Citrus Sinensis ID: 012618

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460

MGQRMSCRERSESALFVAVENGDLQMIEAMVEADPTVLGMTSGYGKQSALHLAAAYGQIEVLSMLLDQFFLYTNTDALNRYKQTPLMVAAMNGKLSCVKKLIESGAFILNFDSLQGRTCLHYAAYYGHSDCLQALLTAARTSPVANTWGFSRFVNIRDESGATPLHLAARQGWSECVHTLLDNGALACSSTGGNGYPGSTPLHFAARGGSLECIRELLAWGADRVQPDAFGRIPYAIALKYKHQACAALLNPSSAEPLVWPLQLRNMTDLNPEAKELLEKALMESNEEREKAILNETICSVPSTSPSDAEVDDNTSEASDVELCCICFENLCTIEIKPCGHQMCAHCTLALCCHKKPDIITAVPEVPACPFCRCSIANLVAARIINSATELDISPSKPRISRKSWNSSEGSSSSFKGLSAMGSFVKIAGRSSGRVTAECNEASDKLLHMDARDSPSCHVS

ccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHccccHHHHHHHHcccccccccccccccHHHHHHHHcccccccCCcccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccHHccccccccccc

*********RSESALFVAVENGDLQMIEAMVEADPTVLGMTSGYGKQSALHLAAAYGQIEVLSMLLDQFFLYTNTDALNRYKQTPLMVAAMNGKLSCVKKLIESGAFILNFDSLQGRTCLHYAAYYGHSDCLQALLTAARTSPVANTWGFSRFVNIRDESGATPLHLAARQGWSECVHTLLDNGALACSSTGGNGYPGSTPLHFAARGGSLECIRELLAWGADRVQPDAFGRIPYAIALKYKHQACAALLNPSSAEPLVWPLQLRNMTDLNPEAKELLEKALMESNEEREKAILNETICSVPSTSPSDAEVDDNTSEASDVELCCICFENLCTIEIKPCGHQMCAHCTLALCCHKKPDIITAVPEVPACPFCRCSIANLVAARIINSATELDI************************************************ASDKLLHMDARD*******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGQRMSCRERSESALFVAVENGDLQMIEAMVEADPTVLGMTSGYGKQSALHLAAAYGQIEVLSMLLDQFFLYTNTDALNRYKQTPLMVAAMNGKLSCVKKLIESGAFILNFDSLQGRTCLHYAAYYGHSDCLQALLTAARTSPVANTWGFSRFVNIRDESGATPLHLAARQGWSECVHTLLDNGALACSSTGGNGYPGSTPLHFAARGGSLECIRELLAWGADRVQPDAFGRIPYAIALKYKHQACAALLNPSSAEPLVWPLQLRNMTDLNPEAxxxxxxxxxxxxxxxxxxxxxETICSVPSTSPSDAEVDDNTSEASDVELCCICFENLCTIEIKPCGHQMCAHCTLALCCHKKPDIITAVPEVPACPFCRCSIANLVAARIINSATELDISPSKPRISRKSWNSSEGSSSSFKGLSAMGSFVKIAGRSSGRVTAECNEASDKLLHMDARDSPSCHVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
E3 ubiquitin-protein ligase XB3	E3 ubiquitin-protein ligase required for full accumulation of the LRR receptor kinase XA21 and XA21-mediated disease resistance. Binding to XA21 may stabilize the receptor kinase and maintain its protein level. Autoubiquitinated in vitro.	probable	Q65XV2
Putative E3 ubiquitin-protein ligase XBAT31	No E3 ubiquitin-protein ligase activity observed when associated with the E2 enzyme UBC8 in vitro.	probable	Q94B55

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OY3, chain D
Confidence level:very confident
Coverage over the Query: 42-258,269-271
View the alignment between query and template
View the model in PyMOL

Template: 1OY3, chain D
Confidence level:very confident
Coverage over the Query: 7-141,154-228
View the alignment between query and template
View the model in PyMOL

Template: 2VJE, chain B
Confidence level:confident
Coverage over the Query: 320-355,367-384
View the alignment between query and template
View the model in PyMOL

Template: 4EPO, chain C
Confidence level:probable
Coverage over the Query: 314-358,369-390
View the alignment between query and template
View the model in PyMOL