Citrus Sinensis ID: 012592


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460
MEKFRKIPVNGTRWSTFKYLLVIELMGGIISKRESSRQPSFGSSSYSWNHHNYPQQPPYGQPSQEYAPQQYYATPSQSYSGRAPESTRKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLHHIGDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDEKFCNGFEEVLRRYRELVPHLRLAGPTSFAPIIEMAITIVEHSGGQYHVLVIIADGQVTRSVDTEHGQLSSQEKKTVEAIVKASEYPLSIILVGVGDGPWDMMREFDDNIPARAFDNFQFVNFTEIMSKNVDRSRKEAEFALAALMEIPSQYKAALEFNILGAQRGKAVDRVSLPPPQYGAASQNTPKTSRSSSFRPSAPSGHERVVGTAPPASSTSDNHVCPICLTDPKDMAFGCGHQTCCGCGQDLDLCPICRSFIQTRIKLY
ccccccccccccccEEEEEEEEEHHcccccccccccccccCCccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccHHHHHHHHHHHccccEEccEEEEEccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccEEECcccccccccHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccccHHHHHHHHHHHcccccccEEEEccccccccccccccccccccccccEEEEEcHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccc
******IPVNGTRWSTFKYLLVIELMG******************************************************************YSKIDDNYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLHHIGDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDEKFCNGFEEVLRRYRELVPHLRLAGPTSFAPIIEMAITIVEHSGGQYHVLVIIADGQVTRS*************KTVEAIVKASEYPLSIILVGVGDGPWDMMREFDDNIPARAFDNFQFVNFTEIMSKNVDRSRKEAEFALAALMEIPSQYKAALEFNILGAQRGKAVDRVSLPPP*****************************************NHVCPICLTDPKDMAFGCGHQTCCGCGQDLDLCPICRSFIQTRIKLY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKFRKIPVNGTRWSTFKYLLVIELMGGIISKRESSRQPSFGSSSYSWNHHNYPQQPPYGQPSQEYAPQQYYATPSQSYSGRAPESTRKLERKYSKIDDNYHSLEQVTDALARAGLESSNLIVGIDFTKSNEWTGARSFQRRSLHHIGDDQNPYEQAISIIGKTLSSFDEDNLIPCFGFGDASTHDQEVFSFYPDEKFCNGFEEVLRRYRELVPHLRLAGPTSFAPIIEMAITIVEHSGGQYHVLVIIADGQVTRSVDTEHGQLSSQEKKTVEAIVKASEYPLSIILVGVGDGPWDMMREFDDNIPARAFDNFQFVNFTEIMSKNVDRSRKEAEFALAALMEIPSQYKAALEFNILGAQRGKAVDRVSLPPPQYGAASQNTPKTSRSSSFRPSAPSGHERVVGTAPPASSTSDNHVCPICLTDPKDMAFGCGHQTCCGCGQDLDLCPICRSFIQTRIKLY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase RGLG2 E3 ubiquitin-protein ligase that mediates the formation of 'Lys-63'-linked multiubiquitin chains. Regulates apical dominance by acting on the auxin transport proteins abundance.confidentQ9LY87

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EA5, chain A
Confidence level:confident
Coverage over the Query: 411-460
View the alignment between query and template
View the model in PyMOL
Template: 4B4T, chain W
Confidence level:probable
Coverage over the Query: 116-139,150-255,267-318
View the alignment between query and template
View the model in PyMOL
Template: 1JEY, chain A
Confidence level:probable
Coverage over the Query: 115-296
View the alignment between query and template
View the model in PyMOL