Citrus Sinensis ID: 012647

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFEGVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENKEYLPIEGLAAFNKVTAELLFGADNSVLKEQRVATVQGLSGTGSLRLAAALIERYFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYDPKTVGLDFEGMIADIKAAPGGSFILLHGCAHNPTGIDPTPEQWEKIADVIQEKNHIPFFDVAYQGFASGSLDNDASSVRLFATRGMELLVAQSYSKNLGLYAERIGAMNVVCSSSDLAARVKSQLKRLARPMYSNPPVHGARIVANVVGNPALFDEWKAEMEMMAGRIKNVRQKLFDSLSAKDKSGKDWSFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS
ccccccccccccccccHHHHHHcccccccccccccccccHHHccccccccccccccccccccccccccccccHHHHHHcccccccccccccCECccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccHHHccccEEEEEccccHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHcccccccccccccccccccHHHHHHHHHccccccEEEEEccccccccccccHHHHHHHHHHHHHcccccEEEcccccccccccHHHHHHHHHHHHccccEEEEEccccccccccccccEEEEEcccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHccEEEEcccccEEccccccccHHHHHHHHHHHHHHcc
************************************************SM******SRFEGVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENKEYLPIEGLAAFNKVTAELLFGADNSVLKEQRVATVQGLSGTGSLRLAAALIERYFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYDPKTVGLDFEGMIADIKAAPGGSFILLHGCAHNPTGIDPTPEQWEKIADVIQEKNHIPFFDVAYQGFASGSLDNDASSVRLFATRGMELLVAQSYSKNLGLYAERIGAMNVVCSSSDLAARVKSQLKRLARPMYSNPPVHGARIVANVVGNPALFDEWKAEMEMMAGRIKNVRQKLFDSLSAKDKSGKDWSFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFEGVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENKEYLPIEGLAAFNKVTAELLFGADNSVLKEQRVATVQGLSGTGSLRLAAALIERYFPGAKVLISSPTWGNHKNIFNDARVPWSEYRYYDPKTVGLDFEGMIADIKAAPGGSFILLHGCAHNPTGIDPTPEQWEKIADVIQEKNHIPFFDVAYQGFASGSLDNDASSVRLFATRGMELLVAQSYSKNLGLYAERIGAMNVVCSSSDLAARVKSQLKRLARPMYSNPPVHGARIVANVVGNPALFDEWKAEMEMMAGRIKNVRQKLFDSLSAKDKSGKDWSFILRQIGMFSFTGLNKAQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aspartate aminotransferase, chloroplastic Important for the metabolism of amino acids and Krebs-cycle related organic acids. In plants, it is involved in nitrogen metabolism and in aspects of carbon and energy metabolism.confidentP46248
Aspartate aminotransferase, mitochondrial Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids.probableP12344
Aspartate aminotransferase, mitochondrial Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids.probableP05202

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.6.-.-Transferring nitrogenous groups.probable
2.6.1.-Transaminases (aminotransferases).probable
2.6.1.1Aspartate transaminase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MEB, chain A
Confidence level:very confident
Coverage over the Query: 56-458
View the alignment between query and template
View the model in PyMOL