|Q8VZV7|PMT9_ARATH Probable methyltransferase PMT9 OS=Arabidopsis thaliana GN=At5g14430 PE=1 SV=1 Back     alignment and function description
>sp|Q93YV7|PMT3_ARATH Probable methyltransferase PMT3 OS=Arabidopsis thaliana GN=At4g14360 PE=1 SV=1 Back     alignment and function description
>sp|Q940J9|PMT8_ARATH Probable methyltransferase PMT8 OS=Arabidopsis thaliana GN=At1g04430 PE=1 SV=1 Back     alignment and function description
>sp|Q8H118|PMT1_ARATH Probable methyltransferase PMT1 OS=Arabidopsis thaliana GN=At3g23300 PE=1 SV=2 Back     alignment and function description
>sp|O22285|PMTB_ARATH Probable methyltransferase PMT11 OS=Arabidopsis thaliana GN=At2g39750 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG39|PMTC_ARATH Probable methyltransferase PMT12 OS=Arabidopsis thaliana GN=At5g06050 PE=2 SV=1 Back     alignment and function description
>sp|Q94KE1|PMTA_ARATH Probable methyltransferase PMT10 OS=Arabidopsis thaliana GN=At1g77260 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query460
297738060429 unnamed protein product [Vitis vinifera] 0.926 0.993 0.814 0.0
359472802 620 PREDICTED: probable methyltransferase PM 0.923 0.685 0.816 0.0
255542060 620 ATP binding protein, putative [Ricinus c 0.923 0.685 0.793 0.0
224112126 617 predicted protein [Populus trichocarpa] 0.913 0.680 0.779 0.0
356494969 623 PREDICTED: probable methyltransferase PM 0.934 0.690 0.714 0.0
356499881 623 PREDICTED: probable methyltransferase PM 0.934 0.690 0.712 0.0
449478364 653 PREDICTED: probable methyltransferase PM 0.921 0.649 0.721 0.0
449434732 656 PREDICTED: probable methyltransferase PM 0.921 0.646 0.721 0.0
357475025 628 hypothetical protein MTR_4g083030 [Medic 0.930 0.681 0.706 0.0
297814646 619 predicted protein [Arabidopsis lyrata su 0.919 0.683 0.672 1e-166
>gi|297738060|emb|CBI27261.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/427 (81%), Positives = 381/427 (89%), Gaps = 1/427 (0%)

Query: 1   MRSPWFNKLSVILGRGPPLSWLLLCFLSIVALIAVLGSSTSNTLDFVTSSSKPDIYSSYR 60
           MRS W NKLSVILG  PP+SWLLLC +S++ALIAVLGSS+SN+ + VTS   PDIY++YR
Sbjct: 1   MRSSWINKLSVILGPRPPVSWLLLCLISVLALIAVLGSSSSNSFESVTSIPVPDIYTNYR 60

Query: 61  RLKEQAAVDYLELRTLSLGTTRPKELDLCGKERENFVPCYNVSANLLAGFKEGEEFDRHC 120
           RLKEQAA+DYLELRTLSLG +R +EL LCGKE EN+VPCYNVSANLLAGFK+GEEFDRHC
Sbjct: 61  RLKEQAAIDYLELRTLSLGVSRQRELGLCGKELENYVPCYNVSANLLAGFKDGEEFDRHC 120

Query: 121 GMSGLGDRCLVRPPKDYKIPLRWPAGRDVIWSANVKITKDQFLSSGSMTKRLMLLEENQI 180
            +S  G RCLVRPPKDYKIPLRWPAGRDVIWS NVKITKDQFLSSGSMTKRLMLLEENQI
Sbjct: 121 ELSRDGQRCLVRPPKDYKIPLRWPAGRDVIWSGNVKITKDQFLSSGSMTKRLMLLEENQI 180

Query: 181 AFHSEDGLVFDGVKDYSRQIAEMIGLGTDSEFLQAGVQSVLDVGCGFGSFGAHLVSLKLM 240
           AFHSEDGL FDGVK+YSRQIAEMIGLG+DSEFLQAGV++VLD+GCGFGSF AHLVSLKLM
Sbjct: 181 AFHSEDGLNFDGVKEYSRQIAEMIGLGSDSEFLQAGVRTVLDIGCGFGSFAAHLVSLKLM 240

Query: 241 AVCVAVYEATGSQVQLALERGLPAMIGNFISRQLPYPSLSFDMVHCAQCGIIWDKKEGIF 300
           AVC+A YEATGSQVQLALERGLPAMIGNFISRQLPYPSLSFDMVHCAQCGIIWDK++G+F
Sbjct: 241 AVCIAEYEATGSQVQLALERGLPAMIGNFISRQLPYPSLSFDMVHCAQCGIIWDKRDGMF 300

Query: 301 LIEADRLLKPGGYFVLTSPESKPRGSSSSRKNKSLLKVMEEFTEKICWSLIAQQDETFIW 360
           LIE DR+LKPGGYFVLTSP SKPRGSSSS K  S+L  +EE T++ICWSL+AQQDET IW
Sbjct: 301 LIEVDRVLKPGGYFVLTSPTSKPRGSSSSTKKGSVLTPIEELTQRICWSLLAQQDETLIW 360

Query: 361 QKTVDAHCYTSRKHG-LPLCKEEHDAVPYYHPLVSCISATNSKRWISIQNRSSGSQLSSA 419
           QKT+D HCYTSRK G +PLCKEEHD   YY PL+ CIS T SKRWI IQNRSSG  LSS 
Sbjct: 361 QKTMDVHCYTSRKQGAVPLCKEEHDTQSYYQPLIPCISGTTSKRWIPIQNRSSGFHLSSV 420

Query: 420 ELEVHGK 426
           ELEVHG 
Sbjct: 421 ELEVHGN 427




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359472802|ref|XP_002271275.2| PREDICTED: probable methyltransferase PMT5-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255542060|ref|XP_002512094.1| ATP binding protein, putative [Ricinus communis] gi|223549274|gb|EEF50763.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224112126|ref|XP_002316092.1| predicted protein [Populus trichocarpa] gi|222865132|gb|EEF02263.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356494969|ref|XP_003516353.1| PREDICTED: probable methyltransferase PMT4-like [Glycine max] Back     alignment and taxonomy information
>gi|356499881|ref|XP_003518764.1| PREDICTED: probable methyltransferase PMT4-like [Glycine max] Back     alignment and taxonomy information
>gi|449478364|ref|XP_004155297.1| PREDICTED: probable methyltransferase PMT4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449434732|ref|XP_004135150.1| PREDICTED: probable methyltransferase PMT4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357475025|ref|XP_003607798.1| hypothetical protein MTR_4g083030 [Medicago truncatula] gi|355508853|gb|AES89995.1| hypothetical protein MTR_4g083030 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297814646|ref|XP_002875206.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297321044|gb|EFH51465.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query460
TAIR|locus:2063798 606 QUL2 "QUASIMODO2 LIKE 2" [Arab 0.952 0.722 0.642 1.9e-154
TAIR|locus:2014789 603 QUL1 "QUASIMODO2 LIKE 1" [Arab 0.882 0.673 0.619 3.9e-140
TAIR|locus:2032130 684 TSD2 "TUMOROUS SHOOT DEVELOPME 0.860 0.578 0.508 3.4e-109
TAIR|locus:2145658 612 AT5G14430 [Arabidopsis thalian 0.813 0.611 0.309 8.3e-51
TAIR|locus:2063947 694 AT2G39750 [Arabidopsis thalian 0.684 0.453 0.341 2e-47
TAIR|locus:2153704 682 AT5G06050 [Arabidopsis thalian 0.658 0.444 0.347 6.9e-47
TAIR|locus:2090935 611 AT3G23300 [Arabidopsis thalian 0.806 0.607 0.295 3e-46
TAIR|locus:2150670 600 AT5G04060 [Arabidopsis thalian 0.821 0.63 0.318 3.8e-46
TAIR|locus:2018329 623 AT1G04430 [Arabidopsis thalian 0.636 0.470 0.321 7.9e-46
TAIR|locus:2195955 655 AT1G77260 [Arabidopsis thalian 0.654 0.459 0.338 1.6e-45
TAIR|locus:2063798 QUL2 "QUASIMODO2 LIKE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1506 (535.2 bits), Expect = 1.9e-154, P = 1.9e-154
 Identities = 284/442 (64%), Positives = 341/442 (77%)

Query:     1 MRSPWFNKLSVILGRGPPLSWLLLCFLSIVALIAVLGSSTSNTLDFVTSSSK-PDIYSSY 59
             MR  W+  +S + G  P +  LL   + +VAL+ +L   TSN+ D  +SS+  P+IYS+Y
Sbjct:     1 MRGSWYKSVSSVFGLRPRIRGLLFFIVGVVALVTILAPLTSNSYDSSSSSTLVPNIYSNY 60

Query:    60 RRLKEQAAVDYLELRTLSLGTTRPKELDLCGKERENFVPCYNVSANLLAGFKEGEEFDRH 119
             RR+KEQAAVDYL+LR+LSLG +  KE   CGKERE++VPCYN++ NLLAG +EGEE DRH
Sbjct:    61 RRIKEQAAVDYLDLRSLSLGASL-KEFPFCGKERESYVPCYNITGNLLAGLQEGEELDRH 119

Query:   120 CGMSGLGDRCLVRPPKDYKIPLRWPAGRDVIWSANVKITKDQFLSSGSMTKRLMLLEENQ 179
             C      +RC+VRPP+DYKIPLRWP GRD+IWS NVKITKDQFLSSG++T RLMLLEENQ
Sbjct:   120 CEFEREKERCVVRPPRDYKIPLRWPLGRDIIWSGNVKITKDQFLSSGTVTTRLMLLEENQ 179

Query:   180 IAFHSEDGLVFDGVKDYSRQIAEMIGLGTDSEFLQAGVQSVLDVGCGFGSFGAHLVSLKL 239
             I FHSEDGLVFDGVKDY+RQIAEMIGLG+D+EF QAGV++VLD+GCGFGSFGAHLVSLKL
Sbjct:   180 ITFHSEDGLVFDGVKDYARQIAEMIGLGSDTEFAQAGVRTVLDIGCGFGSFGAHLVSLKL 239

Query:   240 MAVCVAVYEATGSQVQLALERGLPAMIGNFISRQLPYPSLSFDMVHCAQCGIIWDKKEGI 299
             M +C+A YEATGSQVQLALERGLPAMIGNF S+QLPYP+LSFDMVHCAQCG  WD K+ +
Sbjct:   240 MPICIAEYEATGSQVQLALERGLPAMIGNFFSKQLPYPALSFDMVHCAQCGTTWDIKDAM 299

Query:   300 FLIEADRLLKPGGYFVLTXXXXXXXXXXXXXXXXXXXXVMEEFTEKICWSLIAQQDETFI 359
              L+E DR+LKPGGYFVLT                     + E ++KICWSL AQQDETF+
Sbjct:   300 LLLEVDRVLKPGGYFVLTSPTNKAQGNLPDTKKTSISTRVNELSKKICWSLTAQQDETFL 359

Query:   360 WQKTVDAHCYTSRKHG-LPLCKEEHDAVPYYHPLVSCISATNSKRWISIQNRSSGSQLSS 418
             WQKT D+ CY+SR    +PLCK+  D+VPYYHPLV CIS T SKRWISIQNRS+ +  +S
Sbjct:   360 WQKTSDSSCYSSRSQASIPLCKDG-DSVPYYHPLVPCISGTTSKRWISIQNRSAVAGTTS 418

Query:   419 AELEVHGKYCFKIIFSQCIVLV 440
             A LE+HGK   K  +S    L+
Sbjct:   419 AGLEIHGKSALKNYWSLLTPLI 440




GO:0008168 "methyltransferase activity" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IDA
TAIR|locus:2014789 QUL1 "QUASIMODO2 LIKE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032130 TSD2 "TUMOROUS SHOOT DEVELOPMENT 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2145658 AT5G14430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063947 AT2G39750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153704 AT5G06050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090935 AT3G23300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150670 AT5G04060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018329 AT1G04430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195955 AT1G77260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3EC77PMT5_ARATH2, ., 1, ., 1, ., -0.65610.95210.7227yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00080884
annotation not avaliable (630 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query460
pfam03141 506 pfam03141, Methyltransf_29, Putative S-adenosyl-L- 7e-78
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 8e-08
PLN02244340 PLN02244, PLN02244, tocopherol O-methyltransferase 8e-07
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 1e-05
pfam1364997 pfam13649, Methyltransf_25, Methyltransferase doma 2e-04
COG0500257 COG0500, SmtA, SAM-dependent methyltransferases [S 3e-04
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 0.001
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 0.004
COG2226238 COG2226, UbiE, Methylase involved in ubiquinone/me 0.004
>gnl|CDD|217386 pfam03141, Methyltransf_29, Putative S-adenosyl-L-methionine-dependent methyltransferase Back     alignment and domain information
 Score =  251 bits (642), Expect = 7e-78
 Identities = 123/313 (39%), Positives = 175/313 (55%), Gaps = 25/313 (7%)

Query: 95  NFVPCYNVSANL--LAGFKEGEEFDRHCGMSGLGDRCLVRPPKDYKIPLRWPAGRDVIWS 152
           +++PC +    +  L   +  E  +RHC  S    RCLV PP  YK P+ WP  RD +W 
Sbjct: 1   DYIPCLDNDRAIKFLLSRERMEHRERHCPPSEEKLRCLVPPPDGYKTPIPWPKSRDKVWY 60

Query: 153 ANVKITKDQFLSSGSMTKRLMLLEENQIAFHSEDGLVFD-GVKDYSRQIAEMIGLGTDSE 211
           ANV  TK   L+     +  + +E ++  F    G  F  G   Y   +A+MI       
Sbjct: 61  ANVPHTK---LAEEKGGQNWVKVEGDKFRF-PGGGTQFPHGADAYIDFLAQMIPDIAWG- 115

Query: 212 FLQAGVQSVLDVGCGFGSFGAHLVSLKLMAVCVA---VYEATGSQVQLALERGLPAMIGN 268
                V++ LDVGCG  SFGA+L+S  ++ +  A   V+EA   QVQ ALERG+PAM+G 
Sbjct: 116 ---GRVRTALDVGCGVASFGAYLLSRDVLTMSFAPKDVHEA---QVQFALERGVPAMLGV 169

Query: 269 FISRQLPYPSLSFDMVHCAQCGIIWDKKEGIFLIEADRLLKPGGYFVLTSPESKPRGSSS 328
             +R+LPYPS SFDM HC++C I W   +GI L+E DR+L+PGGYFVL+ P   P  +  
Sbjct: 170 LGTRRLPYPSRSFDMAHCSRCLIPWHANDGILLLEVDRVLRPGGYFVLSGP---PVYARD 226

Query: 329 SRKNKSLLKVMEEFTEKICWSLIAQQDETFIWQKTVDAHCYTSRKHG--LPLCKE--EHD 384
               +   K ME   + +CW L+A++ +  IWQK V+  CY  R+ G   PLCK+  + D
Sbjct: 227 EEDLQEEWKAMEALAKSLCWKLVAKKGDIAIWQKPVNNSCYNKREPGKKPPLCKDSDDPD 286

Query: 385 AVPYYHPLVSCIS 397
           A  +Y P+ +CI+
Sbjct: 287 AA-WYVPMEACIT 298


This family is a putative S-adenosyl-L-methionine (SAM)-dependent methyltransferase. Length = 506

>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|215135 PLN02244, PLN02244, tocopherol O-methyltransferase Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|222287 pfam13649, Methyltransf_25, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|223574 COG0500, SmtA, SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|225136 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 460
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 100.0
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.77
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.77
PLN02233261 ubiquinone biosynthesis methyltransferase 99.71
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.69
KOG4300252 consensus Predicted methyltransferase [General fun 99.67
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.62
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.62
PLN02244340 tocopherol O-methyltransferase 99.6
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.6
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.58
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.56
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.56
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.56
PRK05785226 hypothetical protein; Provisional 99.55
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.54
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.53
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.53
PRK11207197 tellurite resistance protein TehB; Provisional 99.52
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.5
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.5
PLN02336475 phosphoethanolamine N-methyltransferase 99.5
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.5
PLN02490340 MPBQ/MSBQ methyltransferase 99.49
PRK08317241 hypothetical protein; Provisional 99.49
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.49
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.48
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.47
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.46
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.46
PRK12335287 tellurite resistance protein TehB; Provisional 99.44
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.44
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.43
TIGR00452314 methyltransferase, putative. Known examples to dat 99.43
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.42
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.41
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.41
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.39
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.39
KOG1270282 consensus Methyltransferases [Coenzyme transport a 99.38
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.37
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.37
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.36
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.36
PRK06922677 hypothetical protein; Provisional 99.35
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.35
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.33
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.3
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.29
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.29
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.28
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.28
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 99.28
PRK06202232 hypothetical protein; Provisional 99.27
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.27
PLN02336 475 phosphoethanolamine N-methyltransferase 99.25
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.25
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.25
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.24
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 99.23
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.21
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.21
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.21
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.21
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.19
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 99.17
COG4976287 Predicted methyltransferase (contains TPR repeat) 99.14
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.13
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.13
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.13
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 99.13
PLN03075296 nicotianamine synthase; Provisional 99.12
PRK04266226 fibrillarin; Provisional 99.12
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.11
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 99.11
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 99.11
PRK13255218 thiopurine S-methyltransferase; Reviewed 99.11
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.1
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.08
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.08
KOG3010261 consensus Methyltransferase [General function pred 99.08
PRK14968188 putative methyltransferase; Provisional 99.07
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.06
PRK14967223 putative methyltransferase; Provisional 99.06
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.05
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 99.05
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.03
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.03
PTZ00146293 fibrillarin; Provisional 99.02
TIGR03438301 probable methyltransferase. This model represents 99.02
PLN02232160 ubiquinone biosynthesis methyltransferase 99.01
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.01
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 99.0
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.98
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.97
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.97
TIGR00438188 rrmJ cell division protein FtsJ. 98.94
KOG2361264 consensus Predicted methyltransferase [General fun 98.93
PRK07402196 precorrin-6B methylase; Provisional 98.92
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.92
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.91
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.9
KOG1271227 consensus Methyltransferases [General function pre 98.87
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 98.86
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.85
PRK10901427 16S rRNA methyltransferase B; Provisional 98.82
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.82
PHA03411279 putative methyltransferase; Provisional 98.82
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.81
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.81
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.81
COG4123248 Predicted O-methyltransferase [General function pr 98.8
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.8
PRK14901434 16S rRNA methyltransferase B; Provisional 98.8
KOG2940325 consensus Predicted methyltransferase [General fun 98.79
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.78
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 98.76
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.76
PRK14904445 16S rRNA methyltransferase B; Provisional 98.76
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.75
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.74
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.72
PRK04457262 spermidine synthase; Provisional 98.7
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 98.7
PRK00811283 spermidine synthase; Provisional 98.69
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.69
KOG3045325 consensus Predicted RNA methylase involved in rRNA 98.69
PRK14903431 16S rRNA methyltransferase B; Provisional 98.69
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.67
PRK14902444 16S rRNA methyltransferase B; Provisional 98.67
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.66
PRK01581374 speE spermidine synthase; Validated 98.66
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.66
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.66
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.64
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 98.6
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.59
PHA03412241 putative methyltransferase; Provisional 98.59
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 98.58
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.57
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.57
PRK03612521 spermidine synthase; Provisional 98.53
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.5
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.5
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.5
PLN02366308 spermidine synthase 98.49
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.48
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.47
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.44
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.39
COG2890280 HemK Methylase of polypeptide chain release factor 98.37
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.36
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 98.35
KOG2899288 consensus Predicted methyltransferase [General fun 98.33
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.32
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.3
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.3
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.29
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.27
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.26
COG2521287 Predicted archaeal methyltransferase [General func 98.26
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.25
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 98.23
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 98.2
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.2
PRK04148134 hypothetical protein; Provisional 98.19
PLN02476278 O-methyltransferase 98.18
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.17
KOG1499346 consensus Protein arginine N-methyltransferase PRM 98.16
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 98.14
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.14
COG4122219 Predicted O-methyltransferase [General function pr 98.12
PLN02672 1082 methionine S-methyltransferase 98.08
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.06
COG1041347 Predicted DNA modification methylase [DNA replicat 98.06
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.05
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.03
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.0
PTZ00338294 dimethyladenosine transferase-like protein; Provis 97.98
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 97.97
KOG1331293 consensus Predicted methyltransferase [General fun 97.94
PLN02823336 spermine synthase 97.93
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 97.93
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 97.88
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.87
PLN02589247 caffeoyl-CoA O-methyltransferase 97.87
KOG2904328 consensus Predicted methyltransferase [General fun 97.86
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 97.8
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 97.78
COG0421282 SpeE Spermidine synthase [Amino acid transport and 97.76
PRK00536262 speE spermidine synthase; Provisional 97.73
KOG3201201 consensus Uncharacterized conserved protein [Funct 97.71
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.67
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 97.67
KOG1500517 consensus Protein arginine N-methyltransferase CAR 97.66
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.64
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 97.64
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.63
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 97.56
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 97.53
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.44
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 97.43
KOG3987288 consensus Uncharacterized conserved protein DREV/C 97.43
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 97.37
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 97.36
KOG2352 482 consensus Predicted spermine/spermidine synthase [ 97.36
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 97.34
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 97.33
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 97.27
KOG3420185 consensus Predicted RNA methylase [Translation, ri 97.27
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 97.27
KOG1663237 consensus O-methyltransferase [Secondary metabolit 97.24
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 97.2
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 97.15
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 97.13
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 97.13
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 97.11
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 97.11
COG1092393 Predicted SAM-dependent methyltransferases [Genera 97.11
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 97.08
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 97.06
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.03
KOG1709271 consensus Guanidinoacetate methyltransferase and r 96.97
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 96.97
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 96.85
COG2520341 Predicted methyltransferase [General function pred 96.82
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 96.8
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 96.79
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 96.78
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 96.69
COG2265432 TrmA SAM-dependent methyltransferases related to t 96.67
COG0742187 N6-adenine-specific methylase [DNA replication, re 96.64
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 96.53
COG4627185 Uncharacterized protein conserved in bacteria [Fun 96.45
COG4798238 Predicted methyltransferase [General function pred 96.44
KOG2798369 consensus Putative trehalase [Carbohydrate transpo 96.29
PF13679141 Methyltransf_32: Methyltransferase domain 96.22
COG3897218 Predicted methyltransferase [General function pred 96.17
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 96.09
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 96.02
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 95.95
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 95.85
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 95.8
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 95.77
COG4262508 Predicted spermidine synthase with an N-terminal m 95.76
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 95.73
PLN02668386 indole-3-acetate carboxyl methyltransferase 95.71
COG5459 484 Predicted rRNA methylase [Translation, ribosomal s 95.53
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 95.5
COG4076252 Predicted RNA methylase [General function predicti 95.25
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 94.83
KOG3115249 consensus Methyltransferase-like protein [General 94.66
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 94.32
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 94.31
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 94.15
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 93.48
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 93.35
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 93.02
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 92.94
PF03514374 GRAS: GRAS domain family; InterPro: IPR005202 Sequ 92.76
COG0286489 HsdM Type I restriction-modification system methyl 92.64
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 92.17
PF03492334 Methyltransf_7: SAM dependent carboxyl methyltrans 91.93
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 91.83
KOG2793248 consensus Putative N2,N2-dimethylguanosine tRNA me 91.79
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 91.17
PF03269177 DUF268: Caenorhabditis protein of unknown function 91.15
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 90.79
PHA01634156 hypothetical protein 90.09
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 90.04
PF02005377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 89.88
PRK09880343 L-idonate 5-dehydrogenase; Provisional 89.64
PRK13699227 putative methylase; Provisional 89.02
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 88.95
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 88.9
KOG0822649 consensus Protein kinase inhibitor [Cell cycle con 88.8
KOG1099294 consensus SAM-dependent methyltransferase/cell div 88.72
KOG2920282 consensus Predicted methyltransferase [General fun 88.57
KOG2539491 consensus Mitochondrial/chloroplast ribosome small 88.28
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 87.59
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 87.48
KOG1562337 consensus Spermidine synthase [Amino acid transpor 87.33
KOG1596317 consensus Fibrillarin and related nucleolar RNA-bi 87.27
COG2384226 Predicted SAM-dependent methyltransferase [General 86.76
KOG2730263 consensus Methylase [General function prediction o 85.59
PF01795310 Methyltransf_5: MraW methylase family; InterPro: I 85.22
COG0275314 Predicted S-adenosylmethionine-dependent methyltra 84.75
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 84.18
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 84.18
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 84.17
KOG1501 636 consensus Arginine N-methyltransferase [General fu 83.93
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 83.41
COG3129292 Predicted SAM-dependent methyltransferase [General 82.19
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 82.18
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 81.67
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 81.57
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 81.41
COG4301321 Uncharacterized conserved protein [Function unknow 81.29
COG3510237 CmcI Cephalosporin hydroxylase [Defense mechanisms 80.98
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
Probab=100.00  E-value=8.8e-70  Score=559.46  Aligned_cols=314  Identities=39%  Similarity=0.753  Sum_probs=283.0

Q ss_pred             CccCCCCchhhhhc--CccccceecCCCCCCCCCCCcccCCCCCCCCCCcCCCCcccccccCcccchhhhccccccchhh
Q 012571           95 NFVPCYNVSANLLA--GFKEGEEFDRHCGMSGLGDRCLVRPPKDYKIPLRWPAGRDVIWSANVKITKDQFLSSGSMTKRL  172 (460)
Q Consensus        95 ~~~pc~d~~~~~~~--~~~~~~~~er~Cp~~~~~~~Cl~~~P~~y~~P~~wP~srd~~W~~Nvp~~~~~~l~~~~~~q~w  172 (460)
                      |||||+|+++++++  ++++++|||||||+.+++++||||+|++||.|++||+|||++|++||||++   +...+.+|||
T Consensus         1 dy~PC~D~~~~~~~~~~~~~~~~rERhCP~~~~~~~CLVp~P~gYk~P~~WP~SRd~iW~~Nvph~~---L~~~K~~qnW   77 (506)
T PF03141_consen    1 DYIPCLDNSRAIKFLLSRERMEHRERHCPPPEERLRCLVPPPKGYKTPIPWPKSRDYIWYANVPHTK---LAEEKADQNW   77 (506)
T ss_pred             CCcCCCCHHHHHhhccCcccccEeeccCcCCCCCCccccCCCccCCCCCCCCcccceeeecccCchH---Hhhhcccccc
Confidence            79999999999998  899999999999999999999999999999999999999999999999999   6678899999


Q ss_pred             hhhccccccccccccccccchhHHHHHHHHHHccCCCchhhccCCCeEEEeCCCCchHHHHHHhccCceeEEEEeeCCHH
Q 012571          173 MLLEENQIAFHSEDGLVFDGVKDYSRQIAEMIGLGTDSEFLQAGVQSVLDVGCGFGSFGAHLVSLKLMAVCVAVYEATGS  252 (460)
Q Consensus       173 ~~~~~~~~~F~~~~~~~fd~~~~~~~~i~~~l~~~~~~~~~~~~~~~VLDIGCGtG~~a~~La~~g~~~~~v~giD~s~~  252 (460)
                      +..+++.+.|++|++.+.+++.+|+++|.++++...    ....++++||||||+|+|+++|+++++.+++++..|.++.
T Consensus        78 v~~~gd~~~FPgggt~F~~Ga~~Yid~i~~~~~~~~----~~g~iR~~LDvGcG~aSF~a~l~~r~V~t~s~a~~d~~~~  153 (506)
T PF03141_consen   78 VRVEGDKFRFPGGGTMFPHGADHYIDQIAEMIPLIK----WGGGIRTALDVGCGVASFGAYLLERNVTTMSFAPNDEHEA  153 (506)
T ss_pred             eeecCCEEEeCCCCccccCCHHHHHHHHHHHhhccc----cCCceEEEEeccceeehhHHHHhhCCceEEEcccccCCch
Confidence            999999999999555445899999999999998721    1236789999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCCeEEEeecccCCCCCCCCccEEEEccccccccccHHHHHHHHHHhcCCCcEEEEEeCCCCCCCCCCchhh
Q 012571          253 QVQLALERGLPAMIGNFISRQLPYPSLSFDMVHCAQCGIIWDKKEGIFLIEADRLLKPGGYFVLTSPESKPRGSSSSRKN  332 (460)
Q Consensus       253 ~l~~A~~rgl~~~~~~~d~~~Lp~~~~sFDlVvs~~~l~~~~~d~~~~L~ei~RvLkPGG~lvl~~~~~~~~~~~~~~e~  332 (460)
                      ++++|.+||+++.+..+..++|||++++||+|||+.|+..|.++.+.+|.|++|+|||||+|+++.++.+.+.   .++.
T Consensus       154 qvqfaleRGvpa~~~~~~s~rLPfp~~~fDmvHcsrc~i~W~~~~g~~l~evdRvLRpGGyfv~S~ppv~~r~---~~~~  230 (506)
T PF03141_consen  154 QVQFALERGVPAMIGVLGSQRLPFPSNAFDMVHCSRCLIPWHPNDGFLLFEVDRVLRPGGYFVLSGPPVYQRT---DEDL  230 (506)
T ss_pred             hhhhhhhcCcchhhhhhccccccCCccchhhhhcccccccchhcccceeehhhhhhccCceEEecCCcccccc---hHHH
Confidence            9999999999999998889999999999999999999999998878899999999999999999999887322   2367


Q ss_pred             hHHHHHHHHHHHHhCeEEEeeecceeeeeeccCccccccccc--CCCcccCCCC-CCCceeccceeEccCCCC------C
Q 012571          333 KSLLKVMEEFTEKICWSLIAQQDETFIWQKTVDAHCYTSRKH--GLPLCKEEHD-AVPYYHPLVSCISATNSK------R  403 (460)
Q Consensus       333 ~~~w~~i~~l~~~~~w~~~~~~~~~~iw~k~~~~~C~~~r~~--~~~L~~ag~~-~~awy~pl~~ci~~~~~~------~  403 (460)
                      ..+|.+|+++++++||++++++++.+||+|+.+++||.+|+.  .++||+.+++ +.+||+||++||++.|..      .
T Consensus       231 ~~~~~~~~~l~~~lCW~~va~~~~~aIwqKp~~~~Cy~~r~~~~~pplC~~~~dpd~aWY~~l~~Cit~~p~~~~~~~~~  310 (506)
T PF03141_consen  231 EEEWNAMEDLAKSLCWKKVAEKGDTAIWQKPTNNSCYQKRKPGKSPPLCDSSDDPDAAWYVPLEACITPLPEVSSEIAGG  310 (506)
T ss_pred             HHHHHHHHHHHHHHHHHHheeeCCEEEEeccCCchhhhhccCCCCCCCCCCCCCCcchhhcchhhhcCcCCccccccccc
Confidence            899999999999999999999999999999999999999986  3999997777 999999999999998854      4


Q ss_pred             CCc-ccccc--ccCcccc
Q 012571          404 WIS-IQNRS--SGSQLSS  418 (460)
Q Consensus       404 W~~-~~~~~--~~~~l~~  418 (460)
                      |++ -|+|+  .|.+|.+
T Consensus       311 ~~~~WP~RL~~~P~rl~~  328 (506)
T PF03141_consen  311 WLPKWPERLNAVPPRLSS  328 (506)
T ss_pred             CCCCChhhhccCchhhhc
Confidence            443 35555  5555554



; GO: 0008168 methyltransferase activity

>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>PF03514 GRAS: GRAS domain family; InterPro: IPR005202 Sequence analysis of the products of the GRAS (GAI, RGA, SCR) gene family indicates that they share a variable N terminus and a highly conserved C terminus that contains five recognizable motifs [] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1099 consensus SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2920 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2539 consensus Mitochondrial/chloroplast ribosome small subunit component [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>COG4301 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query460
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 8e-13
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 2e-11
3f4k_A257 Putative methyltransferase; structural genomics, P 3e-11
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 1e-10
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 1e-10
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 2e-10
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 5e-10
3cc8_A230 Putative methyltransferase; structural genomics, j 6e-10
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 7e-10
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 1e-09
1vlm_A219 SAM-dependent methyltransferase; possible histamin 2e-09
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 2e-09
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 2e-09
3ege_A261 Putative methyltransferase from antibiotic biosyn 3e-09
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 5e-09
3i9f_A170 Putative type 11 methyltransferase; structural gen 7e-09
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 1e-08
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 4e-08
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 5e-08
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 5e-08
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 7e-08
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 7e-08
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 9e-08
1xxl_A239 YCGJ protein; structural genomics, protein structu 1e-07
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 1e-07
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 2e-07
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 3e-07
1vl5_A260 Unknown conserved protein BH2331; putative methylt 5e-07
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 5e-07
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 5e-07
3dh0_A219 SAM dependent methyltransferase; cystal structure, 5e-07
3ocj_A305 Putative exported protein; structural genomics, PS 6e-07
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 2e-06
3hnr_A220 Probable methyltransferase BT9727_4108; structural 2e-06
3gu3_A284 Methyltransferase; alpha-beta protein, structural 3e-06
3m33_A226 Uncharacterized protein; structural genomics, PSI- 4e-06
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 5e-06
2kw5_A202 SLR1183 protein; structural genomics, northeast st 5e-06
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 9e-06
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 2e-05
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 3e-05
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 4e-05
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 1e-04
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 1e-04
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 1e-04
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 1e-04
1wzn_A252 SAM-dependent methyltransferase; structural genomi 2e-04
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 3e-04
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 4e-04
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 4e-04
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 5e-04
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 6e-04
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 6e-04
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 7e-04
3dtn_A234 Putative methyltransferase MM_2633; structural gen 7e-04
2p7i_A250 Hypothetical protein; putative methyltransferase, 8e-04
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 9e-04
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 9e-04
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
 Score = 67.5 bits (165), Expect = 8e-13
 Identities = 29/142 (20%), Positives = 51/142 (35%), Gaps = 21/142 (14%)

Query: 198 RQIAEMIGLGTDSEFLQAGVQSVLDVGCGFGSFGAHLVSLKLMAVCVAVYEATGSQVQLA 257
            ++  ++ + +           VLDVGCG G     L + + + V   +   +  QV  A
Sbjct: 51  DEMIALLDVRSG--------DRVLDVGCGIGKPAVRLATARDVRV-TGI-SISRPQVNQA 100

Query: 258 LER----GLPAMI----GNFISRQLPYPSLSFDMVHCAQCGIIWDKKEGIFLIEADRLLK 309
             R    GL   +     +     LP+   SFD V   +       +    L E  R+L+
Sbjct: 101 NARATAAGLANRVTFSYADA--MDLPFEDASFDAVWALESLHHMPDRGR-ALREMARVLR 157

Query: 310 PGGYFVLTSPESKPRGSSSSRK 331
           PGG   +           + ++
Sbjct: 158 PGGTVAIADFVLLAPVEGAKKE 179


>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Length = 219 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Length = 254 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Length = 211 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* Length = 312 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Length = 202 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Length = 235 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Length = 219 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256 Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Length = 302 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Length = 215 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Length = 246 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 252 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Length = 950 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Length = 292 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Length = 263 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Length = 298 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Length = 215 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Length = 199 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Length = 250 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Length = 243 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query460
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.67
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.67
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.66
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.65
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.64
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.63
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.63
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.63
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.62
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.62
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.62
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.62
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.61
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.61
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.6
3f4k_A257 Putative methyltransferase; structural genomics, P 99.6
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.6
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.59
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.59
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.59
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.58
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.58
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.58
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.57
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.57
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.56
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.56
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.56
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.56
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.56
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.55
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.55
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.55
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.55
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.55
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.55
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.54
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.54
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.54
3lcc_A235 Putative methyl chloride transferase; halide methy 99.54
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.54
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.54
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.54
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.54
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.54
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.54
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.54
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.52
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.52
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.52
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.51
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.51
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.5
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.5
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.49
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.49
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.49
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.49
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.48
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.48
3ocj_A305 Putative exported protein; structural genomics, PS 99.47
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.47
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.47
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.47
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.46
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.46
3cc8_A230 Putative methyltransferase; structural genomics, j 99.46
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.46
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.45
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.45
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.45
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.44
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.44
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.43
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.43
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.42
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.41
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.41
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.41
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.4
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.4
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.4
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.39
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.39
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.38
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.38
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.38
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.37
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.36
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.36
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.36
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.36
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.36
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.36
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 99.36
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.35
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.35
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.35
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.34
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.34
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 99.34
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.33
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.32
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.32
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.32
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.32
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.31
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 99.31
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.3
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.3
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.3
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.3
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.29
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.29
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.29
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.29
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.29
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.29
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.29
2fyt_A340 Protein arginine N-methyltransferase 3; structural 99.28
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.28
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.27
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.27
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.26
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 99.26
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.26
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.26
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.26
3lpm_A259 Putative methyltransferase; structural genomics, p 99.25
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.25
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.25
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.24
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.24
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.24
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.24
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.24
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 99.23
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.23
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.23
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.23
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.23
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.22
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.22
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.22
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.22
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 99.22
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.21
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.21
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.2
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 99.2
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.2
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.19
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.19
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.19
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.19
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.19
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.19
3sso_A419 Methyltransferase; macrolide, natural product, ros 99.18
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.18
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.18
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.18
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.18
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.18
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 99.18
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 99.18
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.17
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.17
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.16
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.16
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.16
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.16
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.15
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.15
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.15
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.15
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 99.15
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.15
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.14
2b25_A336 Hypothetical protein; structural genomics, methyl 99.13
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.12
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.11
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.11
3giw_A277 Protein of unknown function DUF574; rossmann-fold 99.11
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.1
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 99.1
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.1
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.1
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.1
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.09
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.09
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 99.07
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.06
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 99.05
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 99.05
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.05
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.03
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.02
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.02
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 99.02
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.02
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 99.02
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.01
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.01
1xj5_A334 Spermidine synthase 1; structural genomics, protei 99.0
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.99
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.99
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.98
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.97
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.97
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.97
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 98.97
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 98.97
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 98.96
2i7c_A283 Spermidine synthase; transferase, structural genom 98.95
2o07_A304 Spermidine synthase; structural genomics, structur 98.95
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.94
2pt6_A321 Spermidine synthase; transferase, structural genom 98.94
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.94
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.94
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.93
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 98.93
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.93
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.92
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.92
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.9
2h00_A254 Methyltransferase 10 domain containing protein; st 98.9
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.89
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.89
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.89
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.88
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.87
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 98.85
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.85
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.85
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.85
3k6r_A278 Putative transferase PH0793; structural genomics, 98.84
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.83
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 98.81
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.8
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.8
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 98.79
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 98.79
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.79
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 98.77
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.73
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.7
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.68
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.67
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.67
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.64
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.63
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 98.6
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 98.58
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.49
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.44
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.42
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.42
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.4
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.38
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.37
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.36
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 98.33
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.29
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 98.23
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.21
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.19
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 98.18
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.15
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 98.14
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.13
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein 98.13
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.08
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.06
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.0
3lkd_A542 Type I restriction-modification system methyltrans 97.96
3khk_A544 Type I restriction-modification system methylation 97.94
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 97.92
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 97.91
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 97.85
3ua3_A745 Protein arginine N-methyltransferase 5; TIM-barrel 97.82
3cvo_A202 Methyltransferase-like protein of unknown functio; 97.76
3ll7_A410 Putative methyltransferase; methytransferase, stru 97.69
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 97.67
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 97.61
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 97.57
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 97.56
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 97.46
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 97.36
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 97.17
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 97.14
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 96.92
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 96.77
2px2_A269 Genome polyprotein [contains: capsid protein C (co 96.75
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 96.72
2zig_A297 TTHA0409, putative modification methylase; methylt 96.67
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 96.62
3ufb_A530 Type I restriction-modification system methyltran 96.5
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 96.48
1g55_A343 DNA cytosine methyltransferase DNMT2; human DNA me 94.72
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 94.58
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 94.35
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 93.92
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 93.83
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 93.63
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 93.58
1i4w_A353 Mitochondrial replication protein MTF1; mitochondr 93.54
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 93.36
3tka_A347 Ribosomal RNA small subunit methyltransferase H; H 93.2
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 92.93
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 92.58
3qv2_A327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 92.2
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 92.07
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 92.03
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 91.96
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 91.44
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 91.41
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 91.23
4h0n_A333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 90.93
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 90.87
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 90.75
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 90.54
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 90.42
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 90.31
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 90.09
2c7p_A327 Modification methylase HHAI; DNA methyltransferase 90.06
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 89.96
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 89.8
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 89.7
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 89.65
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 89.18
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 89.08
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 89.07
1rjd_A334 PPM1P, carboxy methyl transferase for protein phos 89.05
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 88.94
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 88.88
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 88.84
2zig_A297 TTHA0409, putative modification methylase; methylt 88.41
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 88.03
3gms_A340 Putative NADPH:quinone reductase; structural genom 87.6
1boo_A 323 Protein (N-4 cytosine-specific methyltransferase P 87.37
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 87.33
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 87.2
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 87.12
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 86.8
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 86.79
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 86.64
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 86.47
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 86.06
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 86.04
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 85.72
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 85.54
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 85.26
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 85.13
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 84.88
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 84.61
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 84.23
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 83.67
4eye_A342 Probable oxidoreductase; structural genomics, niai 83.43
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 82.94
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 82.93
3fbg_A346 Putative arginate lyase; structural genomics, unkn 82.71
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 82.65
3ubt_Y331 Modification methylase HAEIII; protein-DNA complex 81.38
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 81.37
2uyo_A310 Hypothetical protein ML2640; putative methyltransf 81.05
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 80.29
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
Probab=99.67  E-value=1.2e-15  Score=142.83  Aligned_cols=139  Identities=17%  Similarity=0.181  Sum_probs=105.7

Q ss_pred             CeEEEeCCCCchHHHHHHhccCceeEEEEeeCCHHHHHHHHHcCC-CeEEEeecccCCCCCCCCccEEEEcccccccccc
Q 012571          218 QSVLDVGCGFGSFGAHLVSLKLMAVCVAVYEATGSQVQLALERGL-PAMIGNFISRQLPYPSLSFDMVHCAQCGIIWDKK  296 (460)
Q Consensus       218 ~~VLDIGCGtG~~a~~La~~g~~~~~v~giD~s~~~l~~A~~rgl-~~~~~~~d~~~Lp~~~~sFDlVvs~~~l~~~~~d  296 (460)
                      .+|||||||+|.++..+++.+   .+++|+|+++.+++.++++.. .+.+...|...++++ ++||+|++..+++|+ ++
T Consensus        47 ~~vLDiGcG~G~~~~~l~~~~---~~v~~vD~s~~~~~~a~~~~~~~~~~~~~d~~~~~~~-~~fD~v~~~~~l~~~-~~  121 (220)
T 3hnr_A           47 GNVLEFGVGTGNLTNKLLLAG---RTVYGIEPSREMRMIAKEKLPKEFSITEGDFLSFEVP-TSIDTIVSTYAFHHL-TD  121 (220)
T ss_dssp             SEEEEECCTTSHHHHHHHHTT---CEEEEECSCHHHHHHHHHHSCTTCCEESCCSSSCCCC-SCCSEEEEESCGGGS-CH
T ss_pred             CeEEEeCCCCCHHHHHHHhCC---CeEEEEeCCHHHHHHHHHhCCCceEEEeCChhhcCCC-CCeEEEEECcchhcC-Ch
Confidence            799999999999999999985   589999999999999988754 567777788888887 999999999877777 45


Q ss_pred             HHH--HHHHHHHhcCCCcEEEEEeCCCCCCCCCC-----------c--hhhh-----HHHHHHHHHHHHhCeEEEeeecc
Q 012571          297 EGI--FLIEADRLLKPGGYFVLTSPESKPRGSSS-----------S--RKNK-----SLLKVMEEFTEKICWSLIAQQDE  356 (460)
Q Consensus       297 ~~~--~L~ei~RvLkPGG~lvl~~~~~~~~~~~~-----------~--~e~~-----~~w~~i~~l~~~~~w~~~~~~~~  356 (460)
                      ...  +++++.++|||||.+++.++.........           .  ....     ..-+.+..+.++.+|+++.....
T Consensus       122 ~~~~~~l~~~~~~LkpgG~l~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~aGf~v~~~~~~  201 (220)
T 3hnr_A          122 DEKNVAIAKYSQLLNKGGKIVFADTIFADQDAYDKTVEAAKQRGFHQLANDLQTEYYTRIPVMQTIFENNGFHVTFTRLN  201 (220)
T ss_dssp             HHHHHHHHHHHHHSCTTCEEEEEEECBSSHHHHHHHHHHHHHTTCHHHHHHHHHSCCCBHHHHHHHHHHTTEEEEEEECS
T ss_pred             HHHHHHHHHHHHhcCCCCEEEEEeccccChHHHHHHHHHHHhCCCccchhhcchhhcCCHHHHHHHHHHCCCEEEEeecc
Confidence            555  99999999999999999987543210000           0  0000     01255677788888888776666


Q ss_pred             eeeee
Q 012571          357 TFIWQ  361 (460)
Q Consensus       357 ~~iw~  361 (460)
                      ...|.
T Consensus       202 ~~~w~  206 (220)
T 3hnr_A          202 HFVWV  206 (220)
T ss_dssp             SSEEE
T ss_pred             ceEEE
Confidence            55554



>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 460
d1wzna1251 c.66.1.43 (A:1-251) Hypothetical methyltransferase 3e-07
d1nt2a_209 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Arch 5e-06
d1g8aa_227 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyro 6e-06
d1jqea_280 c.66.1.19 (A:) Histamine methyltransferase {Human 7e-06
d2gh1a1281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 9e-06
d1nkva_245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 2e-05
d1g8sa_230 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Meth 3e-05
d1xvaa_292 c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Ra 3e-05
d1y8ca_246 c.66.1.43 (A:) Putative methyltransferase CAC2371 4e-05
d2i6ga1198 c.66.1.44 (A:1-198) Putative methyltransferase Teh 5e-05
d2p7ia1225 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 6e-05
d1o54a_266 c.66.1.13 (A:) Hypothetical protein TM0748 {Thermo 7e-05
d1xxla_234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 1e-04
d2avna1246 c.66.1.41 (A:1-246) Hypothetical methyltransferase 3e-04
d1pjza_201 c.66.1.36 (A:) Thiopurine S-methyltransferase {Pse 3e-04
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 6e-04
d1ri5a_252 c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf 8e-04
d1g6q1_328 c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Ba 0.001
d1u2za_406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 0.001
d2b25a1324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 0.002
d2fyta1311 c.66.1.6 (A:238-548) Protein arginine N-methyltran 0.003
d1oria_316 c.66.1.6 (A:) Protein arginine N-methyltransferase 0.003
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 251 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: CAC2371-like
domain: Hypothetical methyltransferase PH1305
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]
 Score = 49.3 bits (116), Expect = 3e-07
 Identities = 23/136 (16%), Positives = 42/136 (30%), Gaps = 4/136 (2%)

Query: 186 DGLVFDGVKDYSRQIAEMIGLGTDSEFLQAGVQSVLDVGCGFGSFGAHLVSLKLMAVCVA 245
           D +    ++    +I  +  +    E  +  V+ VLD+ CG G     L       V + 
Sbjct: 13  DTIYRRRIERVKAEIDFVEEI--FKEDAKREVRRVLDLACGTGIPTLELAERGYEVVGLD 70

Query: 246 VYEATGSQVQLALERGLPAMIGNFISRQLPYPSLSFDMVHCAQ--CGIIWDKKEGIFLIE 303
           ++E      +   +     +               FD V           ++       +
Sbjct: 71  LHEEMLRVARRKAKERNLKIEFLQGDVLEIAFKNEFDAVTMFFSTIMYFDEEDLRKLFSK 130

Query: 304 ADRLLKPGGYFVLTSP 319
               LKPGG F+   P
Sbjct: 131 VAEALKPGGVFITDFP 146


>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 209 Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 227 Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 280 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 292 Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Length = 198 Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Length = 225 Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Length = 266 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Length = 246 Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Length = 201 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 328 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query460
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.77
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.77
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.73
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.72
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.72
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.69
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.67
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.65
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.64
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.62
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.62
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.62
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.62
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.61
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.6
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.6
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.59
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.57
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.55
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.55
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.51
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.49
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.49
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.47
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.46
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.46
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.45
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.45
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.42
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.42
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.41
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.4
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.37
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.35
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.35
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.33
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.32
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.28
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.28
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.23
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 99.23
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.22
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.21
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.2
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.16
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.13
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.12
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.1
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 99.08
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.83
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.83
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.8
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.8
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 98.79
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.79
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.76
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.64
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.63
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.62
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.58
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.57
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.56
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.55
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.47
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.45
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.44
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.39
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.34
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.23
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.17
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.17
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.14
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.09
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.07
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.03
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.03
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.02
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 97.99
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 97.89
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 97.85
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 97.83
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 97.8
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.75
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 97.66
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 97.66
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.59
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 97.5
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 97.5
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.36
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 97.33
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.29
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 97.22
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 97.14
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 97.13
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 97.09
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 96.99
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 96.78
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 96.58
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.26
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 96.14
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 96.11
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 95.67
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.41
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.14
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.78
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.42
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 94.12
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 93.92
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 93.73
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.54
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 92.93
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 92.78
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 92.77
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 91.97
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 91.36
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 90.75
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 90.42
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 90.25
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 90.21
d1g55a_343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 89.53
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 89.28
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 88.59
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 88.45
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 88.29
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 88.27
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 88.0
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 87.4
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 87.17
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 85.61
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 84.95
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 84.67
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 84.32
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 83.91
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 81.46
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 80.35
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: UbiE/COQ5-like
domain: Hypothetical protein YcgJ
species: Bacillus subtilis [TaxId: 1423]
Probab=99.77  E-value=1.2e-18  Score=164.12  Aligned_cols=115  Identities=22%  Similarity=0.299  Sum_probs=100.3

Q ss_pred             HHHHHHHHHHccCCCchhhccCCCeEEEeCCCCchHHHHHHhccCceeEEEEeeCCHHHHHHHHHc----CC-CeEEEee
Q 012571          195 DYSRQIAEMIGLGTDSEFLQAGVQSVLDVGCGFGSFGAHLVSLKLMAVCVAVYEATGSQVQLALER----GL-PAMIGNF  269 (460)
Q Consensus       195 ~~~~~i~~~l~~~~~~~~~~~~~~~VLDIGCGtG~~a~~La~~g~~~~~v~giD~s~~~l~~A~~r----gl-~~~~~~~  269 (460)
                      .+.+.+.+.+..+++        .+|||||||+|.++..|++++   .+++|+|+|+.|++.|+++    +. .+.+..+
T Consensus         3 ~~~~~l~~~~~~~~~--------~rILDiGcGtG~~~~~la~~~---~~v~gvD~S~~~l~~A~~~~~~~~~~~~~~~~~   71 (234)
T d1xxla_           3 HSLGLMIKTAECRAE--------HRVLDIGAGAGHTALAFSPYV---QECIGVDATKEMVEVASSFAQEKGVENVRFQQG   71 (234)
T ss_dssp             HHHHHHHHHHTCCTT--------CEEEEESCTTSHHHHHHGGGS---SEEEEEESCHHHHHHHHHHHHHHTCCSEEEEEC
T ss_pred             hHHHHHHHHhCCCCC--------CEEEEeCCcCcHHHHHHHHhC---CeEEEEeCChhhhhhhhhhhccccccccccccc
Confidence            456678888888887        899999999999999999886   4789999999999988765    43 4778888


Q ss_pred             cccCCCCCCCCccEEEEccccccccccHHHHHHHHHHhcCCCcEEEEEeCCC
Q 012571          270 ISRQLPYPSLSFDMVHCAQCGIIWDKKEGIFLIEADRLLKPGGYFVLTSPES  321 (460)
Q Consensus       270 d~~~Lp~~~~sFDlVvs~~~l~~~~~d~~~~L~ei~RvLkPGG~lvl~~~~~  321 (460)
                      |.+++|+++++||+|+|..+++|+ +++..++++++|+|||||+++++++..
T Consensus        72 d~~~~~~~~~~fD~v~~~~~l~~~-~d~~~~l~~~~r~LkpgG~~~~~~~~~  122 (234)
T d1xxla_          72 TAESLPFPDDSFDIITCRYAAHHF-SDVRKAVREVARVLKQDGRFLLVDHYA  122 (234)
T ss_dssp             BTTBCCSCTTCEEEEEEESCGGGC-SCHHHHHHHHHHHEEEEEEEEEEEECB
T ss_pred             ccccccccccccceeeeeceeecc-cCHHHHHHHHHHeeCCCcEEEEEEcCC
Confidence            999999999999999999876665 788999999999999999999987643



>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure