Citrus Sinensis ID: 012711
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 458 | 2.2.26 [Sep-21-2011] | |||||||
| Q5RBU7 | 496 | Lysosomal Pro-X carboxype | yes | no | 0.930 | 0.858 | 0.362 | 4e-87 | |
| P42785 | 496 | Lysosomal Pro-X carboxype | yes | no | 0.930 | 0.858 | 0.360 | 1e-86 | |
| Q7TMR0 | 491 | Lysosomal Pro-X carboxype | yes | no | 0.941 | 0.877 | 0.368 | 3e-86 | |
| Q2TA14 | 499 | Lysosomal Pro-X carboxype | yes | no | 0.910 | 0.835 | 0.366 | 9e-84 | |
| Q9UHL4 | 492 | Dipeptidyl peptidase 2 OS | no | no | 0.921 | 0.857 | 0.341 | 1e-67 | |
| Q9EPB1 | 500 | Dipeptidyl peptidase 2 OS | no | no | 0.925 | 0.848 | 0.335 | 3e-66 | |
| Q9ET22 | 506 | Dipeptidyl peptidase 2 OS | no | no | 0.925 | 0.837 | 0.335 | 1e-60 | |
| P34676 | 507 | Prolyl carboxy peptidase | yes | no | 0.908 | 0.820 | 0.309 | 2e-47 | |
| Q9NQE7 | 514 | Thymus-specific serine pr | no | no | 0.890 | 0.793 | 0.304 | 2e-39 | |
| Q9QXE5 | 509 | Thymus-specific serine pr | no | no | 0.895 | 0.805 | 0.291 | 4e-38 |
| >sp|Q5RBU7|PCP_PONAB Lysosomal Pro-X carboxypeptidase OS=Pongo abelii GN=PRCP PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 322 bits (824), Expect = 4e-87, Method: Compositional matrix adjust.
Identities = 165/455 (36%), Positives = 265/455 (58%), Gaps = 29/455 (6%)
Query: 8 KDFKTFFYTQTLDHFNYRPDSYATFQQRYVINFKHWGGSNSSAPIFVYLGAEGSLDEDLD 67
K++ ++ Q +DHF + ++ TF QRY++ K+W + S I Y G EG + +
Sbjct: 46 KNYSVLYFQQKVDHFGF--NTVKTFNQRYLVADKYWKKNGGS--ILFYTGNEGDIIWFCN 101
Query: 68 VAGFLPDNAPRFKALLVYIEHRYYGKSVPFGSREEAMKNASTLGYFNSAQAIADYADVLL 127
GF+ D A KA+LV+ EHRYYG+S+PFG + K++ L + S QA+AD+A+++
Sbjct: 102 NTGFMWDVAEELKAMLVFAEHRYYGESLPFG--DNTFKDSRHLNFLTSEQALADFAELIK 159
Query: 128 HIKKKY-SAERSPSIVVGGSYGGMLAAWFRLKYPHIALGALASSAPILYFHDTAPQVGYY 186
H+K+ AE P I +GGSYGGMLAAWFR+KYPH+ +GALA+SAPI F D P +
Sbjct: 160 HLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFM 219
Query: 187 TIVTKDFKETSQSCYETVRKSWDEIRKVASRPNGLSMLSKKFRTCKPL--KKTSELEDFL 244
IVT DF+++ C E++R+SWD I ++++ +GL L+ C PL + L+D++
Sbjct: 220 KIVTTDFRKSGPHCSESIRRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWI 279
Query: 245 DSLYTDVAQYDDP---------PTYPLSIVCGGIDGAPTGID--VLGKIFKGVVA---YK 290
+ ++A D P P +P+ +VC + P D +L IF+ + Y
Sbjct: 280 SETWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLKN-PNVSDSLLLQNIFQALNVYYNYS 338
Query: 291 GNRSCYDMDEYIRPTETNVGWRWQTCSEMVMPIGHGHKDTMFPPAPFDLNRFTKDCEGTF 350
G C ++ E + +GW +Q C+E+VMP D MF P ++L + DC +
Sbjct: 339 GQVKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQW 398
Query: 351 GVKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRDPYSTGGVLGNISDSVVAISTVNG 410
GV+P+P W+TT YGG+++ +NI+FSNG DP+S GGV +I+D++VA++ G
Sbjct: 399 GVRPRPSWITTMYGGKNIS-----SHTNIVFSNGELDPWSGGGVTKDITDTLVAVTISEG 453
Query: 411 SHCLDILPESKSDPQWLVMQRKAEIKIIEEWIAKY 445
+H LD+ ++ DP +++ R E++ ++ WI +
Sbjct: 454 AHHLDLRTKNALDPTSVLLARSLEVRHMKNWIRDF 488
|
Cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH. Pongo abelii (taxid: 9601) EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: 2 |
| >sp|P42785|PCP_HUMAN Lysosomal Pro-X carboxypeptidase OS=Homo sapiens GN=PRCP PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q7TMR0|PCP_MOUSE Lysosomal Pro-X carboxypeptidase OS=Mus musculus GN=Prcp PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q2TA14|PCP_BOVIN Lysosomal Pro-X carboxypeptidase OS=Bos taurus GN=PRCP PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9UHL4|DPP2_HUMAN Dipeptidyl peptidase 2 OS=Homo sapiens GN=DPP7 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q9EPB1|DPP2_RAT Dipeptidyl peptidase 2 OS=Rattus norvegicus GN=Dpp7 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9ET22|DPP2_MOUSE Dipeptidyl peptidase 2 OS=Mus musculus GN=Dpp7 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|P34676|PCP5_CAEEL Prolyl carboxy peptidase like protein 5 OS=Caenorhabditis elegans GN=pcp-5 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9NQE7|TSSP_HUMAN Thymus-specific serine protease OS=Homo sapiens GN=PRSS16 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9QXE5|TSSP_MOUSE Thymus-specific serine protease OS=Mus musculus GN=Prss16 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 458 | ||||||
| 225436405 | 510 | PREDICTED: lysosomal Pro-X carboxypeptid | 0.973 | 0.874 | 0.705 | 0.0 | |
| 147792728 | 502 | hypothetical protein VITISV_018664 [Viti | 0.973 | 0.888 | 0.705 | 0.0 | |
| 297734875 | 975 | unnamed protein product [Vitis vinifera] | 0.973 | 0.457 | 0.705 | 0.0 | |
| 356541970 | 509 | PREDICTED: lysosomal Pro-X carboxypeptid | 0.982 | 0.884 | 0.697 | 0.0 | |
| 225436403 | 503 | PREDICTED: lysosomal Pro-X carboxypeptid | 0.967 | 0.880 | 0.697 | 0.0 | |
| 255565527 | 517 | Lysosomal Pro-X carboxypeptidase, putati | 0.975 | 0.864 | 0.702 | 0.0 | |
| 359479403 | 503 | PREDICTED: LOW QUALITY PROTEIN: lysosoma | 0.960 | 0.874 | 0.710 | 0.0 | |
| 225436410 | 505 | PREDICTED: lysosomal Pro-X carboxypeptid | 0.960 | 0.871 | 0.696 | 0.0 | |
| 297734878 | 624 | unnamed protein product [Vitis vinifera] | 0.960 | 0.705 | 0.696 | 0.0 | |
| 224109994 | 446 | predicted protein [Populus trichocarpa] | 0.965 | 0.991 | 0.716 | 0.0 |
| >gi|225436405|ref|XP_002271797.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 692 bits (1786), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 316/448 (70%), Positives = 374/448 (83%), Gaps = 2/448 (0%)
Query: 9 DFKTFFYTQTLDHFNYRPDSYATFQQRYVINFKHWGGSNSSAPIFVYLGAEGSLDEDLDV 68
DF+TFFY QTLDHFNYRP+SY TFQQRYV+NFK+WGG+N+SAPIF YLGAE +LD DL
Sbjct: 61 DFQTFFYNQTLDHFNYRPESYYTFQQRYVMNFKYWGGANASAPIFAYLGAEAALDFDLTG 120
Query: 69 AGFLPDNAPRFKALLVYIEHRYYGKSVPFGSREEAMKNASTLGYFNSAQAIADYADVLLH 128
GF DNA +FKALLVYIEHRYYG+S+PFGSREEA+KNAST GYFNSAQAIADYA+VL +
Sbjct: 121 VGFPVDNALQFKALLVYIEHRYYGQSIPFGSREEALKNASTRGYFNSAQAIADYAEVLEY 180
Query: 129 IKKKYSAERSPSIVVGGSYGGMLAAWFRLKYPHIALGALASSAPILYFHDTAPQVGYYTI 188
IKKK AE SP IV+GGSYGGMLA+WFRLKYPH+ALGALASSAPILYF D PQ GYY+I
Sbjct: 181 IKKKLLAENSPVIVIGGSYGGMLASWFRLKYPHVALGALASSAPILYFDDITPQNGYYSI 240
Query: 189 VTKDFKETSQSCYETVRKSWDEIRKVASRPNGLSMLSKKFRTCKPLKKTSELEDFLDSLY 248
VTKDF+E S+SCY T+R+SW EI +VAS PNGLS+LSKKFRTC L K++EL+D+L+++Y
Sbjct: 241 VTKDFREASESCYSTIRESWSEIDRVASEPNGLSILSKKFRTCAELNKSNELKDYLETMY 300
Query: 249 TDVAQYDDPPTYPLSIVCGGIDGAPTGIDVLGKIFKGVVAYKGNRSCYDMDEYIRPTETN 308
AQY+ PP YP+++VCGGIDGAP G D+L +IF GVVAY+GN SCY+ + PTET+
Sbjct: 301 AVAAQYNHPPRYPVTVVCGGIDGAPEGSDILSRIFAGVVAYRGNSSCYNTS--VNPTETS 358
Query: 309 VGWRWQTCSEMVMPIGHGHKDTMFPPAPFDLNRFTKDCEGTFGVKPKPHWVTTYYGGRDL 368
GWRWQTCSEMVMPIG G DTMFPP+PF+L F + C + V P+PHW+TTYYGG D+
Sbjct: 359 EGWRWQTCSEMVMPIGRGDNDTMFPPSPFNLTTFIQACTSLYDVPPRPHWITTYYGGHDI 418
Query: 369 KLILHRFGSNIIFSNGLRDPYSTGGVLGNISDSVVAISTVNGSHCLDILPESKSDPQWLV 428
KLILHRF SNIIFSNGLRDPYS+ GVL NIS +V+AI TVNGSHCLDILP +DP+WL+
Sbjct: 419 KLILHRFASNIIFSNGLRDPYSSAGVLKNISHTVLAIHTVNGSHCLDILPAKSTDPEWLI 478
Query: 429 MQRKAEIKIIEEWIAKYQNDLLEFKEET 456
MQRK E++IIE WIA+Y DL ++ T
Sbjct: 479 MQRKTEVEIIESWIAQYHADLDATRKRT 506
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147792728|emb|CAN64374.1| hypothetical protein VITISV_018664 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297734875|emb|CBI17109.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356541970|ref|XP_003539445.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225436403|ref|XP_002271733.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255565527|ref|XP_002523754.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis] gi|223537058|gb|EEF38694.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359479403|ref|XP_003632268.1| PREDICTED: LOW QUALITY PROTEIN: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225436410|ref|XP_002271961.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297734878|emb|CBI17112.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224109994|ref|XP_002333168.1| predicted protein [Populus trichocarpa] gi|222835051|gb|EEE73500.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 458 | ||||||
| TAIR|locus:2172671 | 502 | AT5G22860 [Arabidopsis thalian | 0.962 | 0.878 | 0.595 | 1.4e-151 | |
| TAIR|locus:2169945 | 515 | AT5G65760 [Arabidopsis thalian | 0.910 | 0.809 | 0.474 | 2.1e-107 | |
| TAIR|locus:2047495 | 494 | AT2G24280 "AT2G24280" [Arabido | 0.969 | 0.898 | 0.451 | 5.7e-107 | |
| UNIPROTKB|F1STV0 | 493 | PRCP "Uncharacterized protein" | 0.897 | 0.833 | 0.389 | 3.2e-81 | |
| UNIPROTKB|F1NWF2 | 433 | PRCP "Uncharacterized protein" | 0.862 | 0.912 | 0.409 | 2.9e-80 | |
| MGI|MGI:1919711 | 491 | Prcp "prolylcarboxypeptidase ( | 0.899 | 0.839 | 0.378 | 7.9e-78 | |
| UNIPROTKB|P42785 | 496 | PRCP "Lysosomal Pro-X carboxyp | 0.899 | 0.830 | 0.367 | 1.3e-77 | |
| RGD|1307842 | 493 | Prcp "prolylcarboxypeptidase ( | 0.895 | 0.831 | 0.384 | 2.7e-77 | |
| UNIPROTKB|F1PWK3 | 497 | PRCP "Uncharacterized protein" | 0.895 | 0.824 | 0.379 | 2.1e-75 | |
| UNIPROTKB|F1MAU4 | 499 | PRCP "Lysosomal Pro-X carboxyp | 0.871 | 0.799 | 0.377 | 7.3e-75 |
| TAIR|locus:2172671 AT5G22860 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1479 (525.7 bits), Expect = 1.4e-151, P = 1.4e-151
Identities = 264/443 (59%), Positives = 336/443 (75%)
Query: 9 DFKTFFYTQTLDHFNYRPDSYATFQQRYVINFKHWGGSNSSAPIFVYLGAEGSLDEDLDV 68
+ K +++ QTLDHF + P+SY TFQQRY I+ HWGG+ ++API +LG E SLD DL
Sbjct: 53 NLKMYYFNQTLDHFTFTPESYMTFQQRYAIDSTHWGGAKANAPILAFLGEESSLDSDLAA 112
Query: 69 AGFLPDNAPRFKALLVYIEHRYYGKSVPFGSREEAMKNASTLGYFNSAQAIADYADVLLH 128
GFL DN PR ALLVYIEHRYYG+++PFGS EEA+KNASTLGY N+AQA+ADYA +LLH
Sbjct: 113 IGFLRDNGPRLNALLVYIEHRYYGETMPFGSAEEALKNASTLGYLNAAQALADYAAILLH 172
Query: 129 IKKKYSAERSPSIVVGGSYGGMLAAWFRLKYPHIALGALASSAPILYFHDTAPQVGYYTI 188
+K+KYS SP IV+GGSYGGMLAAWFRLKYPHIALGALASSAP+LYF DT P+ GYY I
Sbjct: 173 VKEKYSTNHSPIIVIGGSYGGMLAAWFRLKYPHIALGALASSAPLLYFEDTRPKFGYYYI 232
Query: 189 VTKDFKETSQSCYETVRKSWDEIRKVASRPNGLSMLSKKFRTCKPLKKTSELEDFLDSLY 248
VTK FKE S+ CY T+R SW EI +VA +PNGLS+LSK+F+TC PL + +++DFLD++Y
Sbjct: 233 VTKVFKEASERCYNTIRNSWIEIDRVAGKPNGLSILSKQFKTCAPLNGSFDIKDFLDTIY 292
Query: 249 TDVAQYDDPPTYPLSIVCGGIDGAPTG--IDVLGKIFKGVVAYKGNRSCYDMDEYIRPTE 306
+ QY+ P + ++ VC I+ P ++L +IF GVVA GNR+CYD + +PT
Sbjct: 293 AEAVQYNRGPNFWVAKVCNAINANPPNRRYNLLDRIFAGVVALVGNRTCYDTKMFAQPTN 352
Query: 307 TNVGWRWQTCSEMVMPIGHGHKDTMFPPAPFDLNRFTKDCEGTFGVKPKPHWVTTYYGGR 366
N+ WRWQ+CSE+VMP+G+ +DTMFP APF++ + C+ GV P+PHW+TTY+G +
Sbjct: 353 NNIAWRWQSCSEIVMPVGYDKQDTMFPTAPFNMTSYIDGCKSYHGVTPRPHWITTYFGIQ 412
Query: 367 DLKLILHRFGSNIIFSNGLRDPYSTGGVLGNISDSVVAISTVNGSHCLDILPESKSDPQW 426
++KLIL +FGSNIIFSNGL DPYS GGVL +ISD++VAI+T NGSHCLDI +SK DP+W
Sbjct: 413 EVKLILQKFGSNIIFSNGLSDPYSVGGVLEDISDTLVAITTKNGSHCLDITLKSKEDPEW 472
Query: 427 LVMQRXXXXXXXXXXXXXYQNDL 449
LV+QR YQNDL
Sbjct: 473 LVIQREKEIKVIDSWISTYQNDL 495
|
|
| TAIR|locus:2169945 AT5G65760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2047495 AT2G24280 "AT2G24280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1STV0 PRCP "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NWF2 PRCP "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919711 Prcp "prolylcarboxypeptidase (angiotensinase C)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P42785 PRCP "Lysosomal Pro-X carboxypeptidase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1307842 Prcp "prolylcarboxypeptidase (angiotensinase C)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PWK3 PRCP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MAU4 PRCP "Lysosomal Pro-X carboxypeptidase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q7TMR0 | PCP_MOUSE | 3, ., 4, ., 1, 6, ., 2 | 0.3689 | 0.9410 | 0.8778 | yes | no |
| Q2TA14 | PCP_BOVIN | 3, ., 4, ., 1, 6, ., 2 | 0.3664 | 0.9104 | 0.8356 | yes | no |
| Q5RBU7 | PCP_PONAB | 3, ., 4, ., 1, 6, ., 2 | 0.3626 | 0.9301 | 0.8588 | yes | no |
| P34676 | PCP5_CAEEL | 3, ., 4, ., -, ., - | 0.3098 | 0.9082 | 0.8205 | yes | no |
| P42785 | PCP_HUMAN | 3, ., 4, ., 1, 6, ., 2 | 0.3604 | 0.9301 | 0.8588 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 458 | |||
| pfam05577 | 433 | pfam05577, Peptidase_S28, Serine carboxypeptidase | 2e-79 | |
| pfam00291 | 295 | pfam00291, PALP, Pyridoxal-phosphate dependent enz | 0.001 | |
| pfam11144 | 403 | pfam11144, DUF2920, Protein of unknown function (D | 0.002 |
| >gnl|CDD|218645 pfam05577, Peptidase_S28, Serine carboxypeptidase S28 | Back alignment and domain information |
|---|
Score = 252 bits (646), Expect = 2e-79
Identities = 132/455 (29%), Positives = 190/455 (41%), Gaps = 63/455 (13%)
Query: 17 QTLDHFNYRPDSYATFQQRYVINFKHWGGSNSSAPIFVYLGAEGSLDEDLDVAGFLPDNA 76
Q LDHF+ P + TFQQRY N +H+ + PIF+ +G EG G D A
Sbjct: 1 QKLDHFD--PSNNRTFQQRYFYNDQHY---RNGGPIFLMIGGEGPESASWVRNGHWLDLA 55
Query: 77 PRFKALLVYIEHRYYGKSVPFGSREEAMKNASTLGYFNSAQAIADYADVLLHIKKKYS-A 135
F AL+ +EHR+YG+S P G + A+ L Y +S QA+AD A + + +K++
Sbjct: 56 KEFGALVFSLEHRFYGQSKPIGD----LSTAN-LRYLSSLQALADVASFIKAMNQKFNGL 110
Query: 136 ERSPSIVVGGSYGGMLAAWFRLKYPHIALGALASSAPILYFHDTAPQVGYYTIVTKDFKE 195
S I GGSY G LAAW R KYPH+ +GA+ASSAP+L D Y +V +
Sbjct: 111 SSSKWITFGGSYSGSLAAWARKKYPHLVVGAVASSAPLLAKVDF---KEYNMVVETSLAQ 167
Query: 196 TSQSCYETVRKSWDEIRKVASRPNGLSMLSKKFRTCKPLKKTSELEDF------LDSLYT 249
T CY+ V + E+ ++ G LSK + C PL T++L D + S +
Sbjct: 168 TGGECYDAVENGFAEVEELLLTKEGRQALSKLLQLCPPLNVTTDL-DILNFFSNIYSPFQ 226
Query: 250 DVAQYDDP-------PTYPLSIVCGGIDGAPTGIDVLGKIFKGVVAYKGNRSCY------ 296
V QY Y + +C + A T +L + N+
Sbjct: 227 GVVQYTYDGQGNSTLNGYSIPDLCKIMLNATTTDLILRVEVLIQLFNYLNQKSGNNSTMD 286
Query: 297 --------DMDEYIRPTETNVGWRWQTCSEMVMPI----GHGHKDTMFPPAPFDLNRFTK 344
+ + W WQTC+E G+G + P + F
Sbjct: 287 ISYQLANASYGDSSGSYADDRQWTWQTCTEFGWYQTTDSGNGPFGSPVP-----ASLFID 341
Query: 345 DCEGTFGVKPKPHWVTT-------YYGGRDLKLILHRFGSNIIFSNGLRDPYSTGGVLGN 397
C FG ++ YYGG D + +N++F NG DP+ G +
Sbjct: 342 MCMDVFGADYNSTKISLRVSATNYYYGGAD-----NPNATNVVFVNGDLDPWHALGKTDS 396
Query: 398 ISDSVVAISTVNGSHCLDILPESKSDPQWLVMQRK 432
SVV +HC D+ P SD L R
Sbjct: 397 TDSSVVPYLIPGAAHCADMYPARPSDSPELKAARA 431
|
These serine proteases include several eukaryotic enzymes such as lysosomal Pro-X carboxypeptidase, dipeptidyl-peptidase II, and thymus-specific serine peptidase. Length = 433 |
| >gnl|CDD|215840 pfam00291, PALP, Pyridoxal-phosphate dependent enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|220999 pfam11144, DUF2920, Protein of unknown function (DUF2920) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 458 | |||
| KOG2183 | 492 | consensus Prolylcarboxypeptidase (angiotensinase C | 100.0 | |
| KOG2182 | 514 | consensus Hydrolytic enzymes of the alpha/beta hyd | 100.0 | |
| PF05577 | 434 | Peptidase_S28: Serine carboxypeptidase S28; InterP | 100.0 | |
| PF05576 | 448 | Peptidase_S37: PS-10 peptidase S37; InterPro: IPR0 | 100.0 | |
| PLN02298 | 330 | hydrolase, alpha/beta fold family protein | 98.87 | |
| PLN02385 | 349 | hydrolase; alpha/beta fold family protein | 98.83 | |
| PRK00870 | 302 | haloalkane dehalogenase; Provisional | 98.75 | |
| TIGR01250 | 288 | pro_imino_pep_2 proline-specific peptidases, Bacil | 98.72 | |
| PF12697 | 228 | Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 | 98.65 | |
| PHA02857 | 276 | monoglyceride lipase; Provisional | 98.64 | |
| TIGR01249 | 306 | pro_imino_pep_1 proline iminopeptidase, Neisseria- | 98.64 | |
| TIGR02427 | 251 | protocat_pcaD 3-oxoadipate enol-lactonase. Members | 98.63 | |
| PLN02824 | 294 | hydrolase, alpha/beta fold family protein | 98.62 | |
| PRK10749 | 330 | lysophospholipase L2; Provisional | 98.59 | |
| TIGR01840 | 212 | esterase_phb esterase, PHB depolymerase family. Th | 98.57 | |
| TIGR02240 | 276 | PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer | 98.56 | |
| COG2267 | 298 | PldB Lysophospholipase [Lipid metabolism] | 98.55 | |
| TIGR03611 | 257 | RutD pyrimidine utilization protein D. This protei | 98.49 | |
| TIGR03056 | 278 | bchO_mg_che_rel putative magnesium chelatase acces | 98.48 | |
| TIGR03695 | 251 | menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene | 98.47 | |
| PRK03592 | 295 | haloalkane dehalogenase; Provisional | 98.45 | |
| PRK10673 | 255 | acyl-CoA esterase; Provisional | 98.45 | |
| PRK11126 | 242 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl | 98.41 | |
| KOG1455 | 313 | consensus Lysophospholipase [Lipid transport and m | 98.4 | |
| TIGR03343 | 282 | biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die | 98.39 | |
| PLN02211 | 273 | methyl indole-3-acetate methyltransferase | 98.38 | |
| PLN02511 | 388 | hydrolase | 98.38 | |
| PLN02965 | 255 | Probable pheophorbidase | 98.37 | |
| PRK08775 | 343 | homoserine O-acetyltransferase; Provisional | 98.36 | |
| PF00561 | 230 | Abhydrolase_1: alpha/beta hydrolase fold A web pag | 98.33 | |
| TIGR01607 | 332 | PST-A Plasmodium subtelomeric family (PST-A). Thes | 98.31 | |
| KOG2564 | 343 | consensus Predicted acetyltransferases and hydrola | 98.3 | |
| PLN02894 | 402 | hydrolase, alpha/beta fold family protein | 98.29 | |
| PLN02652 | 395 | hydrolase; alpha/beta fold family protein | 98.27 | |
| PLN03084 | 383 | alpha/beta hydrolase fold protein; Provisional | 98.25 | |
| TIGR01738 | 245 | bioH putative pimeloyl-BioC--CoA transferase BioH. | 98.24 | |
| TIGR03101 | 266 | hydr2_PEP hydrolase, ortholog 2, exosortase system | 98.24 | |
| KOG4178 | 322 | consensus Soluble epoxide hydrolase [Lipid transpo | 98.22 | |
| PLN02679 | 360 | hydrolase, alpha/beta fold family protein | 98.2 | |
| PRK10349 | 256 | carboxylesterase BioH; Provisional | 98.19 | |
| PRK10566 | 249 | esterase; Provisional | 98.18 | |
| PRK10985 | 324 | putative hydrolase; Provisional | 98.17 | |
| PRK03204 | 286 | haloalkane dehalogenase; Provisional | 98.13 | |
| PLN02578 | 354 | hydrolase | 98.07 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 98.07 | |
| PRK06489 | 360 | hypothetical protein; Provisional | 98.07 | |
| PLN03087 | 481 | BODYGUARD 1 domain containing hydrolase; Provision | 98.04 | |
| PRK07581 | 339 | hypothetical protein; Validated | 98.0 | |
| TIGR03100 | 274 | hydr1_PEP hydrolase, ortholog 1, exosortase system | 98.0 | |
| PLN02980 | 1655 | 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi | 97.98 | |
| TIGR02821 | 275 | fghA_ester_D S-formylglutathione hydrolase. This m | 97.92 | |
| TIGR01392 | 351 | homoserO_Ac_trn homoserine O-acetyltransferase. Th | 97.91 | |
| TIGR00976 | 550 | /NonD putative hydrolase, CocE/NonD family. This m | 97.89 | |
| PRK05077 | 414 | frsA fermentation/respiration switch protein; Revi | 97.88 | |
| TIGR03230 | 442 | lipo_lipase lipoprotein lipase. Members of this pr | 97.85 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 97.8 | |
| cd00707 | 275 | Pancreat_lipase_like Pancreatic lipase-like enzyme | 97.75 | |
| PF00326 | 213 | Peptidase_S9: Prolyl oligopeptidase family This fa | 97.72 | |
| PF10503 | 220 | Esterase_phd: Esterase PHB depolymerase | 97.72 | |
| KOG4409 | 365 | consensus Predicted hydrolase/acyltransferase (alp | 97.71 | |
| TIGR01836 | 350 | PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth | 97.65 | |
| COG1506 | 620 | DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept | 97.65 | |
| KOG2382 | 315 | consensus Predicted alpha/beta hydrolase [General | 97.58 | |
| PTZ00472 | 462 | serine carboxypeptidase (CBP1); Provisional | 97.56 | |
| PLN02442 | 283 | S-formylglutathione hydrolase | 97.51 | |
| PRK10162 | 318 | acetyl esterase; Provisional | 97.48 | |
| PRK10115 | 686 | protease 2; Provisional | 97.46 | |
| PRK11460 | 232 | putative hydrolase; Provisional | 97.46 | |
| KOG4391 | 300 | consensus Predicted alpha/beta hydrolase BEM46 [Ge | 97.41 | |
| COG0596 | 282 | MhpC Predicted hydrolases or acyltransferases (alp | 97.4 | |
| TIGR03502 | 792 | lipase_Pla1_cef extracellular lipase, Pla-1/cef fa | 97.35 | |
| PF12695 | 145 | Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 | 97.33 | |
| PRK00175 | 379 | metX homoserine O-acetyltransferase; Provisional | 97.32 | |
| PF09752 | 348 | DUF2048: Uncharacterized conserved protein (DUF204 | 97.3 | |
| KOG1454 | 326 | consensus Predicted hydrolase/acyltransferase (alp | 97.26 | |
| PF07859 | 211 | Abhydrolase_3: alpha/beta hydrolase fold A web pag | 97.19 | |
| KOG1552 | 258 | consensus Predicted alpha/beta hydrolase [General | 97.17 | |
| PLN00021 | 313 | chlorophyllase | 97.11 | |
| PRK13604 | 307 | luxD acyl transferase; Provisional | 97.02 | |
| PLN02872 | 395 | triacylglycerol lipase | 96.94 | |
| PF00450 | 415 | Peptidase_S10: Serine carboxypeptidase; InterPro: | 96.84 | |
| PF00975 | 229 | Thioesterase: Thioesterase domain; InterPro: IPR00 | 96.71 | |
| KOG2281 | 867 | consensus Dipeptidyl aminopeptidases/acylaminoacyl | 96.6 | |
| cd00312 | 493 | Esterase_lipase Esterases and lipases (includes fu | 96.56 | |
| COG0657 | 312 | Aes Esterase/lipase [Lipid metabolism] | 96.55 | |
| PF05677 | 365 | DUF818: Chlamydia CHLPS protein (DUF818); InterPro | 96.4 | |
| PRK11071 | 190 | esterase YqiA; Provisional | 96.37 | |
| PF07819 | 225 | PGAP1: PGAP1-like protein; InterPro: IPR012908 The | 96.25 | |
| PF06500 | 411 | DUF1100: Alpha/beta hydrolase of unknown function | 96.19 | |
| PF00756 | 251 | Esterase: Putative esterase; InterPro: IPR000801 T | 96.14 | |
| KOG1838 | 409 | consensus Alpha/beta hydrolase [General function p | 96.1 | |
| PF10230 | 266 | DUF2305: Uncharacterised conserved protein (DUF230 | 96.0 | |
| PF02129 | 272 | Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam | 95.94 | |
| PF08538 | 303 | DUF1749: Protein of unknown function (DUF1749); In | 95.91 | |
| TIGR01838 | 532 | PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, | 95.81 | |
| COG3509 | 312 | LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda | 95.79 | |
| PF03403 | 379 | PAF-AH_p_II: Platelet-activating factor acetylhydr | 95.71 | |
| COG0429 | 345 | Predicted hydrolase of the alpha/beta-hydrolase fo | 95.69 | |
| PLN02209 | 437 | serine carboxypeptidase | 95.38 | |
| PF12146 | 79 | Hydrolase_4: Putative lysophospholipase; InterPro: | 95.34 | |
| COG4099 | 387 | Predicted peptidase [General function prediction o | 95.22 | |
| KOG2100 | 755 | consensus Dipeptidyl aminopeptidase [Posttranslati | 95.13 | |
| KOG1553 | 517 | consensus Predicted alpha/beta hydrolase BAT5 [Gen | 95.0 | |
| PF11144 | 403 | DUF2920: Protein of unknown function (DUF2920); In | 94.83 | |
| COG1770 | 682 | PtrB Protease II [Amino acid transport and metabol | 94.81 | |
| PRK06765 | 389 | homoserine O-acetyltransferase; Provisional | 94.8 | |
| PRK10439 | 411 | enterobactin/ferric enterobactin esterase; Provisi | 94.59 | |
| PLN02733 | 440 | phosphatidylcholine-sterol O-acyltransferase | 94.46 | |
| KOG2984 | 277 | consensus Predicted hydrolase [General function pr | 94.43 | |
| PLN03016 | 433 | sinapoylglucose-malate O-sinapoyltransferase | 94.41 | |
| COG1647 | 243 | Esterase/lipase [General function prediction only] | 94.19 | |
| COG2819 | 264 | Predicted hydrolase of the alpha/beta superfamily | 94.16 | |
| PRK05371 | 767 | x-prolyl-dipeptidyl aminopeptidase; Provisional | 93.86 | |
| PF06259 | 177 | Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR | 93.85 | |
| COG0627 | 316 | Predicted esterase [General function prediction on | 93.81 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 93.73 | |
| PF05448 | 320 | AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 | 93.7 | |
| COG2021 | 368 | MET2 Homoserine acetyltransferase [Amino acid tran | 93.54 | |
| COG0400 | 207 | Predicted esterase [General function prediction on | 93.51 | |
| PF01738 | 218 | DLH: Dienelactone hydrolase family; InterPro: IPR0 | 93.44 | |
| KOG1515 | 336 | consensus Arylacetamide deacetylase [Defense mecha | 93.29 | |
| PF02230 | 216 | Abhydrolase_2: Phospholipase/Carboxylesterase; Int | 93.28 | |
| PF12740 | 259 | Chlorophyllase2: Chlorophyllase enzyme; InterPro: | 93.02 | |
| COG4757 | 281 | Predicted alpha/beta hydrolase [General function p | 92.75 | |
| cd00741 | 153 | Lipase Lipase. Lipases are esterases that can hydr | 92.7 | |
| PF01764 | 140 | Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr | 92.68 | |
| PF00135 | 535 | COesterase: Carboxylesterase family The prints ent | 92.13 | |
| PF06342 | 297 | DUF1057: Alpha/beta hydrolase of unknown function | 91.67 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 91.67 | |
| PF03096 | 283 | Ndr: Ndr family; InterPro: IPR004142 This family c | 91.59 | |
| PF02450 | 389 | LCAT: Lecithin:cholesterol acyltransferase; InterP | 91.49 | |
| PF06821 | 171 | Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 | 91.49 | |
| PF11187 | 224 | DUF2974: Protein of unknown function (DUF2974); In | 91.42 | |
| COG3208 | 244 | GrsT Predicted thioesterase involved in non-riboso | 91.19 | |
| cd00519 | 229 | Lipase_3 Lipase (class 3). Lipases are esterases t | 91.07 | |
| COG2939 | 498 | Carboxypeptidase C (cathepsin A) [Amino acid trans | 90.72 | |
| PF08840 | 213 | BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term | 90.07 | |
| PLN02454 | 414 | triacylglycerol lipase | 90.03 | |
| PF05728 | 187 | UPF0227: Uncharacterised protein family (UPF0227); | 89.6 | |
| PLN02310 | 405 | triacylglycerol lipase | 89.49 | |
| PRK04940 | 180 | hypothetical protein; Provisional | 88.7 | |
| TIGR01839 | 560 | PHA_synth_II poly(R)-hydroxyalkanoic acid synthase | 88.53 | |
| KOG1282 | 454 | consensus Serine carboxypeptidases (lysosomal cath | 88.4 | |
| COG3319 | 257 | Thioesterase domains of type I polyketide synthase | 88.25 | |
| PLN03037 | 525 | lipase class 3 family protein; Provisional | 88.25 | |
| PLN02213 | 319 | sinapoylglucose-malate O-sinapoyltransferase/ carb | 88.07 | |
| KOG4667 | 269 | consensus Predicted esterase [Lipid transport and | 87.57 | |
| COG0412 | 236 | Dienelactone hydrolase and related enzymes [Second | 87.47 | |
| PF01674 | 219 | Lipase_2: Lipase (class 2); InterPro: IPR002918 Li | 87.28 | |
| KOG4627 | 270 | consensus Kynurenine formamidase [Amino acid trans | 84.83 | |
| PLN02571 | 413 | triacylglycerol lipase | 84.66 | |
| PLN02761 | 527 | lipase class 3 family protein | 84.2 | |
| PLN02162 | 475 | triacylglycerol lipase | 84.15 | |
| PF07519 | 474 | Tannase: Tannase and feruloyl esterase; InterPro: | 83.42 | |
| KOG2931 | 326 | consensus Differentiation-related gene 1 protein ( | 83.27 | |
| PLN02324 | 415 | triacylglycerol lipase | 82.63 | |
| KOG2369 | 473 | consensus Lecithin:cholesterol acyltransferase (LC | 82.38 | |
| PLN02753 | 531 | triacylglycerol lipase | 82.36 | |
| PLN00413 | 479 | triacylglycerol lipase | 82.09 | |
| COG2272 | 491 | PnbA Carboxylesterase type B [Lipid metabolism] | 82.02 | |
| PF03583 | 290 | LIP: Secretory lipase ; InterPro: IPR005152 This e | 81.33 | |
| KOG3847 | 399 | consensus Phospholipase A2 (platelet-activating fa | 81.11 | |
| PLN02408 | 365 | phospholipase A1 | 80.91 |
| >KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6e-108 Score=805.62 Aligned_cols=434 Identities=49% Similarity=0.922 Sum_probs=396.5
Q ss_pred CCCceeeEEEeecCCCCCCCCCCCeeeeEEEEeccccCCCCCCCCEEEEeCCCCCCCccccccccccCcccccCCeEEEE
Q 012711 7 FKDFKTFFYTQTLDHFNYRPDSYATFQQRYVINFKHWGGSNSSAPIFVYLGAEGSLDEDLDVAGFLPDNAPRFKALLVYI 86 (458)
Q Consensus 7 ~~~~~~~~f~Q~lDHf~~~~~~~~TF~QRY~~n~~~~~~~~~~~pi~l~~gge~~~~~~~~~~~~~~~~A~~~~a~~v~~ 86 (458)
--++++.||.|+||||++. ++.||.|||++|++||+++ +||||+|+|+||+++.+..++||++++|.+++|++|+.
T Consensus 42 ~~~ye~~yf~q~LDHFsF~--~~~tF~qRylin~~fw~~g--~gPIffYtGNEGdie~Fa~ntGFm~D~Ap~~~AllVFa 117 (492)
T KOG2183|consen 42 EYNYETRYFQQPLDHFSFT--DNKTFDQRYLINDDFWKKG--EGPIFFYTGNEGDIEWFANNTGFMWDLAPELKALLVFA 117 (492)
T ss_pred cccceeEEeeccccccccc--CccceeeEEEEecccccCC--CCceEEEeCCcccHHHHHhccchHHhhhHhhCceEEEe
Confidence 3469999999999999986 6799999999999999843 39999999999999999999999999999999999999
Q ss_pred ecceeecCCCCCChhhhhccCCccccCChHhhHHHHHHHHHHHHhhcCCCCCCEEEeccChhHHHHHHHHHhcCceEEEE
Q 012711 87 EHRYYGKSVPFGSREEAMKNASTLGYFNSAQAIADYADVLLHIKKKYSAERSPSIVVGGSYGGMLAAWFRLKYPHIALGA 166 (458)
Q Consensus 87 EhR~yG~S~P~~~~s~~~~~~~nl~ylt~~Qal~D~~~f~~~~~~~~~~~~~~~i~~GgSy~G~laa~~r~kyP~~~~~~ 166 (458)
||||||+|.||++- |+++.++|.|||+||||||.|++++++|.++....+|+|+|||||||+||||||+||||++.||
T Consensus 118 EHRyYGeS~PFG~~--s~k~~~hlgyLtseQALADfA~ll~~lK~~~~a~~~pvIafGGSYGGMLaAWfRlKYPHiv~GA 195 (492)
T KOG2183|consen 118 EHRYYGESLPFGSQ--SYKDARHLGYLTSEQALADFAELLTFLKRDLSAEASPVIAFGGSYGGMLAAWFRLKYPHIVLGA 195 (492)
T ss_pred ehhccccCCCCcch--hccChhhhccccHHHHHHHHHHHHHHHhhccccccCcEEEecCchhhHHHHHHHhcChhhhhhh
Confidence 99999999999976 5677789999999999999999999999998888999999999999999999999999999999
Q ss_pred EeccccccccccCCCCcchhhhhhccccccChhHHHHHHHHHHHHHHHhcCCchhHHHhhhccccCCCC-ChhhHHHHHH
Q 012711 167 LASSAPILYFHDTAPQVGYYTIVTKDFKETSQSCYETVRKSWDEIRKVASRPNGLSMLSKKFRTCKPLK-KTSELEDFLD 245 (458)
Q Consensus 167 iassapv~a~~~~~~~~~y~~~v~~~~~~~~~~C~~~i~~~~~~i~~l~~~~~~~~~l~~~F~~c~~l~-~~~~~~~f~~ 245 (458)
+|+||||+.+.|..+...|+..|+++|+.++++|.+.|++++..|+++..+++|++.|.+.|++|.+++ +..++.+|++
T Consensus 196 lAaSAPvl~f~d~vp~~~f~~ivT~~F~~as~~C~~~I~~sW~ai~~l~~~~nG~q~Ls~~f~lc~~ln~d~~~l~d~l~ 275 (492)
T KOG2183|consen 196 LAASAPVLYFEDTVPKDVFYRIVTRDFKDASPNCRNTIRKSWDAIDRLAAKDNGLQILSKAFKLCKPLNDDIGDLKDYLR 275 (492)
T ss_pred hhccCceEeecCCCCcchhhhHHHHHHHhhcHHHHHHHHHHHHHHHHHhcCcchHHHHHHHhhhcccccccHHHHHHHHH
Confidence 999999999999999899999999999999999999999999999999999999999999999999999 7788999999
Q ss_pred HHhhhh--hccCCC-------CCCccccccccccCCCCc-hhHHHHHHHhhh---hhcCcceeccCCC-CCCCCCCCCcc
Q 012711 246 SLYTDV--AQYDDP-------PTYPLSIVCGGIDGAPTG-IDVLGKIFKGVV---AYKGNRSCYDMDE-YIRPTETNVGW 311 (458)
Q Consensus 246 ~~~~~~--~Q~~~~-------~~~~i~~~C~~l~~~~~~-~~~l~~~~~~~~---~~~~~~~C~~~~~-~~~~~~~~R~W 311 (458)
+.+..+ |+|.+| |++||+++|+.|...... .+.+.++++.+. ||.++..|+|++. ......+.|.|
T Consensus 276 ea~~ylAMVdYPy~t~Fl~pLPa~PV~~~C~~i~~~~~~~~~ll~~i~a~~~~yyNytg~~~C~d~sd~t~~~~~d~~gW 355 (492)
T KOG2183|consen 276 EAYEYLAMVDYPYPTSFLAPLPAWPVKVVCKYINAPGPNDSDLLDRIFAAVNLYYNYTGSEKCYDISDPTYGSGLDDLGW 355 (492)
T ss_pred HHHHHHHHhcCCCCccccCcCCCCcHHHHHHHhccCCCChHHHHHHHHHHhhheeccCCCcchhccccccCCCCCCcCCC
Confidence 876654 455555 478999999999876544 667777776654 4568889999863 22345578999
Q ss_pred eeeeecccccccccCCCCCCCCCCCCChhhHHHHhhhhcCCCCCcchhhcccCCcchhhhccccccEEEEEcCCCCccCC
Q 012711 312 RWQTCSEMVMPIGHGHKDTMFPPAPFDLNRFTKDCEGTFGVKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRDPYST 391 (458)
Q Consensus 312 ~yQtCtE~G~~~~~~~~~~~f~~~~i~~~y~~~~C~~~Fg~~~~~~~~n~~yGG~~~~~~~~~~atnViFtnG~~DPW~~ 391 (458)
.||+|||+.|+.++++.+.||+..++|.+-+.+.|.+.||+.|+|+|++.+|||.++.. .|||||+||.+|||+.
T Consensus 356 ~~QaCtEmVMp~~~ng~~~mf~~~~fn~~~y~e~C~~~~~v~prP~wi~t~fgg~~l~~-----~SNiIFSNG~LDPWSG 430 (492)
T KOG2183|consen 356 PWQACTEMVMPMCSNGVDDMFPDCPFNSESYQEGCMQTFGVTPRPKWITTEFGGADLSA-----FSNIIFSNGLLDPWSG 430 (492)
T ss_pred chhhhhhhhhccccCCCcccCCCCCCCHHHHHHHHHHhcCCCCCCcceehhhccccchh-----hcceeeeCCCcCCccC
Confidence 99999999999999888899999999999999999999999999999999999988763 6999999999999999
Q ss_pred CCccCCCCCceEEEEeCCCcccCCCCCCCCCCcHHHHHHHHHHHHHHHHHHHHHHhcHhh
Q 012711 392 GGVLGNISDSVVAISTVNGSHCLDILPESKSDPQWLVMQRKAEIKIIEEWIAKYQNDLLE 451 (458)
Q Consensus 392 lgv~~~~~~~~~~i~i~g~~Hc~Dl~~~~~~Dp~~l~~aR~~i~~~i~~Wl~e~~~~~~~ 451 (458)
+||+++.+.++++++|++|+||.||+.+++.||++|+++|++|+++|++||++++..+.+
T Consensus 431 GGV~~nis~svvav~~k~GAHHlDLR~~~~~DP~~v~~aR~~Ei~iI~~WI~~~~r~~~~ 490 (492)
T KOG2183|consen 431 GGVLKNISDSVVAVTIKEGAHHLDLRASHPEDPESVVEARELEIQIIKKWIKEFYRVLGE 490 (492)
T ss_pred cCeeccccCcEEEEEecCCccceeccCCCCCCcHHHHHHHHHHHHHHHHHHHHHHHhhcc
Confidence 999999999999999999999999999999999999999999999999999998876543
|
|
| >KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
| >PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF05576 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR008761 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PLN02298 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN02385 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK00870 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A | Back alignment and domain information |
|---|
| >PHA02857 monoglyceride lipase; Provisional | Back alignment and domain information |
|---|
| >TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily | Back alignment and domain information |
|---|
| >TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >PLN02824 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK10749 lysophospholipase L2; Provisional | Back alignment and domain information |
|---|
| >TIGR01840 esterase_phb esterase, PHB depolymerase family | Back alignment and domain information |
|---|
| >TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >COG2267 PldB Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR03611 RutD pyrimidine utilization protein D | Back alignment and domain information |
|---|
| >TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PRK03592 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10673 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional | Back alignment and domain information |
|---|
| >KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >PLN02211 methyl indole-3-acetate methyltransferase | Back alignment and domain information |
|---|
| >PLN02511 hydrolase | Back alignment and domain information |
|---|
| >PLN02965 Probable pheophorbidase | Back alignment and domain information |
|---|
| >PRK08775 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) | Back alignment and domain information |
|---|
| >KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02894 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN02652 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN03084 alpha/beta hydrolase fold protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH | Back alignment and domain information |
|---|
| >TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02679 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK10349 carboxylesterase BioH; Provisional | Back alignment and domain information |
|---|
| >PRK10566 esterase; Provisional | Back alignment and domain information |
|---|
| >PRK10985 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK03204 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02578 hydrolase | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06489 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07581 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding | Back alignment and domain information |
|---|
| >TIGR02821 fghA_ester_D S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR00976 /NonD putative hydrolase, CocE/NonD family | Back alignment and domain information |
|---|
| >PRK05077 frsA fermentation/respiration switch protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03230 lipo_lipase lipoprotein lipase | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes | Back alignment and domain information |
|---|
| >PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification | Back alignment and domain information |
|---|
| >PF10503 Esterase_phd: Esterase PHB depolymerase | Back alignment and domain information |
|---|
| >KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit | Back alignment and domain information |
|---|
| >COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00472 serine carboxypeptidase (CBP1); Provisional | Back alignment and domain information |
|---|
| >PLN02442 S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PRK10162 acetyl esterase; Provisional | Back alignment and domain information |
|---|
| >PRK10115 protease 2; Provisional | Back alignment and domain information |
|---|
| >PRK11460 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] | Back alignment and domain information |
|---|
| >COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family | Back alignment and domain information |
|---|
| >PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A | Back alignment and domain information |
|---|
| >PRK00175 metX homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00021 chlorophyllase | Back alignment and domain information |
|---|
| >PRK13604 luxD acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02872 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] | Back alignment and domain information |
|---|
| >KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc | Back alignment and domain information |
|---|
| >COG0657 Aes Esterase/lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins | Back alignment and domain information |
|---|
| >PRK11071 esterase YqiA; Provisional | Back alignment and domain information |
|---|
| >PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] | Back alignment and domain information |
|---|
| >PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae | Back alignment and domain information |
|---|
| >KOG1838 consensus Alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] | Back alignment and domain information |
|---|
| >PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function | Back alignment and domain information |
|---|
| >TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I | Back alignment and domain information |
|---|
| >COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A | Back alignment and domain information |
|---|
| >COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02209 serine carboxypeptidase | Back alignment and domain information |
|---|
| >PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >COG4099 Predicted peptidase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] | Back alignment and domain information |
|---|
| >PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function | Back alignment and domain information |
|---|
| >COG1770 PtrB Protease II [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06765 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10439 enterobactin/ferric enterobactin esterase; Provisional | Back alignment and domain information |
|---|
| >PLN02733 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >KOG2984 consensus Predicted hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03016 sinapoylglucose-malate O-sinapoyltransferase | Back alignment and domain information |
|---|
| >COG1647 Esterase/lipase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria | Back alignment and domain information |
|---|
| >COG0627 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins | Back alignment and domain information |
|---|
| >COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0400 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway | Back alignment and domain information |
|---|
| >KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases | Back alignment and domain information |
|---|
| >PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 | Back alignment and domain information |
|---|
| >COG4757 Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd00741 Lipase Lipase | Back alignment and domain information |
|---|
| >PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] | Back alignment and domain information |
|---|
| >PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases | Back alignment and domain information |
|---|
| >PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 | Back alignment and domain information |
|---|
| >PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 | Back alignment and domain information |
|---|
| >PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic | Back alignment and domain information |
|---|
| >PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function | Back alignment and domain information |
|---|
| >COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd00519 Lipase_3 Lipase (class 3) | Back alignment and domain information |
|---|
| >COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH | Back alignment and domain information |
|---|
| >PLN02454 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO | Back alignment and domain information |
|---|
| >PLN02310 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PRK04940 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II | Back alignment and domain information |
|---|
| >KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN03037 lipase class 3 family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase | Back alignment and domain information |
|---|
| >KOG4667 consensus Predicted esterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] | Back alignment and domain information |
|---|
| >KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02571 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02761 lipase class 3 family protein | Back alignment and domain information |
|---|
| >PLN02162 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] | Back alignment and domain information |
|---|
| >KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] | Back alignment and domain information |
|---|
| >PLN02324 triacylglycerol lipase | Back alignment and domain information |
|---|
| >KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02753 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN00413 triacylglycerol lipase | Back alignment and domain information |
|---|
| >COG2272 PnbA Carboxylesterase type B [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases | Back alignment and domain information |
|---|
| >KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02408 phospholipase A1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 458 | ||||
| 3n2z_B | 446 | The Structure Of Human Prolylcarboxypeptidase At 2. | 5e-85 | ||
| 3jyh_A | 469 | Human Dipeptidyl Peptidase Dpp7 Length = 469 | 8e-65 | ||
| 4ebb_A | 472 | Structure Of Dpp2 Length = 472 | 7e-63 |
| >pdb|3N2Z|B Chain B, The Structure Of Human Prolylcarboxypeptidase At 2.80 Angstroms Resolution Length = 446 | Back alignment and structure |
|
| >pdb|3JYH|A Chain A, Human Dipeptidyl Peptidase Dpp7 Length = 469 | Back alignment and structure |
| >pdb|4EBB|A Chain A, Structure Of Dpp2 Length = 472 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Length = 446 | Back alignment and structure |
|---|
Score = 366 bits (939), Expect = e-123
Identities = 159/456 (34%), Positives = 257/456 (56%), Gaps = 27/456 (5%)
Query: 8 KDFKTFFYTQTLDHFNYRPDSYATFQQRYVINFKHWGGSNSSAPIFVYLGAEGSLDEDLD 67
K++ ++ Q +DHF ++ TF QRY++ K+W + I Y G EG + +
Sbjct: 1 KNYSVLYFQQKVDHFG--FNTVKTFNQRYLVADKYWKKNGG--SILFYTGNEGDIIWFCN 56
Query: 68 VAGFLPDNAPRFKALLVYIEHRYYGKSVPFGSREEAMKNASTLGYFNSAQAIADYADVLL 127
GF+ D A KA+LV+ EHRYYG+S+PFG + K++ L + S QA+AD+A+++
Sbjct: 57 NTGFMWDVAEELKAMLVFAEHRYYGESLPFGDN--SFKDSRHLNFLTSEQALADFAELIK 114
Query: 128 HIKKKYS-AERSPSIVVGGSYGGMLAAWFRLKYPHIALGALASSAPILYFHDTAPQVGYY 186
H+K+ AE P I +GGSYGGMLAAWFR+KYPH+ +GALA+SAPI F D P +
Sbjct: 115 HLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFM 174
Query: 187 TIVTKDFKETSQSCYETVRKSWDEIRKVASRPNGLSMLSKKFRTCKPLKKT--SELEDFL 244
IVT DF+++ C E++ +SWD I ++++ +GL L+ C PL L+D++
Sbjct: 175 KIVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWI 234
Query: 245 DSLYTDVAQYDDP---------PTYPLSIVCGGIDGAPTGIDVLGKIFKGVVA----YKG 291
+ ++A D P P +P+ +VC + +L + + Y G
Sbjct: 235 SETWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSG 294
Query: 292 NRSCYDMDEYIRPTETNVGWRWQTCSEMVMPIGHGHKDTMFPPAPFDLNRFTKDCEGTFG 351
C ++ E + +GW +Q C+E+VMP D MF P ++L + DC +G
Sbjct: 295 QVKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWG 354
Query: 352 VKPKPHWVTTYYGGRDLKLILHRFGSNIIFSNGLRDPYSTGGVLGNISDSVVAISTVNGS 411
V+P+P W+TT YGG++ +NI+FSNG DP+S GGV +I+D++VA++ G+
Sbjct: 355 VRPRPSWITTMYGGKN-----ISSHTNIVFSNGELDPWSGGGVTKDITDTLVAVTISEGA 409
Query: 412 HCLDILPESKSDPQWLVMQRKAEIKIIEEWIAKYQN 447
H LD+ ++ DP +++ R E++ ++ WI + +
Sbjct: 410 HHLDLRTKNALDPMSVLLARSLEVRHMKNWIRDFYD 445
|
| >3jyh_A Dipeptidyl-peptidase 2; structural genomics, structural genomics consortium, SGC, aminopeptidase, cleavage on PAIR of basic residues; HET: NAG BMA; 2.19A {Homo sapiens} PDB: 3n0t_A* Length = 469 | Back alignment and structure |
|---|
| >3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Length = 380 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 458 | |||
| 4ebb_A | 472 | Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 | 100.0 | |
| 3n2z_B | 446 | Lysosomal Pro-X carboxypeptidase; alpha/beta hydro | 100.0 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 99.03 | |
| 4dnp_A | 269 | DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu | 98.94 | |
| 3pe6_A | 303 | Monoglyceride lipase; alpha-beta hydrolase fold, 2 | 98.94 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 98.92 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 98.9 | |
| 1azw_A | 313 | Proline iminopeptidase; aminopeptidase, serine pro | 98.89 | |
| 1wm1_A | 317 | Proline iminopeptidase; complex with inhibitor, hy | 98.87 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 98.87 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 98.86 | |
| 3pfb_A | 270 | Cinnamoyl esterase; alpha/beta hydrolase fold, hyd | 98.86 | |
| 3hju_A | 342 | Monoglyceride lipase; alpha/beta hydrolase, hydrol | 98.84 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 98.83 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 98.83 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 98.82 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 98.82 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 98.81 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 98.81 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 98.81 | |
| 3ibt_A | 264 | 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, | 98.8 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 98.79 | |
| 3dqz_A | 258 | Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl | 98.79 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 98.79 | |
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 98.79 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 98.77 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 98.77 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 98.77 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 98.76 | |
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 98.75 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 98.74 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 98.74 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 98.74 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 98.74 | |
| 3llc_A | 270 | Putative hydrolase; structural genomics, joint cen | 98.73 | |
| 2wfl_A | 264 | Polyneuridine-aldehyde esterase; alkaloid metaboli | 98.73 | |
| 2psd_A | 318 | Renilla-luciferin 2-monooxygenase; alpha/beta-hydr | 98.72 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 98.71 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 98.71 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 98.71 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 98.71 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 98.7 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 98.7 | |
| 2o2g_A | 223 | Dienelactone hydrolase; YP_324580.1, structural ge | 98.7 | |
| 3sty_A | 267 | Methylketone synthase 1; alpha/beta hydrolase, dec | 98.69 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 98.69 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 98.68 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 98.68 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 98.67 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 98.67 | |
| 1k8q_A | 377 | Triacylglycerol lipase, gastric; APHA beta hydrola | 98.67 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 98.67 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 98.67 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 98.67 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 98.66 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 98.65 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 98.65 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 98.65 | |
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 98.65 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 98.65 | |
| 2h1i_A | 226 | Carboxylesterase; structural genomics, PSI-2, prot | 98.65 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 98.64 | |
| 3c6x_A | 257 | Hydroxynitrilase; atomic resolution, hydroxynitril | 98.64 | |
| 4fbl_A | 281 | LIPS lipolytic enzyme; thermostable, structural ge | 98.64 | |
| 1ufo_A | 238 | Hypothetical protein TT1662; alpha-beta fold, hydr | 98.64 | |
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 98.64 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 98.64 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 98.63 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 98.63 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 98.63 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 98.62 | |
| 1xkl_A | 273 | SABP2, salicylic acid-binding protein 2; alpha-bet | 98.62 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 98.62 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 98.62 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 98.61 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 98.61 | |
| 4g9e_A | 279 | AHL-lactonase, alpha/beta hydrolase fold protein; | 98.6 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 98.6 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 98.6 | |
| 3p2m_A | 330 | Possible hydrolase; alpha/beta hydrolase superfami | 98.59 | |
| 2pl5_A | 366 | Homoserine O-acetyltransferase; alpha/beta hydrola | 98.59 | |
| 2i3d_A | 249 | AGR_C_3351P, hypothetical protein ATU1826; structu | 98.58 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 98.55 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 98.55 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 98.54 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 98.54 | |
| 3fla_A | 267 | RIFR; alpha-beta hydrolase thioesterase, hydrolase | 98.49 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 98.48 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 97.86 | |
| 3cn9_A | 226 | Carboxylesterase; alpha/beta hydrolase fold super- | 98.46 | |
| 3i1i_A | 377 | Homoserine O-acetyltransferase; structural genomic | 98.46 | |
| 3e4d_A | 278 | Esterase D; S-formylglutathione hydrolase, hydrola | 98.46 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 98.45 | |
| 2qjw_A | 176 | Uncharacterized protein XCC1541; putative hydrolas | 98.43 | |
| 1auo_A | 218 | Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl | 98.43 | |
| 3ksr_A | 290 | Putative serine hydrolase; catalytic triad, struct | 98.41 | |
| 2r8b_A | 251 | AGR_C_4453P, uncharacterized protein ATU2452; APC6 | 98.41 | |
| 4i19_A | 388 | Epoxide hydrolase; structural genomics, PSI-biolog | 98.41 | |
| 2vat_A | 444 | Acetyl-COA--deacetylcephalosporin C acetyltransfer | 98.41 | |
| 3fcy_A | 346 | Xylan esterase 1; alpha/beta hydrolase, carbohydra | 98.41 | |
| 3b5e_A | 223 | MLL8374 protein; NP_108484.1, carboxylesterase, st | 98.4 | |
| 3qmv_A | 280 | Thioesterase, REDJ; alpha/beta hydrolase fold, hyd | 98.4 | |
| 2hdw_A | 367 | Hypothetical protein PA2218; alpha/beta hydrolase | 98.4 | |
| 2b61_A | 377 | Homoserine O-acetyltransferase; acyl-enzyme, aspar | 98.39 | |
| 1pja_A | 302 | Palmitoyl-protein thioesterase 2 precursor; hydrol | 98.39 | |
| 1l7a_A | 318 | Cephalosporin C deacetylase; structural genomics, | 98.39 | |
| 2fuk_A | 220 | XC6422 protein; A/B hydrolase, structural genomics | 98.38 | |
| 1zi8_A | 236 | Carboxymethylenebutenolidase; alpha and beta prote | 98.38 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 98.38 | |
| 3og9_A | 209 | Protein YAHD A copper inducible hydrolase; alpha/b | 98.37 | |
| 2uz0_A | 263 | Esterase, tributyrin esterase; alpha/beta hydrolas | 98.36 | |
| 3f67_A | 241 | Putative dienelactone hydrolase; alpha-beta-alpha | 98.32 | |
| 3trd_A | 208 | Alpha/beta hydrolase; cellular processes; 1.50A {C | 98.32 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 98.31 | |
| 3g02_A | 408 | Epoxide hydrolase; alpha/beta hydrolase fold, enan | 98.3 | |
| 1fj2_A | 232 | Protein (acyl protein thioesterase 1); alpha/beta | 98.3 | |
| 2q0x_A | 335 | Protein DUF1749, uncharacterized protein; alpha/be | 98.3 | |
| 3i6y_A | 280 | Esterase APC40077; lipase, structural genomics, PS | 98.28 | |
| 2pbl_A | 262 | Putative esterase/lipase/thioesterase; alpha/beta- | 98.27 | |
| 1vlq_A | 337 | Acetyl xylan esterase; TM0077, structural genomics | 98.26 | |
| 1bu8_A | 452 | Protein (pancreatic lipase related protein 2); hyd | 98.25 | |
| 3hxk_A | 276 | Sugar hydrolase; alpha-beta protein., structural g | 98.22 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 98.19 | |
| 1lzl_A | 323 | Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod | 98.19 | |
| 1w52_X | 452 | Pancreatic lipase related protein 2; detergent, cl | 98.19 | |
| 1tht_A | 305 | Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. | 98.18 | |
| 1jji_A | 311 | Carboxylesterase; alpha-beta hydrolase fold, hydro | 98.17 | |
| 3d0k_A | 304 | Putative poly(3-hydroxybutyrate) depolymerase LPQ; | 98.17 | |
| 3ain_A | 323 | 303AA long hypothetical esterase; carboxylesterase | 98.17 | |
| 3h2g_A | 397 | Esterase; xanthomonas oryzae PV. oryzae, cell WALL | 98.17 | |
| 3ls2_A | 280 | S-formylglutathione hydrolase; psychrophilic organ | 98.16 | |
| 2dst_A | 131 | Hypothetical protein TTHA1544; conserved hypotheti | 98.15 | |
| 2wir_A | 313 | Pesta, alpha/beta hydrolase fold-3 domain protein; | 98.15 | |
| 2hm7_A | 310 | Carboxylesterase; alpha/beta hydrolase fold, hydro | 98.15 | |
| 2c7b_A | 311 | Carboxylesterase, ESTE1; carboxyesterase, thermoph | 98.15 | |
| 3h04_A | 275 | Uncharacterized protein; protein with unknown func | 98.14 | |
| 3fak_A | 322 | Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc | 98.14 | |
| 1jjf_A | 268 | Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x | 98.14 | |
| 2jbw_A | 386 | Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine | 98.13 | |
| 4b6g_A | 283 | Putative esterase; hydrolase, formaldehyde detoxif | 98.13 | |
| 3d7r_A | 326 | Esterase; alpha/beta fold, hydrolase; 2.01A {Staph | 98.13 | |
| 3fnb_A | 405 | Acylaminoacyl peptidase SMU_737; alpha-beta-alpha | 98.12 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 98.12 | |
| 4hvt_A | 711 | Ritya.17583.B, post-proline cleaving enzyme; ssgci | 98.12 | |
| 1qlw_A | 328 | Esterase; anisotropic refinement, atomic resolutio | 98.11 | |
| 3k6k_A | 322 | Esterase/lipase; alpha/beta hydrolase fold; 2.20A | 98.11 | |
| 1gpl_A | 432 | RP2 lipase; serine esterase, hydrolase, lipid degr | 98.11 | |
| 3ga7_A | 326 | Acetyl esterase; phosphoserine, IDP00896, hydrolas | 98.11 | |
| 3bxp_A | 277 | Putative lipase/esterase; putative carboxylesteras | 98.11 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 98.11 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 98.09 | |
| 3fcx_A | 282 | FGH, esterase D, S-formylglutathione hydrolase; re | 98.08 | |
| 2zsh_A | 351 | Probable gibberellin receptor GID1L1; plant hormon | 98.08 | |
| 1vkh_A | 273 | Putative serine hydrolase; structural genomics, jo | 98.08 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 98.07 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 98.07 | |
| 2o7r_A | 338 | CXE carboxylesterase; alpha/beta hydrolase; 1.40A | 98.06 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 98.06 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 98.06 | |
| 3u0v_A | 239 | Lysophospholipase-like protein 1; alpha, beta hydr | 98.06 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 98.05 | |
| 1jkm_A | 361 | Brefeldin A esterase; serine hydrolase, degradatio | 98.04 | |
| 1ys1_X | 320 | Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h | 98.04 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 98.03 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 98.02 | |
| 1ex9_A | 285 | Lactonizing lipase; alpha-beta hydrolase fold, pho | 98.01 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 98.01 | |
| 3ils_A | 265 | PKS, aflatoxin biosynthesis polyketide synthase; A | 98.0 | |
| 4e15_A | 303 | Kynurenine formamidase; alpha/beta hydrolase fold, | 97.99 | |
| 3ds8_A | 254 | LIN2722 protein; unkonwn function, structural geno | 97.98 | |
| 3k2i_A | 422 | Acyl-coenzyme A thioesterase 4; alpha/beta hydrola | 97.97 | |
| 3lcr_A | 319 | Tautomycetin biosynthetic PKS; alpha-beta hydrolas | 97.97 | |
| 2x5x_A | 342 | PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE | 97.96 | |
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 97.93 | |
| 1jfr_A | 262 | Lipase; serine hydrolase; 1.90A {Streptomyces exfo | 97.92 | |
| 3hlk_A | 446 | Acyl-coenzyme A thioesterase 2, mitochondrial; alp | 97.92 | |
| 3d59_A | 383 | Platelet-activating factor acetylhydrolase; secret | 97.92 | |
| 3qh4_A | 317 | Esterase LIPW; structural genomics, ssgcid, seattl | 97.92 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 97.9 | |
| 3vis_A | 306 | Esterase; alpha/beta-hydrolase fold, polyethylene | 97.89 | |
| 2qru_A | 274 | Uncharacterized protein; alpha/beta-hydrolase, str | 97.88 | |
| 3mve_A | 415 | FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ | 97.87 | |
| 1r88_A | 280 | MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP | 97.87 | |
| 4ezi_A | 377 | Uncharacterized protein; alpha-beta hydrolases fol | 97.83 | |
| 1uxo_A | 192 | YDEN protein; hydrolase, A/B hydrolase, esterase, | 97.82 | |
| 3doh_A | 380 | Esterase; alpha-beta hydrolase, beta sheet; 2.60A | 97.8 | |
| 3bjr_A | 283 | Putative carboxylesterase; structural genomics, jo | 97.8 | |
| 1sfr_A | 304 | Antigen 85-A; alpha/beta hydrolase, structural gen | 97.8 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 97.79 | |
| 3g8y_A | 391 | SUSD/RAGB-associated esterase-like protein; struct | 97.79 | |
| 1kez_A | 300 | Erythronolide synthase; polyketide synthase, modul | 97.79 | |
| 1hpl_A | 449 | Lipase; hydrolase(carboxylic esterase); 2.30A {Equ | 97.78 | |
| 3bdv_A | 191 | Uncharacterized protein DUF1234; DUF1234 family pr | 97.76 | |
| 1rp1_A | 450 | Pancreatic lipase related protein 1; hydrolase, li | 97.7 | |
| 2qs9_A | 194 | Retinoblastoma-binding protein 9; B5T overexpresse | 97.69 | |
| 3i2k_A | 587 | Cocaine esterase; alpha/beta hydrolase, hydrolase; | 97.69 | |
| 4fle_A | 202 | Esterase; structural genomics, PSI-biology, northe | 97.67 | |
| 3lp5_A | 250 | Putative cell surface hydrolase; structural genom | 97.61 | |
| 3nuz_A | 398 | Putative acetyl xylan esterase; structural genomic | 97.61 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 97.6 | |
| 3fle_A | 249 | SE_1780 protein; structural genomics, APC61035.1, | 97.59 | |
| 2zyr_A | 484 | Lipase, putative; fatty acid, hydrolase; HET: 1PE; | 97.58 | |
| 1whs_A | 255 | Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T | 97.58 | |
| 1dqz_A | 280 | 85C, protein (antigen 85-C); fibronectin, structur | 97.57 | |
| 1gkl_A | 297 | Endo-1,4-beta-xylanase Y; hydrolase, esterase fami | 97.55 | |
| 4h0c_A | 210 | Phospholipase/carboxylesterase; PSI-biology, midwe | 97.55 | |
| 1qe3_A | 489 | PNB esterase, para-nitrobenzyl esterase; alpha-bet | 97.49 | |
| 2qm0_A | 275 | BES; alpha-beta structure, structural genomics, PS | 97.49 | |
| 3tej_A | 329 | Enterobactin synthase component F; nonribosomal pe | 97.48 | |
| 1mpx_A | 615 | Alpha-amino acid ester hydrolase; alpha/beta hydro | 97.46 | |
| 4ao6_A | 259 | Esterase; hydrolase, thermo label; 1.60A {Unidenti | 97.45 | |
| 2ogt_A | 498 | Thermostable carboxylesterase EST50; alpha/beta hy | 97.43 | |
| 1ivy_A | 452 | Human protective protein; carboxypeptidase, serine | 97.43 | |
| 1ei9_A | 279 | Palmitoyl protein thioesterase 1; alpha/beta hydro | 97.42 | |
| 2k2q_B | 242 | Surfactin synthetase thioesterase subunit; A/B-hyd | 97.4 | |
| 3iii_A | 560 | COCE/NOND family hydrolase; structural genomics, c | 97.39 | |
| 4fhz_A | 285 | Phospholipase/carboxylesterase; alpha/beta hydrola | 97.36 | |
| 2b9v_A | 652 | Alpha-amino acid ester hydrolase; catalytic triad, | 97.24 | |
| 2ha2_A | 543 | ACHE, acetylcholinesterase; hydrolase fold, serine | 97.16 | |
| 1p0i_A | 529 | Cholinesterase; serine hydrolase, butyrate, hydrol | 97.1 | |
| 2h7c_A | 542 | Liver carboxylesterase 1; enzyme, cholesteryl este | 97.1 | |
| 1lns_A | 763 | X-prolyl dipeptidyl aminopetidase; alpha beta hydr | 97.06 | |
| 2hfk_A | 319 | Pikromycin, type I polyketide synthase pikaiv; alp | 97.0 | |
| 1dx4_A | 585 | ACHE, acetylcholinesterase; hydrolase, serine este | 96.92 | |
| 3tjm_A | 283 | Fatty acid synthase; thioesterase domain, fatty ac | 96.85 | |
| 1ea5_A | 537 | ACHE, acetylcholinesterase; hydrolase, serine hydr | 96.76 | |
| 2fj0_A | 551 | JuvenIle hormone esterase; manduca sexta, alpha-be | 96.71 | |
| 3c8d_A | 403 | Enterochelin esterase; alpha-beta-alpha sandwich, | 96.61 | |
| 1ac5_A | 483 | KEX1(delta)P; carboxypeptidase, hydrolase, glycopr | 96.6 | |
| 1ukc_A | 522 | ESTA, esterase; fungi, A/B hydrolase fold, acetylc | 96.49 | |
| 1ycd_A | 243 | Hypothetical 27.3 kDa protein in AAP1-SMF2 interge | 96.41 | |
| 2fx5_A | 258 | Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse | 96.39 | |
| 3bix_A | 574 | Neuroligin-1, neuroligin I; esterase domain, alpha | 96.34 | |
| 1cpy_A | 421 | Serine carboxypeptidase; hydrolase (carboxypeptida | 96.31 | |
| 1thg_A | 544 | Lipase; hydrolase(carboxylic esterase); HET: NAG N | 96.28 | |
| 1llf_A | 534 | Lipase 3; candida cylindracea cholesterol esterase | 96.13 | |
| 1jmk_C | 230 | SRFTE, surfactin synthetase; thioesterase, non-rib | 96.07 | |
| 3guu_A | 462 | Lipase A; protein structure, hydrolase; HET: 1PE; | 96.02 | |
| 4f21_A | 246 | Carboxylesterase/phospholipase family protein; str | 96.01 | |
| 2cb9_A | 244 | Fengycin synthetase; thioesterase, non-ribosomal p | 95.93 | |
| 2hih_A | 431 | Lipase 46 kDa form; A1 phospholipase, phospholipid | 95.9 | |
| 2gzs_A | 278 | IROE protein; enterobactin, salmochelin, DFP, hydr | 95.85 | |
| 2dsn_A | 387 | Thermostable lipase; T1 lipase, hydrolase; 1.50A { | 95.82 | |
| 4az3_A | 300 | Lysosomal protective protein 32 kDa chain; hydrola | 95.73 | |
| 2bce_A | 579 | Cholesterol esterase; hydrolase, serine esterase, | 95.66 | |
| 3gff_A | 331 | IROE-like serine hydrolase; NP_718593.1, structura | 95.6 | |
| 1tib_A | 269 | Lipase; hydrolase(carboxylic esterase); 1.84A {The | 95.22 | |
| 4fol_A | 299 | FGH, S-formylglutathione hydrolase; D-type esteras | 95.11 | |
| 2px6_A | 316 | Thioesterase domain; thioesaterse domain, orlistat | 94.89 | |
| 1gxs_A | 270 | P-(S)-hydroxymandelonitrIle lyase chain A; inhibit | 94.17 | |
| 1lgy_A | 269 | Lipase, triacylglycerol lipase; hydrolase (carboxy | 93.96 | |
| 1tgl_A | 269 | Triacyl-glycerol acylhydrolase; carboxylic esteras | 93.95 | |
| 1tia_A | 279 | Lipase; hydrolase(carboxylic esterase); 2.10A {Pen | 93.82 | |
| 3g7n_A | 258 | Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A | 92.2 | |
| 1uwc_A | 261 | Feruloyl esterase A; hydrolase, serine esterase, x | 91.48 | |
| 3uue_A | 279 | LIP1, secretory lipase (family 3); LID-domain, hyd | 91.47 | |
| 2d81_A | 318 | PHB depolymerase; alpha/beta hydrolase fold, circu | 89.68 | |
| 3ngm_A | 319 | Extracellular lipase; secret lipase, hydrolase; 2. | 87.84 | |
| 3hxk_A | 276 | Sugar hydrolase; alpha-beta protein., structural g | 86.96 | |
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 83.87 | |
| 3hc7_A | 254 | Gene 12 protein, GP12; alpha/beta sandwich, cell a | 83.11 | |
| 3o0d_A | 301 | YALI0A20350P, triacylglycerol lipase; alpha/beta-h | 82.75 |
| >4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.1e-107 Score=858.13 Aligned_cols=432 Identities=35% Similarity=0.655 Sum_probs=370.3
Q ss_pred CCCceeeEEEeecCCCCCCCCCCCeeeeEEEEeccccCCCCCCCCEEEEeCCCCCCCccccccccccCcccccCCeEEEE
Q 012711 7 FKDFKTFFYTQTLDHFNYRPDSYATFQQRYVINFKHWGGSNSSAPIFVYLGAEGSLDEDLDVAGFLPDNAPRFKALLVYI 86 (458)
Q Consensus 7 ~~~~~~~~f~Q~lDHf~~~~~~~~TF~QRY~~n~~~~~~~~~~~pi~l~~gge~~~~~~~~~~~~~~~~A~~~~a~~v~~ 86 (458)
-|++++.||+|+|||||+++.+++||+||||+|++||++ ++||||||+||||+++....+.|++.++|+++||++|+|
T Consensus 2 ~P~~~~~~f~Q~lDHFn~~~~~~~TF~QRY~~n~~~~~~--~~gPIfl~~gGEg~~~~~~~~~g~~~~lA~~~~a~~v~l 79 (472)
T 4ebb_A 2 DPGFQERFFQQRLDHFNFERFGNKTFPQRFLVSDRFWVR--GEGPIFFYTGNEGDVWAFANNSAFVAELAAERGALLVFA 79 (472)
T ss_dssp CCCCEEEEEEEESCSSCSSTTTTCEEEEEEEEECTTCCT--TTCCEEEEECCSSCHHHHHHHCHHHHHHHHHHTCEEEEE
T ss_pred CCCCceeeEEeecCCCCCCCCCCCEEEEEEEEecceeCC--CCCcEEEEECCCccccccccCccHHHHHHHHhCCeEEEE
Confidence 467999999999999997666789999999999999973 459999999999999877778899999999999999999
Q ss_pred ecceeecCCCCCChhhhhccCCccccCChHhhHHHHHHHHHHHHhhcCCCCCCEEEeccChhHHHHHHHHHhcCceEEEE
Q 012711 87 EHRYYGKSVPFGSREEAMKNASTLGYFNSAQAIADYADVLLHIKKKYSAERSPSIVVGGSYGGMLAAWFRLKYPHIALGA 166 (458)
Q Consensus 87 EhR~yG~S~P~~~~s~~~~~~~nl~ylt~~Qal~D~~~f~~~~~~~~~~~~~~~i~~GgSy~G~laa~~r~kyP~~~~~~ 166 (458)
||||||+|.|++++|+ ..+||||||++|||||+|+||+++|.+++.+++|||+|||||||+||||+|+||||+|+||
T Consensus 80 EHRyYG~S~P~~~~st---~~~nL~yLt~eQALaD~a~fi~~~k~~~~~~~~pwI~~GGSY~G~LaAW~R~kYP~lv~ga 156 (472)
T 4ebb_A 80 EHRYYGKSLPFGAQST---QRGHTELLTVEQALADFAELLRALRRDLGAQDAPAIAFGGSYGGMLSAYLRMKYPHLVAGA 156 (472)
T ss_dssp CCTTSTTCCTTGGGGG---STTSCTTCSHHHHHHHHHHHHHHHHHHTTCTTCCEEEEEETHHHHHHHHHHHHCTTTCSEE
T ss_pred ecccccCCcCCCCCCc---cccccccCCHHHHHHHHHHHHHHHHhhcCCCCCCEEEEccCccchhhHHHHhhCCCeEEEE
Confidence 9999999999999864 2359999999999999999999999999989999999999999999999999999999999
Q ss_pred EeccccccccccCCCCcchhhhhhccccccChhHHHHHHHHHHHHHHHhcCCchhHHHhhhccccCCCCChhhHHH---H
Q 012711 167 LASSAPILYFHDTAPQVGYYTIVTKDFKETSQSCYETVRKSWDEIRKVASRPNGLSMLSKKFRTCKPLKKTSELED---F 243 (458)
Q Consensus 167 iassapv~a~~~~~~~~~y~~~v~~~~~~~~~~C~~~i~~~~~~i~~l~~~~~~~~~l~~~F~~c~~l~~~~~~~~---f 243 (458)
|||||||+|+.+|.++++|++.|++.+...+++|+++|+++++.|++++.+ .+.++++++|++|.++++..|+.. +
T Consensus 157 ~ASSApv~a~~df~~y~~~~~~v~~~~~~~~~~C~~~i~~a~~~i~~~~~~-~~~~~~~~~f~~c~~~~~~~d~~~~~~~ 235 (472)
T 4ebb_A 157 LAASAPVLAVAGLGDSNQFFRDVTADFEGQSPKCTQGVREAFRQIKDLFLQ-GAYDTVRWEFGTCQPLSDEKDLTQLFMF 235 (472)
T ss_dssp EEETCCTTGGGTCSCTTHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHH-TCHHHHHHHHTBSSCCCSHHHHHHHHHH
T ss_pred EecccceEEeccccccHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHhc-chHHHHHHHhcCCCCCCChHHHHHHHHH
Confidence 999999999999999999999999888888999999999999999999865 346789999999999987766654 3
Q ss_pred HHHHhhhhhccCCC---------CCCccccccccccCCCCchhHHHHHHHhhhhhcCcceeccCC----CCCCCC-----
Q 012711 244 LDSLYTDVAQYDDP---------PTYPLSIVCGGIDGAPTGIDVLGKIFKGVVAYKGNRSCYDMD----EYIRPT----- 305 (458)
Q Consensus 244 ~~~~~~~~~Q~~~~---------~~~~i~~~C~~l~~~~~~~~~l~~~~~~~~~~~~~~~C~~~~----~~~~~~----- 305 (458)
+..++..++|++++ +..++..+|+.|.+.......+..+...+.+..+...|++.. ...++.
T Consensus 236 ~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~ 315 (472)
T 4ebb_A 236 ARNAFTVLAMMDYPYPTDFLGPLPANPVKVGCDRLLSEAQRITGLRALAGLVYNASGSEHCYDIYRLYHSCADPTGCGTG 315 (472)
T ss_dssp HHHHHHHHHHTCCSSCEESSSEECSSHHHHHHHHHHTCSSHHHHHHHHHHHHHCTTSCCSSBCHHHHCCCCSSTTCCCSS
T ss_pred HHHHHHHHhhhccccchhhcccCccchHHHHHHHhcccchHHHHHHHHHHHHhhccCCcchhhhhhhhhhccCCcccCCC
Confidence 44556666665554 245678889888765433344444444444555667898752 111221
Q ss_pred CCCCcceeeeecccccccccCCCCCCCCCCCCChhhHHHHhhhhcCCCCCcchh-hcccCCcchhhhccccccEEEEEcC
Q 012711 306 ETNVGWRWQTCSEMVMPIGHGHKDTMFPPAPFDLNRFTKDCEGTFGVKPKPHWV-TTYYGGRDLKLILHRFGSNIIFSNG 384 (458)
Q Consensus 306 ~~~R~W~yQtCtE~G~~~~~~~~~~~f~~~~i~~~y~~~~C~~~Fg~~~~~~~~-n~~yGG~~~~~~~~~~atnViFtnG 384 (458)
.++|+|.||+||||||+++.++..++|++++++++++.++|+++||+.+++++. |.+|||.++. ++||+|+||
T Consensus 316 ~~~r~W~yQ~CtE~g~~~~~~~~~~~f~~~~~~~~~~~~~C~~~fg~~~~~~~~~~~~~Gg~~~~------~sniiF~nG 389 (472)
T 4ebb_A 316 PDARAWDYQACTEINLTFASNNVTDMFPDLPFTDELRQRYCLDTWGVWPRPDWLLTSFWGGDLRA------ASNIIFSNG 389 (472)
T ss_dssp HHHHHHHHHHTTTCCCCCCBCSSSSSSCCBCCCHHHHHHHHHHHHSCCCCTTHHHHHHCTTCCTT------CCSEEEEEE
T ss_pred CCcccccccccccccccccCCCCCCcCCCCCCcHHHHHHHHHHHhCCCCChhHHHHHhcCCcCCC------CCeEEEECC
Confidence 135999999999999998887777889888899999999999999999988864 6677887765 899999999
Q ss_pred CCCccCCCCccCCCCCceEEEEeCCCcccCCCCCCCCCCcHHHHHHHHHHHHHHHHHHHHHHhcHh
Q 012711 385 LRDPYSTGGVLGNISDSVVAISTVNGSHCLDILPESKSDPQWLVMQRKAEIKIIEEWIAKYQNDLL 450 (458)
Q Consensus 385 ~~DPW~~lgv~~~~~~~~~~i~i~g~~Hc~Dl~~~~~~Dp~~l~~aR~~i~~~i~~Wl~e~~~~~~ 450 (458)
++||||.+||+++.+.++++++|+||+||.||+++++.||++|+++|++|+++|++||++|+.+..
T Consensus 390 ~~DPW~~~gv~~~~s~~~~~~~I~g~~Hc~Dl~~~~~~Dp~~l~~ar~~~~~~i~~Wl~~~~~~~~ 455 (472)
T 4ebb_A 390 NLDPWAGGGIRRNLSASVIAVTIQGGAHHLDLRASHPEDPASVVEARKLEATIIGEWVKAARREQQ 455 (472)
T ss_dssp TTCTTGGGSCCSCCSSSEEEEEETTCCTTGGGSCCCTTCCHHHHHHHHHHHHHHHHHHHHHC----
T ss_pred CcCCCcCccCCCCCCCCceEEEeCcCeeeccccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence 999999999999888999999999999999999999999999999999999999999999977543
|
| >3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A | Back alignment and structure |
|---|
| >3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 | Back alignment and structure |
|---|
| >1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} | Back alignment and structure |
|---|
| >3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* | Back alignment and structure |
|---|
| >3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A | Back alignment and structure |
|---|
| >3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} | Back alignment and structure |
|---|
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A | Back alignment and structure |
|---|
| >3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} | Back alignment and structure |
|---|
| >2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* | Back alignment and structure |
|---|
| >2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A | Back alignment and structure |
|---|
| >2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} | Back alignment and structure |
|---|
| >3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A | Back alignment and structure |
|---|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* | Back alignment and structure |
|---|
| >1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A | Back alignment and structure |
|---|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A | Back alignment and structure |
|---|
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* | Back alignment and structure |
|---|
| >2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A | Back alignment and structure |
|---|
| >3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... | Back alignment and structure |
|---|
| >4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A | Back alignment and structure |
|---|
| >1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 | Back alignment and structure |
|---|
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A | Back alignment and structure |
|---|
| >4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* | Back alignment and structure |
|---|
| >3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A | Back alignment and structure |
|---|
| >3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* | Back alignment and structure |
|---|
| >3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A | Back alignment and structure |
|---|
| >2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* | Back alignment and structure |
|---|
| >3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} | Back alignment and structure |
|---|
| >2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* | Back alignment and structure |
|---|
| >3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} | Back alignment and structure |
|---|
| >3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* | Back alignment and structure |
|---|
| >2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* | Back alignment and structure |
|---|
| >2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 | Back alignment and structure |
|---|
| >3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A | Back alignment and structure |
|---|
| >3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* | Back alignment and structure |
|---|
| >1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A | Back alignment and structure |
|---|
| >2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* | Back alignment and structure |
|---|
| >1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* | Back alignment and structure |
|---|
| >3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A | Back alignment and structure |
|---|
| >1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} | Back alignment and structure |
|---|
| >1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A | Back alignment and structure |
|---|
| >3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A | Back alignment and structure |
|---|
| >3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 | Back alignment and structure |
|---|
| >2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A | Back alignment and structure |
|---|
| >2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} | Back alignment and structure |
|---|
| >3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A | Back alignment and structure |
|---|
| >1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* | Back alignment and structure |
|---|
| >2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 | Back alignment and structure |
|---|
| >4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} | Back alignment and structure |
|---|
| >1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* | Back alignment and structure |
|---|
| >3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A | Back alignment and structure |
|---|
| >1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A | Back alignment and structure |
|---|
| >3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A | Back alignment and structure |
|---|
| >3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* | Back alignment and structure |
|---|
| >1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} | Back alignment and structure |
|---|
| >4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A | Back alignment and structure |
|---|
| >3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} | Back alignment and structure |
|---|
| >3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} | Back alignment and structure |
|---|
| >2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A | Back alignment and structure |
|---|
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* | Back alignment and structure |
|---|
| >1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 | Back alignment and structure |
|---|
| >3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* | Back alignment and structure |
|---|
| >3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} | Back alignment and structure |
|---|
| >2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A | Back alignment and structure |
|---|
| >1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 | Back alignment and structure |
|---|
| >3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A | Back alignment and structure |
|---|
| >3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* | Back alignment and structure |
|---|
| >3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A | Back alignment and structure |
|---|
| >1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 | Back alignment and structure |
|---|
| >3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A | Back alignment and structure |
|---|
| >2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A | Back alignment and structure |
|---|
| >4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* | Back alignment and structure |
|---|
| >3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* | Back alignment and structure |
|---|
| >1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* | Back alignment and structure |
|---|
| >1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* | Back alignment and structure |
|---|
| >1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* | Back alignment and structure |
|---|
| >4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A | Back alignment and structure |
|---|
| >2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A | Back alignment and structure |
|---|
| >1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A | Back alignment and structure |
|---|
| >2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A | Back alignment and structure |
|---|
| >1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 | Back alignment and structure |
|---|
| >1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A | Back alignment and structure |
|---|
| >2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A | Back alignment and structure |
|---|
| >3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* | Back alignment and structure |
|---|
| >4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* | Back alignment and structure |
|---|
| >2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A | Back alignment and structure |
|---|
| >2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... | Back alignment and structure |
|---|
| >1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... | Back alignment and structure |
|---|
| >2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* | Back alignment and structure |
|---|
| >1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A | Back alignment and structure |
|---|
| >1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* | Back alignment and structure |
|---|
| >3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A | Back alignment and structure |
|---|
| >1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... | Back alignment and structure |
|---|
| >2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} | Back alignment and structure |
|---|
| >3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* | Back alignment and structure |
|---|
| >1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 | Back alignment and structure |
|---|
| >1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} | Back alignment and structure |
|---|
| >3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* | Back alignment and structure |
|---|
| >1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* | Back alignment and structure |
|---|
| >1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* | Back alignment and structure |
|---|
| >1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 | Back alignment and structure |
|---|
| >3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* | Back alignment and structure |
|---|
| >4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* | Back alignment and structure |
|---|
| >2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} | Back alignment and structure |
|---|
| >2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* | Back alignment and structure |
|---|
| >2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A | Back alignment and structure |
|---|
| >4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* | Back alignment and structure |
|---|
| >2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A | Back alignment and structure |
|---|
| >3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* | Back alignment and structure |
|---|
| >4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* | Back alignment and structure |
|---|
| >2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 | Back alignment and structure |
|---|
| >1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A | Back alignment and structure |
|---|
| >1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A | Back alignment and structure |
|---|
| >1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} | Back alignment and structure |
|---|
| >1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* | Back alignment and structure |
|---|
| >3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* | Back alignment and structure |
|---|
| >2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* | Back alignment and structure |
|---|
| >3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} | Back alignment and structure |
|---|
| >3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* | Back alignment and structure |
|---|
| >3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} | Back alignment and structure |
|---|
| >3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 458 | ||||
| d3b5ea1 | 209 | c.69.1.14 (A:7-215) Uncharacterized protein Mll837 | 7e-04 |
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Length = 209 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Carboxylesterase/thioesterase 1 domain: Uncharacterized protein Mll8374 species: Mesorhizobium loti [TaxId: 381]
Score = 38.5 bits (88), Expect = 7e-04
Identities = 21/175 (12%), Positives = 43/175 (24%), Gaps = 10/175 (5%)
Query: 40 FKHWGGSNSSAPIFVYL-GAEGSLDEDLDVAGFLPDNAPRFKALLVYIEHRYYGKSVPFG 98
++ G S L G+ + +A + A + G
Sbjct: 13 YRLLGAGKESRECLFLLHGSGVDETTLVPLARRIAPTAT--------LVAARGRIPQEDG 64
Query: 99 SREEAMKNASTLGYFNSAQAIADYADVLLHIKKKYSAERSPSIVVGGSYGGMLAAWFRLK 158
R + + + A +A K++ + +G S G L + L
Sbjct: 65 FRWFERIDPTRFEQKSILAETAAFAAFTNEAAKRHGLNLDHATFLGYSNGANLVSSLMLL 124
Query: 159 YPHIALGALASSAPILYFHDTAPQVGYYTIVTKDFKETSQSCYETVRKSWDEIRK 213
+P I A P+ ++ V + +
Sbjct: 125 HPGIVRLAALLR-PMPVLDHVPATDLAGIRTLIIAGAADETYGPFVPALVTLLSR 178
|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 458 | |||
| d1mtza_ | 290 | Tricorn interacting factor F1 {Archaeon Thermoplas | 99.04 | |
| d1azwa_ | 313 | Proline iminopeptidase {Xanthomonas campestris, pv | 99.03 | |
| d1c4xa_ | 281 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 98.96 | |
| d1zd3a2 | 322 | Mammalian epoxide hydrolase, C-terminal domain {Hu | 98.84 | |
| d1ehya_ | 293 | Bacterial epoxide hydrolase {Agrobacterium radioba | 98.82 | |
| d1q0ra_ | 297 | Aclacinomycin methylesterase RdmC {Streptomyces pu | 98.81 | |
| d1b6ga_ | 310 | Haloalkane dehalogenase {Xanthobacter autotrophicu | 98.79 | |
| d1pjaa_ | 268 | Palmitoyl protein thioesterase 2 {Human (Homo sapi | 98.79 | |
| d1j1ia_ | 268 | Meta cleavage compound hydrolase CarC {Janthinobac | 98.75 | |
| d1uk8a_ | 271 | Meta-cleavage product hydrolase CumD {Pseudomonas | 98.73 | |
| d1bn7a_ | 291 | Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 | 98.72 | |
| d1brta_ | 277 | Bromoperoxidase A2 {Streptomyces aureofaciens [Tax | 98.7 | |
| d2rhwa1 | 283 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 98.7 | |
| d1mj5a_ | 298 | Haloalkane dehalogenase {Sphingomonas paucimobilis | 98.6 | |
| d3c70a1 | 256 | Hydroxynitrile lyase {Rubber tree (Hevea brasilien | 98.59 | |
| d1k8qa_ | 377 | Gastric lipase {Dog (Canis familiaris) [TaxId: 961 | 98.54 | |
| d1a8qa_ | 274 | Bromoperoxidase A1 {Streptomyces aureofaciens [Tax | 98.53 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 98.53 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 98.53 | |
| d1hkha_ | 279 | Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] | 98.5 | |
| d1wm1a_ | 313 | Proline aminopeptidase {Serratia marcescens [TaxId | 98.48 | |
| d1a88a_ | 275 | Chloroperoxidase L {Streptomyces lividans [TaxId: | 98.48 | |
| d1a8sa_ | 273 | Chloroperoxidase F {Pseudomonas fluorescens [TaxId | 98.43 | |
| d1r3da_ | 264 | Hypothetical protein VC1974 {Vibrio cholerae [TaxI | 98.42 | |
| d1m33a_ | 256 | Biotin biosynthesis protein BioH {Escherichia coli | 98.42 | |
| d1va4a_ | 271 | Arylesterase {Pseudomonas fluorescens [TaxId: 294] | 98.41 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 98.3 | |
| d1xkta_ | 286 | Fatty acid synthase {Human (Homo sapiens) [TaxId: | 98.13 | |
| d2dsta1 | 122 | Hypothetical protein TTHA1544 {Thermus thermophilu | 98.08 | |
| d1cvla_ | 319 | Lipase {Chromobacterium viscosum [TaxId: 42739]} | 98.01 | |
| d1sfra_ | 288 | Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 | 97.94 | |
| d3b5ea1 | 209 | Uncharacterized protein Mll8374 {Mesorhizobium lot | 97.93 | |
| d1thta_ | 302 | Myristoyl-ACP-specific thioesterase {Vibrio harvey | 97.93 | |
| d2jbwa1 | 360 | 2,6-dihydropseudooxynicotine hydrolase {Arthrobact | 97.89 | |
| d2h1ia1 | 202 | Carboxylesterase {Bacillus cereus [TaxId: 1396]} | 97.87 | |
| d1r88a_ | 267 | Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta | 97.86 | |
| d2pbla1 | 261 | Uncharacterized protein TM1040_2492 {Silicibacter | 97.85 | |
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 97.84 | |
| d2r8ba1 | 203 | Uncharacterized protein Atu2452 {Agrobacterium tum | 97.82 | |
| d2hu7a2 | 260 | Acylamino-acid-releasing enzyme, C-terminal donain | 97.81 | |
| d2fuka1 | 218 | XC6422 protein {Xanthomonas campestris [TaxId: 339 | 97.7 | |
| d1tcaa_ | 317 | Triacylglycerol lipase {Yeast (Candida antarctica) | 97.63 | |
| d1qo7a_ | 394 | Bacterial epoxide hydrolase {Aspergillus niger [Ta | 97.63 | |
| d1vkha_ | 263 | Putative serine hydrolase Ydr428c {Baker's yeast ( | 97.61 | |
| d2h7xa1 | 283 | Picromycin polyketide synthase {Streptomyces venez | 97.53 | |
| d1dqza_ | 280 | Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 | 97.52 | |
| d1ex9a_ | 285 | Lipase {Pseudomonas aeruginosa [TaxId: 287]} | 97.52 | |
| d1ufoa_ | 238 | Hypothetical protein TT1662 {Thermus thermophilus | 97.5 | |
| d2bgra2 | 258 | Dipeptidyl peptidase IV/CD26, C-terminal domain {P | 97.5 | |
| d1mpxa2 | 381 | Alpha-amino acid ester hydrolase {Xanthomonas citr | 97.49 | |
| d1xfda2 | 258 | Dipeptidyl aminopeptidase-like protein 6, DPP6, C- | 97.32 | |
| d1vlqa_ | 322 | Acetyl xylan esterase TM0077 {Thermotoga maritima | 97.31 | |
| d1uxoa_ | 186 | Hypothetical protein YdeN {Bacillus subtilis [TaxI | 97.3 | |
| d1l7aa_ | 318 | Cephalosporin C deacetylase {Bacillus subtilis [Ta | 97.28 | |
| d1jjia_ | 311 | Carboxylesterase {Archaeon Archaeoglobus fulgidus | 97.2 | |
| d1jjfa_ | 255 | Feruloyl esterase domain of the cellulosomal xylan | 97.02 | |
| d1lzla_ | 317 | Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | 96.99 | |
| d1mo2a_ | 255 | Erythromycin polyketide synthase {Saccharopolyspor | 96.89 | |
| d1wb4a1 | 273 | Feruloyl esterase domain of the cellulosomal xylan | 96.89 | |
| d1pv1a_ | 299 | Hypothetical esterase YJL068C {Baker's yeast (Sacc | 96.72 | |
| d1ju3a2 | 347 | Bacterial cocaine esterase N-terminal domain {Rhod | 96.7 | |
| d2i3da1 | 218 | Hypothetical protein Atu1826 {Agrobacterium tumefa | 96.63 | |
| d1u4na_ | 308 | Carboxylesterase {Alicyclobacillus acidocaldarius | 96.58 | |
| g1wht.1 | 409 | Serine carboxypeptidase II {Wheat (Triticum vulgar | 96.56 | |
| d1jfra_ | 260 | Lipase {Streptomyces exfoliatus [TaxId: 1905]} | 96.53 | |
| d1jmkc_ | 230 | Surfactin synthetase, SrfA {Bacillus subtilis [Tax | 96.43 | |
| d1wpxa1 | 421 | Serine carboxypeptidase II {Baker's yeast (Sacchar | 96.34 | |
| d1ivya_ | 452 | Human 'protective protein', HPP {Human (Homo sapie | 96.3 | |
| d2b9va2 | 385 | Alpha-amino acid ester hydrolase {Acetobacter past | 96.26 | |
| d1jkma_ | 358 | Carboxylesterase {Bacillus subtilis, brefeldin A e | 96.24 | |
| d1fj2a_ | 229 | Acyl protein thioesterase 1 {Human (Homo sapiens) | 96.1 | |
| d1ac5a_ | 483 | Serine carboxypeptidase II {Baker's yeast (Sacchar | 95.97 | |
| d3c8da2 | 246 | Enterochelin esterase, catalytic domain {Shigella | 95.95 | |
| d2b61a1 | 357 | Homoserine O-acetyltransferase {Haemophilus influe | 94.7 | |
| g1gxs.1 | 425 | Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T | 94.69 | |
| d1lnsa3 | 405 | X-Prolyl dipeptidyl aminopeptidase PepX, middle do | 94.59 | |
| d1qfma2 | 280 | Prolyl oligopeptidase, C-terminal domain {Pig (Sus | 94.32 | |
| d1auoa_ | 218 | Carboxylesterase {Pseudomonas fluorescens [TaxId: | 94.0 | |
| d2vata1 | 376 | Acetyl-CoA:deacetylcephalosporin C acetyltransfera | 93.82 | |
| d1qe3a_ | 483 | Thermophilic para-nitrobenzyl esterase (PNB estera | 93.52 | |
| d2pl5a1 | 362 | Homoserine O-acetyltransferase {Leptospira interro | 93.2 | |
| d1dina_ | 233 | Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI | 92.96 | |
| d1llfa_ | 534 | Type-B carboxylesterase/lipase {Candida cylindrace | 92.88 | |
| d1ukca_ | 517 | Esterase EstA {Aspergillus niger [TaxId: 5061]} | 92.84 | |
| d1thga_ | 544 | Type-B carboxylesterase/lipase {Fungus (Geotrichum | 92.36 | |
| d2ha2a1 | 542 | Acetylcholinesterase {Mouse (Mus musculus) [TaxId: | 92.29 | |
| d1p0ia_ | 526 | Butyryl cholinesterase {Human (Homo sapiens) [TaxI | 91.9 | |
| d1uwca_ | 261 | Feruloyl esterase A {Aspergillus niger [TaxId: 506 | 91.78 | |
| d2gzsa1 | 265 | Enterobactin and salmochelin hydrolase IroE {Esche | 90.96 | |
| d1dx4a_ | 571 | Acetylcholinesterase {Fruit fly (Drosophila melano | 90.42 | |
| d1ei9a_ | 279 | Palmitoyl protein thioesterase 1 {Cow (Bos taurus) | 90.34 | |
| d1lgya_ | 265 | Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 | 90.17 | |
| d1rp1a2 | 337 | Pancreatic lipase, N-terminal domain {Dog (Canis f | 89.76 | |
| d1ea5a_ | 532 | Acetylcholinesterase {Pacific electric ray (Torped | 89.37 | |
| d1tiaa_ | 271 | Triacylglycerol lipase {Penicillium camembertii [T | 88.83 | |
| d1tiba_ | 269 | Triacylglycerol lipase {Thermomyces lanuginosus, f | 88.26 | |
| d3tgla_ | 265 | Triacylglycerol lipase {Rhizomucor miehei [TaxId: | 87.88 | |
| d2h7ca1 | 532 | Mammalian carboxylesterase (liver carboxylesterase | 87.54 | |
| d2d81a1 | 318 | Polyhydroxybutyrate depolymerase {Penicillium funi | 86.53 | |
| d1bu8a2 | 338 | Pancreatic lipase, N-terminal domain {Rat (Rattus | 86.04 | |
| d2bcea_ | 579 | Bile-salt activated lipase (cholesterol esterase) | 83.26 |
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Proline iminopeptidase-like domain: Tricorn interacting factor F1 species: Archaeon Thermoplasma acidophilum [TaxId: 2303]
Probab=99.04 E-value=5.7e-10 Score=102.67 Aligned_cols=105 Identities=19% Similarity=0.241 Sum_probs=77.2
Q ss_pred CCCEEEEe-CCCCCCCccccccccccCcccccCCeEEEEecceeecCCCCCChhhhhccCCccccCChHhhHHHHHHHHH
Q 012711 49 SAPIFVYL-GAEGSLDEDLDVAGFLPDNAPRFKALLVYIEHRYYGKSVPFGSREEAMKNASTLGYFNSAQAIADYADVLL 127 (458)
Q Consensus 49 ~~pi~l~~-gge~~~~~~~~~~~~~~~~A~~~~a~~v~~EhR~yG~S~P~~~~s~~~~~~~nl~ylt~~Qal~D~~~f~~ 127 (458)
++|++|++ |+.|...... ..+..+++ .|..||++++|+||.|.+... . -.|+++.++|+..+++
T Consensus 24 ~~~~iv~lHG~~g~~~~~~---~~~~~~~~-~~~~vi~~D~~G~G~S~~~~~--------~---~~~~~~~~~~l~~ll~ 88 (290)
T d1mtza_ 24 EKAKLMTMHGGPGMSHDYL---LSLRDMTK-EGITVLFYDQFGCGRSEEPDQ--------S---KFTIDYGVEEAEALRS 88 (290)
T ss_dssp CSEEEEEECCTTTCCSGGG---GGGGGGGG-GTEEEEEECCTTSTTSCCCCG--------G---GCSHHHHHHHHHHHHH
T ss_pred CCCeEEEECCCCCchHHHH---HHHHHHHH-CCCEEEEEeCCCCcccccccc--------c---cccccchhhhhhhhhc
Confidence 45655555 6555544322 22334443 367899999999999976321 1 2589999999999988
Q ss_pred HHHhhcCCCCCCEEEeccChhHHHHHHHHHhcCceEEEEEeccccc
Q 012711 128 HIKKKYSAERSPSIVVGGSYGGMLAAWFRLKYPHIALGALASSAPI 173 (458)
Q Consensus 128 ~~~~~~~~~~~~~i~~GgSy~G~laa~~r~kyP~~~~~~iassapv 173 (458)
++.. ..|++++|+|+||.+|..+..+||+.|.+.+..+++.
T Consensus 89 ~l~~-----~~~~~lvGhS~Gg~ia~~~a~~~p~~v~~lvl~~~~~ 129 (290)
T d1mtza_ 89 KLFG-----NEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLS 129 (290)
T ss_dssp HHHT-----TCCEEEEEETHHHHHHHHHHHHHGGGEEEEEEESCCS
T ss_pred cccc-----ccccceecccccchhhhhhhhcChhhheeeeeccccc
Confidence 7742 2589999999999999999999999999988766443
|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} | Back information, alignment and structure |
|---|
| >d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} | Back information, alignment and structure |
|---|
| >d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} | Back information, alignment and structure |
|---|
| >d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} | Back information, alignment and structure |
|---|
| >d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} | Back information, alignment and structure |
|---|
| >d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} | Back information, alignment and structure |
|---|
| >d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} | Back information, alignment and structure |
|---|
| >d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} | Back information, alignment and structure |
|---|
| >d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} | Back information, alignment and structure |
|---|
| >d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} | Back information, alignment and structure |
|---|
| >d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} | Back information, alignment and structure |
|---|
| >d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} | Back information, alignment and structure |
|---|
| >d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} | Back information, alignment and structure |
|---|
| >d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} | Back information, alignment and structure |
|---|
| >d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} | Back information, alignment and structure |
|---|
| >d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|