Citrus Sinensis ID: 012667

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46

MVAERFIAAVRESSNPPMKMSFFINYNEEDILKQATESTLRYKKGEPISVLDGVLIAVKDEIDCSPYPTTGGTKWLHKVRPCTGDACCVMRLRLCGAILVGKTNMHELGAGTSGINPHYGVARNPYDPSKITGGSSSGSAAVVAAGLCPVALGVDGGGSVRMPAALCGVVGFKPTFGRIPLSGVLPLNWTVGMVGILAATVEDALVVYAAINGPLPSQQPTVSLPKVSFPLLKSATSISAIKLAKYDAWFNDCSDDIRVCCSRAVDKLCERYGWKVVEVTIPNIEVMRLAHYLTIGSECSTSLSSYLQKINCSDQGWDARVALSVYGSFSSQEYIKAQKIRNHQMQIHRNVFAKADVIVVPTTGVTAYEIKDDALKTGELDYIYGAALVRYQIAGNFLGLPAVTVPVGYDTAGLPIGLQFIGKPWSEPTLMHIAFAMQALCISEFRKPKVFHDLLYKE

cHHHHHHHHHHHHccccccccEEEEccHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccccccccHHHHHccccccccccHHHHHHHHHccccEEccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHHcccccccccHHHHHHHccc

MVAERFIAAVRESSNPPMKMSFFINYNEEDILKQATESTLRYKKGEPISVLDGVLIAVKDEIDCSPYPTTGGTKWLHKVRPCTGDACCVMRLRLCGAILVGKTNMHELGAGTSGINPHYGVARNPYDPSKITGGSS***AAVVAAGLCPVALGVDGGGSVRMPAALCGVVGFKPTFGRIPLSGVLPLNWTVGMVGILAATVEDALVVYAAINGPLPSQQPTVSLPKVSFPLLKSATSISAIKLAKYDAWFNDCSDDIRVCCSRAVDKLCERYGWKVVEVTIPNIEVMRLAHYLTIGSECSTSLSSYLQKINCSDQGWDARVALSVYGSFSSQEYIKAQKIRNHQMQIHRNVFAKADVIVVPTTGVTAYEIKDDALKTGELDYIYGAALVRYQIAGNFLGLPAVTVPVGYDTAGLPIGLQFIGKPWSEPTLMHIAFAMQALCISEFRKPKVFHDLLYK*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Glutamyl-tRNA(Gln) amidotransferase subunit A	Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).	probable	A9N8Z4
Glutamyl-tRNA(Gln) amidotransferase subunit A	Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).	probable	B3QQF5
Glutamyl-tRNA(Gln) amidotransferase subunit A	Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).	probable	Q5N0K5

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A2Q, chain A
Confidence level:very confident
Coverage over the Query: 1-450
View the alignment between query and template
View the model in PyMOL