Citrus Sinensis ID: 012750


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------
MTEAFIHSHSHSQKLIHSFIHILLFKSPISGFSSLLTCFESFRIIVMNALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERLTRVFTQKIHDLIGIHTDIPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGREAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGGKVIAVSDITGAVKNADGIDIHKLLAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENAADVKAKFIIEAANHPTDPEADEILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEEDKVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRVARATTLRGWEA
ccHHHHcHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHcccccEEEEEEEEEcccccEEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccEEccccccccccccccccHHHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccEEEccccccHHHHHHHHHHccccccccccccccccccccccccEEEcccccccccccccccccccEEEEcccccccHHHHHHHHHcccEEEcccccccccEEEHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccc
cccHEEcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccccHHHHHHcccccEEEEEEEEEEcccccEEEEEEEEEEEEcccccEEccEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHccHHHHHHHHHHHHHHcHHHcEcccEEccEcccccHHHHHHHHHHHHHHHcccHHHcccccHHHccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHHHccccEEEEEEEccEEEEccccccHHHHHHHHHHHcccccccccEEEcHHHHHcccccEEEEccccccEcHHHHccccccEEEccccccEcHHHHHHHHHcccEEEcHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccc
mteafihshshSQKLIHSFIHILLfkspisgfssLLTCFESFRIIVMNALAATSRNFRNAARILGLDsklersllipfreikvectipkddgslvsyvgfrvqhdnargpmkggiryhpevdpdEVNALAQLMTWKTAvadipyggakggigcspkelsnsELERLTRVFTQKIHDligihtdipapdmgtnAQTMAWILDEYskfhghspavvtgkpidlggslgreaatgrGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGGKVIAVSDItgavknadgidIHKLLAhkdktgslkdfdggdsmepsellahecdvlipcalggvlkrenaaDVKAKFIIEaanhptdpeadeilskrgvtilpdiyansggvtVSYFEWVQNIQGFMWEEDKVNNELRRYMIRAFHNIKGMcqthncnlrmgAFTLGVNRVARATTLRGWEA
MTEAFIHSHSHSQKLIHSFIHILLFKSPISGFSSLLTCFESFRIIVMNALAATSRNFRNAARIlgldsklerslLIPFreikvectipkddgslVSYVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERLTRVFTQKIHDLIGIHTDIPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGREAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGGKVIAVSDITGAVKNADGIDIHKLLAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENAADVKAKFIIEaanhptdpeadEILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEEDKVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRVARATTLRGWEA
MTEAFIHSHSHSQKLIHSFIHILLFKSPISGFSSLLTCFESFRIIVMNALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERLTRVFTQKIHDLIGIHTDIPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGREAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGGKVIAVSDITGAVKNADGIDIHKLLAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENAADVKAKFIIEAANHPTDPEADEILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEEDKVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRVARATTLRGWEA
************QKLIHSFIHILLFKSPISGFSSLLTCFESFRIIVMNALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERLTRVFTQKIHDLIGIHTDIPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGREAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGGKVIAVSDITGAVKNADGIDIHKLLAHK*******************LLAHECDVLIPCALGGVLKRENAADVKAKFIIEAANH******DEILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEEDKVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRVARATTLR****
**************LIHSFIHI******************SFRIIVMNALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERLTRVFTQKIHDLIGIHTDIPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGREAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGGKVIAVSDITGAVKNADGIDIHKLLAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENAADVKAKFIIEAANHPTDPEADEILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEEDKVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRVARATTLRGWEA
*************KLIHSFIHILLFKSPISGFSSLLTCFESFRIIVMNALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERLTRVFTQKIHDLIGIHTDIPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGREAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGGKVIAVSDITGAVKNADGIDIHKLLAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENAADVKAKFIIEAANHPTDPEADEILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEEDKVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRVARATTLRGWEA
***AFIHSHSHSQKLIHSFIHILLFKSPISGFSSLLTCFESFRIIVMNALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERLTRVFTQKIHDLIGIHTDIPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGREAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGGKVIAVSDITGAVKNADGIDIHKLLAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENAADVKAKFIIEAANHPTDPEADEILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEEDKVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRVARATTLR*W**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEAFIHSHSHSQKLIHSFIHILLFKSPISGFSSLLTCFESFRIIVMNALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERLTRVFTQKIHDLIGIHTDIPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGREAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGGKVIAVSDITGAVKNADGIDIHKLLAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENAADVKAKFIIEAANHPTDPEADEILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEEDKVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRVARATTLRGWEA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query457 2.2.26 [Sep-21-2011]
Q38946411 Glutamate dehydrogenase 2 yes no 0.899 1.0 0.868 0.0
O04937411 Glutamate dehydrogenase A N/A no 0.899 1.0 0.871 0.0
P52596411 Glutamate dehydrogenase O yes no 0.899 1.0 0.866 0.0
Q43260411 Glutamate dehydrogenase O N/A no 0.899 1.0 0.812 0.0
Q9LEC8411 Glutamate dehydrogenase B N/A no 0.899 1.0 0.793 0.0
Q43314411 Glutamate dehydrogenase 1 no no 0.899 1.0 0.798 0.0
Q9S7A0411 Probable glutamate dehydr no no 0.894 0.995 0.789 0.0
P93541412 Glutamate dehydrogenase O N/A no 0.899 0.997 0.793 0.0
P96110416 Glutamate dehydrogenase O yes no 0.873 0.959 0.488 1e-107
P39633424 Catabolic NAD-specific gl yes no 0.892 0.962 0.429 1e-101
>sp|Q38946|DHE2_ARATH Glutamate dehydrogenase 2 OS=Arabidopsis thaliana GN=GDH2 PE=1 SV=1 Back     alignment and function desciption
 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/411 (86%), Positives = 392/411 (95%)

Query: 47  MNALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN 106
           MNALAAT+RNFR+A+RILGLDSK+ERSL+IPFREIKVECTIPKDDG+LVSY+GFRVQHDN
Sbjct: 1   MNALAATNRNFRHASRILGLDSKIERSLMIPFREIKVECTIPKDDGTLVSYIGFRVQHDN 60

Query: 107 ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERL 166
           ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSP++LS SELERL
Sbjct: 61  ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPRDLSLSELERL 120

Query: 167 TRVFTQKIHDLIGIHTDIPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG 226
           TRVFTQKIHDLIGIHTD+PAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG
Sbjct: 121 TRVFTQKIHDLIGIHTDVPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG 180

Query: 227 REAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGGKVIAVSDITG 286
           REAATGRGVV+ATEALLAE+G++I+ LTFVIQGFGNVG+WAA+LIHE+GGKV+AVSDITG
Sbjct: 181 REAATGRGVVFATEALLAEYGKSIQGLTFVIQGFGNVGTWAAKLIHEKGGKVVAVSDITG 240

Query: 287 AVKNADGIDIHKLLAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENAA 346
           A++N +GIDI+ L+ HKD TGSL DF+GGD+M   ELL HECDVLIPCALGGVL +ENA 
Sbjct: 241 AIRNPEGIDINALIKHKDATGSLNDFNGGDAMNSDELLIHECDVLIPCALGGVLNKENAG 300

Query: 347 DVKAKFIIEAANHPTDPEADEILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEED 406
           DVKAKFI+EAANHPTDP+ADEILSK+GV ILPDIYAN+GGVTVSYFEWVQNIQGFMWEE+
Sbjct: 301 DVKAKFIVEAANHPTDPDADEILSKKGVIILPDIYANAGGVTVSYFEWVQNIQGFMWEEE 360

Query: 407 KVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRVARATTLRGWEA 457
           KVN EL++YM RAFHNIK MC TH+CNLRMGAFTLGVNRVARAT LRGWEA
Sbjct: 361 KVNLELQKYMTRAFHNIKTMCHTHSCNLRMGAFTLGVNRVARATQLRGWEA 411





Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 4EC: .EC: 1EC: .EC: 3
>sp|O04937|DHEA_NICPL Glutamate dehydrogenase A OS=Nicotiana plumbaginifolia GN=GDHA PE=2 SV=1 Back     alignment and function description
>sp|P52596|DHE3_VITVI Glutamate dehydrogenase OS=Vitis vinifera GN=GDH PE=2 SV=1 Back     alignment and function description
>sp|Q43260|DHE3_MAIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LEC8|DHEB_NICPL Glutamate dehydrogenase B OS=Nicotiana plumbaginifolia GN=GDHB PE=2 SV=1 Back     alignment and function description
>sp|Q43314|DHE1_ARATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 Back     alignment and function description
>sp|Q9S7A0|DHE3_ARATH Probable glutamate dehydrogenase 3 OS=Arabidopsis thaliana GN=GSH3 PE=1 SV=1 Back     alignment and function description
>sp|P93541|DHE3_SOLLC Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1 Back     alignment and function description
>sp|P96110|DHE3_THEMA Glutamate dehydrogenase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gdhA PE=1 SV=4 Back     alignment and function description
>sp|P39633|DHE2_BACSU Catabolic NAD-specific glutamate dehydrogenase RocG OS=Bacillus subtilis (strain 168) GN=rocG PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query457
224114668411 predicted protein [Populus trichocarpa] 0.899 1.0 0.878 0.0
449458315411 PREDICTED: glutamate dehydrogenase 2-lik 0.899 1.0 0.875 0.0
255539945411 glutamate dehydrogenase, putative [Ricin 0.899 1.0 0.883 0.0
149938958411 GDH2 [Actinidia chinensis] 0.899 1.0 0.878 0.0
449451836411 PREDICTED: glutamate dehydrogenase 2-lik 0.899 1.0 0.875 0.0
15240793411 glutamate dehydrogenase 2 [Arabidopsis t 0.899 1.0 0.868 0.0
224134280411 predicted protein [Populus trichocarpa] 0.899 1.0 0.868 0.0
272725401411 GDH2 [Camellia sinensis] 0.899 1.0 0.873 0.0
15004984411 glutamate dehydrogenase [Brassica napus] 0.899 1.0 0.866 0.0
225454888411 PREDICTED: glutamate dehydrogenase [Viti 0.899 1.0 0.868 0.0
>gi|224114668|ref|XP_002339508.1| predicted protein [Populus trichocarpa] gi|222832584|gb|EEE71061.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/411 (87%), Positives = 392/411 (95%)

Query: 47  MNALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN 106
           MNALAATSRNFR+A+R+LGLDSK+E+SLLIPFREIKVECTIPKDDG+LVSYVGFRVQHDN
Sbjct: 1   MNALAATSRNFRHASRLLGLDSKVEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN 60

Query: 107 ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERL 166
           ARGPMKGGIRYHPEVDPDEVNALAQLMTWK+AVADIPYGGAKGGIGC+P +LS SELERL
Sbjct: 61  ARGPMKGGIRYHPEVDPDEVNALAQLMTWKSAVADIPYGGAKGGIGCNPGDLSKSELERL 120

Query: 167 TRVFTQKIHDLIGIHTDIPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG 226
           TRVFTQKIHDLIG+HTD+PAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG
Sbjct: 121 TRVFTQKIHDLIGVHTDVPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG 180

Query: 227 REAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGGKVIAVSDITG 286
           REAATGRGVV+ATEALLAEHG++I+DLTF IQGFGNVGSWAA+LIHERGGKVIAVSDITG
Sbjct: 181 REAATGRGVVFATEALLAEHGKSIKDLTFAIQGFGNVGSWAAKLIHERGGKVIAVSDITG 240

Query: 287 AVKNADGIDIHKLLAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENAA 346
           AVKN +GIDI +LL HK+ TGSLKDF G +SM+ +ELL H+CDVLIPCALGGVL RENAA
Sbjct: 241 AVKNPNGIDIPELLRHKETTGSLKDFQGAESMDANELLIHKCDVLIPCALGGVLNRENAA 300

Query: 347 DVKAKFIIEAANHPTDPEADEILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEED 406
           DVKAKFIIEAANHPTDPEADEIL+K+GV +LPDIYANSGGVTVSYFEWVQNIQGFMW+E 
Sbjct: 301 DVKAKFIIEAANHPTDPEADEILAKKGVVVLPDIYANSGGVTVSYFEWVQNIQGFMWDEQ 360

Query: 407 KVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRVARATTLRGWEA 457
           +VNN L+ YM RAFHNIK MCQTH+CNLRMGAFTLGV+RVARAT LRGWEA
Sbjct: 361 QVNNTLQNYMTRAFHNIKSMCQTHDCNLRMGAFTLGVSRVARATLLRGWEA 411




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449458315|ref|XP_004146893.1| PREDICTED: glutamate dehydrogenase 2-like [Cucumis sativus] gi|449528457|ref|XP_004171221.1| PREDICTED: glutamate dehydrogenase 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255539945|ref|XP_002511037.1| glutamate dehydrogenase, putative [Ricinus communis] gi|223550152|gb|EEF51639.1| glutamate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|149938958|gb|ABR45724.1| GDH2 [Actinidia chinensis] Back     alignment and taxonomy information
>gi|449451836|ref|XP_004143666.1| PREDICTED: glutamate dehydrogenase 2-like [Cucumis sativus] gi|449488611|ref|XP_004158111.1| PREDICTED: LOW QUALITY PROTEIN: glutamate dehydrogenase 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15240793|ref|NP_196361.1| glutamate dehydrogenase 2 [Arabidopsis thaliana] gi|186521018|ref|NP_001119183.1| glutamate dehydrogenase 2 [Arabidopsis thaliana] gi|297806777|ref|XP_002871272.1| hypothetical protein ARALYDRAFT_487575 [Arabidopsis lyrata subsp. lyrata] gi|12229806|sp|Q38946.1|DHE2_ARATH RecName: Full=Glutamate dehydrogenase 2; Short=GDH 2 gi|1336084|gb|AAB01222.1| glutamate dehydrogenase 2 [Arabidopsis thaliana] gi|7576182|emb|CAB87933.1| glutamate dehydrogenase 2 [Arabidopsis thaliana] gi|297317109|gb|EFH47531.1| hypothetical protein ARALYDRAFT_487575 [Arabidopsis lyrata subsp. lyrata] gi|332003774|gb|AED91157.1| glutamate dehydrogenase 2 [Arabidopsis thaliana] gi|332003775|gb|AED91158.1| glutamate dehydrogenase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224134280|ref|XP_002321781.1| predicted protein [Populus trichocarpa] gi|222868777|gb|EEF05908.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|272725401|gb|ACH97123.2| GDH2 [Camellia sinensis] Back     alignment and taxonomy information
>gi|15004984|dbj|BAB62170.1| glutamate dehydrogenase [Brassica napus] gi|77019565|dbj|BAE45943.1| glutamate dehydrogenase 2 [Brassica napus] Back     alignment and taxonomy information
>gi|225454888|ref|XP_002278945.1| PREDICTED: glutamate dehydrogenase [Vitis vinifera] gi|11691872|emb|CAC18730.1| NADH glutamate dehydrogenase [Vitis vinifera] gi|147765649|emb|CAN69242.1| hypothetical protein VITISV_042232 [Vitis vinifera] gi|297737388|emb|CBI26589.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query457
TAIR|locus:2183379411 GDH2 "glutamate dehydrogenase 0.899 1.0 0.868 2.2e-199
TAIR|locus:2172309411 GDH1 "glutamate dehydrogenase 0.899 1.0 0.798 2.6e-182
TAIR|locus:2079364411 GDH3 "glutamate dehydrogenase 0.894 0.995 0.789 5.4e-182
UNIPROTKB|Q5HHC7414 gluD "NAD-specific glutamate d 0.888 0.980 0.424 1e-93
UNIPROTKB|Q6GAW8414 gluD "NAD-specific glutamate d 0.888 0.980 0.424 1e-93
UNIPROTKB|Q6GID0414 gluD "NAD-specific glutamate d 0.888 0.980 0.424 1e-93
UNIPROTKB|Q7A1B9414 gluD "NAD-specific glutamate d 0.888 0.980 0.424 1e-93
UNIPROTKB|Q7A6H8414 gluD "NAD-specific glutamate d 0.888 0.980 0.424 1e-93
UNIPROTKB|Q99VD0414 gluD "NAD-specific glutamate d 0.888 0.980 0.424 1e-93
TIGR_CMR|BA_1511428 BA_1511 "glutamate dehydrogena 0.884 0.943 0.441 9e-93
TAIR|locus:2183379 GDH2 "glutamate dehydrogenase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1930 (684.5 bits), Expect = 2.2e-199, P = 2.2e-199
 Identities = 357/411 (86%), Positives = 392/411 (95%)

Query:    47 MNALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN 106
             MNALAAT+RNFR+A+RILGLDSK+ERSL+IPFREIKVECTIPKDDG+LVSY+GFRVQHDN
Sbjct:     1 MNALAATNRNFRHASRILGLDSKIERSLMIPFREIKVECTIPKDDGTLVSYIGFRVQHDN 60

Query:   107 ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERL 166
             ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSP++LS SELERL
Sbjct:    61 ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPRDLSLSELERL 120

Query:   167 TRVFTQKIHDLIGIHTDIPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG 226
             TRVFTQKIHDLIGIHTD+PAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG
Sbjct:   121 TRVFTQKIHDLIGIHTDVPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG 180

Query:   227 REAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGGKVIAVSDITG 286
             REAATGRGVV+ATEALLAE+G++I+ LTFVIQGFGNVG+WAA+LIHE+GGKV+AVSDITG
Sbjct:   181 REAATGRGVVFATEALLAEYGKSIQGLTFVIQGFGNVGTWAAKLIHEKGGKVVAVSDITG 240

Query:   287 AVKNADGIDIHKLLAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENAA 346
             A++N +GIDI+ L+ HKD TGSL DF+GGD+M   ELL HECDVLIPCALGGVL +ENA 
Sbjct:   241 AIRNPEGIDINALIKHKDATGSLNDFNGGDAMNSDELLIHECDVLIPCALGGVLNKENAG 300

Query:   347 DVKAKFIIEAANHPTDPEADEILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEED 406
             DVKAKFI+EAANHPTDP+ADEILSK+GV ILPDIYAN+GGVTVSYFEWVQNIQGFMWEE+
Sbjct:   301 DVKAKFIVEAANHPTDPDADEILSKKGVIILPDIYANAGGVTVSYFEWVQNIQGFMWEEE 360

Query:   407 KVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRVARATTLRGWEA 457
             KVN EL++YM RAFHNIK MC TH+CNLRMGAFTLGVNRVARAT LRGWEA
Sbjct:   361 KVNLELQKYMTRAFHNIKTMCHTHSCNLRMGAFTLGVNRVARATQLRGWEA 411




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0016639 "oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005524 "ATP binding" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0009651 "response to salt stress" evidence=IEP
GO:0004352 "glutamate dehydrogenase (NAD+) activity" evidence=IDA
GO:0005507 "copper ion binding" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IDA
GO:0050897 "cobalt ion binding" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006598 "polyamine catabolic process" evidence=RCA
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0009698 "phenylpropanoid metabolic process" evidence=RCA
GO:0042398 "cellular modified amino acid biosynthetic process" evidence=RCA
GO:0046482 "para-aminobenzoic acid metabolic process" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
GO:0004353 "glutamate dehydrogenase [NAD(P)+
TAIR|locus:2172309 GDH1 "glutamate dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079364 GDH3 "glutamate dehydrogenase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5HHC7 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus COL (taxid:93062)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GAW8 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus MSSA476 (taxid:282459)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GID0 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus MRSA252 (taxid:282458)] Back     alignment and assigned GO terms
UNIPROTKB|Q7A1B9 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus MW2 (taxid:196620)] Back     alignment and assigned GO terms
UNIPROTKB|Q7A6H8 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus N315 (taxid:158879)] Back     alignment and assigned GO terms
UNIPROTKB|Q99VD0 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus Mu50 (taxid:158878)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1511 BA_1511 "glutamate dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P52596DHE3_VITVI1, ., 4, ., 1, ., 30.86610.89931.0yesno
P96110DHE3_THEMA1, ., 4, ., 1, ., 30.48870.87300.9591yesno
Q6GID0DHE2_STAAR1, ., 4, ., 1, ., 20.42430.88840.9806yesno
Q43260DHE3_MAIZE1, ., 4, ., 1, ., 30.81260.89931.0N/Ano
Q38946DHE2_ARATH1, ., 4, ., 1, ., 30.86860.89931.0yesno
Q9YC65DHE3_AERPE1, ., 4, ., 1, ., 30.40430.89270.9760yesno
P39633DHE2_BACSU1, ., 4, ., 1, ., 20.42920.89270.9622yesno
Q7A1B9DHE2_STAAW1, ., 4, ., 1, ., 20.42430.88840.9806yesno
P29051DHE41_HALSI1, ., 4, ., 1, ., 20.44600.88840.9333yesno
Q5HHC7DHE2_STAAC1, ., 4, ., 1, ., 20.42430.88840.9806yesno
P27346DHE2_CLODI1, ., 4, ., 1, ., 20.42400.89490.9714yesno
Q47950DHE3_PYRAB1, ., 4, ., 1, ., 30.44820.87740.9547yesno
Q7A6H8DHE2_STAAN1, ., 4, ., 1, ., 20.42430.88840.9806yesno
O59650DHE3_PYRKO1, ., 4, ., 1, ., 30.42580.90150.9786yesno
P93541DHE3_SOLLC1, ., 4, ., 1, ., 30.79360.89930.9975N/Ano
P94598DHE3_BACTN1, ., 4, ., 1, ., 30.32410.83150.8558yesno
P80319DHE3_PYRFU1, ., 4, ., 1, ., 30.45070.87740.9547yesno
P0CL72DHE3_PYRHR1, ., 4, ., 1, ., 30.44330.87740.9547yesno
P0CL73DHE3_PYRHO1, ., 4, ., 1, ., 30.44330.87740.9547yesno
Q9S7A0DHE3_ARATH1, ., 4, ., 1, ., 30.78970.89490.9951nono
Q43314DHE1_ARATH1, ., 4, ., 1, ., 30.79800.89931.0nono
Q6GAW8DHE2_STAAS1, ., 4, ., 1, ., 20.42430.88840.9806yesno
Q9LEC8DHEB_NICPL1, ., 4, ., 1, ., 30.79310.89931.0N/Ano
Q99VD0DHE2_STAAM1, ., 4, ., 1, ., 20.42430.88840.9806yesno
P80053DHE2_SULSO1, ., 4, ., 1, ., 30.42670.87520.9523yesno
O04937DHEA_NICPL1, ., 4, ., 1, ., 30.87100.89931.0N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.4.10.983
3rd Layer1.4.1.30.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query457
PLN02477410 PLN02477, PLN02477, glutamate dehydrogenase 0.0
COG0334411 COG0334, GdhA, Glutamate dehydrogenase/leucine deh 1e-180
cd01076227 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain 1e-119
pfam00208237 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenyl 1e-104
PRK14031444 PRK14031, PRK14031, glutamate dehydrogenase; Provi 1e-64
PRK09414445 PRK09414, PRK09414, glutamate dehydrogenase; Provi 6e-63
pfam02812131 pfam02812, ELFV_dehydrog_N, Glu/Leu/Phe/Val dehydr 1e-62
cd05211217 cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding 3e-59
PTZ00079454 PTZ00079, PTZ00079, NADP-specific glutamate dehydr 9e-59
PRK14030445 PRK14030, PRK14030, glutamate dehydrogenase; Provi 3e-53
cd05313254 cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain 9e-38
smart00839102 smart00839, ELFV_dehydrog, Glutamate/Leucine/Pheny 1e-33
cd01075200 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding d 6e-23
PTZ003241002 PTZ00324, PTZ00324, glutamate dehydrogenase 2; Pro 2e-10
PRK06270 341 PRK06270, PRK06270, homoserine dehydrogenase; Prov 5e-08
cd0519186 cd05191, NAD_bind_amino_acid_DH, NAD(P) binding do 3e-06
PRK06392 326 PRK06392, PRK06392, homoserine dehydrogenase; Prov 3e-04
cd12186329 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydr 0.004
>gnl|CDD|178095 PLN02477, PLN02477, glutamate dehydrogenase Back     alignment and domain information
 Score =  836 bits (2162), Expect = 0.0
 Identities = 342/410 (83%), Positives = 374/410 (91%)

Query: 47  MNALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN 106
           MNALAAT+RNFR AAR+LGLDSKLE+SLLIPFREIKVECTIPKDDG+L S+VGFRVQHDN
Sbjct: 1   MNALAATNRNFREAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN 60

Query: 107 ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERL 166
           ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVA+IPYGGAKGGIGC P++LS SELERL
Sbjct: 61  ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCDPRDLSESELERL 120

Query: 167 TRVFTQKIHDLIGIHTDIPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG 226
           TRVFTQKIHDLIGIHTD+PAPDMGTNAQTMAWILDEYSKFHG SPAVVTGKPIDLGGSLG
Sbjct: 121 TRVFTQKIHDLIGIHTDVPAPDMGTNAQTMAWILDEYSKFHGFSPAVVTGKPIDLGGSLG 180

Query: 227 REAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGGKVIAVSDITG 286
           REAATGRGVV+ATEALLAEHG++I   TFVIQGFGNVGSWAA+LIHE+GGK++AVSDITG
Sbjct: 181 REAATGRGVVFATEALLAEHGKSIAGQTFVIQGFGNVGSWAAQLIHEKGGKIVAVSDITG 240

Query: 287 AVKNADGIDIHKLLAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENAA 346
           AVKN +G+DI  L  H  + G LK F GGD ++P ++L   CDVLIP ALGGV+ +ENAA
Sbjct: 241 AVKNENGLDIPALRKHVAEGGGLKGFPGGDPIDPDDILVEPCDVLIPAALGGVINKENAA 300

Query: 347 DVKAKFIIEAANHPTDPEADEILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEED 406
           DVKAKFI+EAANHPTDPEADEIL K+GV +LPDIYANSGGVTVSYFEWVQNIQGFMWEE+
Sbjct: 301 DVKAKFIVEAANHPTDPEADEILRKKGVVVLPDIYANSGGVTVSYFEWVQNIQGFMWEEE 360

Query: 407 KVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRVARATTLRGWE 456
           KVN EL RYM  AF  +K MC+THNC+LRMGAFTLGVNRVARAT LRGWE
Sbjct: 361 KVNRELDRYMTDAFKALKEMCKTHNCSLRMGAFTLGVNRVARATVLRGWE 410


Length = 410

>gnl|CDD|223411 COG0334, GdhA, Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|133445 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>gnl|CDD|215789 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>gnl|CDD|184464 PRK14031, PRK14031, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181834 PRK09414, PRK09414, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|202408 pfam02812, ELFV_dehydrog_N, Glu/Leu/Phe/Val dehydrogenase, dimerisation domain Back     alignment and domain information
>gnl|CDD|133450 cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>gnl|CDD|185433 PTZ00079, PTZ00079, NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184463 PRK14030, PRK14030, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133455 cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>gnl|CDD|214847 smart00839, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>gnl|CDD|133444 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>gnl|CDD|240359 PTZ00324, PTZ00324, glutamate dehydrogenase 2; Provisional Back     alignment and domain information
>gnl|CDD|235763 PRK06270, PRK06270, homoserine dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133449 cd05191, NAD_bind_amino_acid_DH, NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>gnl|CDD|102354 PRK06392, PRK06392, homoserine dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240662 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydroxyisocaproic acid dehydrogenase (D-HicDH), NAD-binding and catalytic domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 457
PLN02477410 glutamate dehydrogenase 100.0
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 100.0
PRK14030445 glutamate dehydrogenase; Provisional 100.0
PRK09414445 glutamate dehydrogenase; Provisional 100.0
PRK14031444 glutamate dehydrogenase; Provisional 100.0
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 100.0
KOG2250514 consensus Glutamate/leucine/phenylalanine/valine d 100.0
PTZ003241002 glutamate dehydrogenase 2; Provisional 100.0
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 100.0
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 100.0
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 100.0
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 100.0
PF02812131 ELFV_dehydrog_N: Glu/Leu/Phe/Val dehydrogenase, di 100.0
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 100.0
PF05088 1528 Bac_GDH: Bacterial NAD-glutamate dehydrogenase 100.0
COG2902 1592 NAD-specific glutamate dehydrogenase [Amino acid t 100.0
smart00839102 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Vali 99.96
PRK08374 336 homoserine dehydrogenase; Provisional 99.28
PRK06392 326 homoserine dehydrogenase; Provisional 99.08
PRK06270 341 homoserine dehydrogenase; Provisional 98.71
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.65
PLN02700 377 homoserine dehydrogenase family protein 98.25
PRK06813 346 homoserine dehydrogenase; Validated 98.05
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.85
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.81
COG0460 333 ThrA Homoserine dehydrogenase [Amino acid transpor 97.74
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.69
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 97.6
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.51
PRK09466 810 metL bifunctional aspartate kinase II/homoserine d 97.4
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.34
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.33
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 97.3
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.22
PTZ00075476 Adenosylhomocysteinase; Provisional 97.16
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 97.05
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.04
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.02
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 96.99
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 96.91
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.85
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 96.8
PRK13243333 glyoxylate reductase; Reviewed 96.75
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 96.73
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.72
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.69
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 96.66
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.65
PLN02494477 adenosylhomocysteinase 96.64
PRK00676338 hemA glutamyl-tRNA reductase; Validated 96.6
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.57
PLN03129581 NADP-dependent malic enzyme; Provisional 96.5
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.47
PRK06932314 glycerate dehydrogenase; Provisional 96.45
PRK12861 764 malic enzyme; Reviewed 96.43
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 96.43
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.4
PRK07574385 formate dehydrogenase; Provisional 96.39
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 96.36
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 96.32
PLN02928347 oxidoreductase family protein 96.3
COG0281432 SfcA Malic enzyme [Energy production and conversio 96.26
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 96.24
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 96.23
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.2
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 96.16
PLN03139386 formate dehydrogenase; Provisional 96.15
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 96.14
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 96.12
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 96.04
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 96.03
PRK00048257 dihydrodipicolinate reductase; Provisional 96.0
PRK13529563 malate dehydrogenase; Provisional 95.99
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.99
PRK06436303 glycerate dehydrogenase; Provisional 95.97
PRK13302271 putative L-aspartate dehydrogenase; Provisional 95.92
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 95.92
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 95.9
PRK06487317 glycerate dehydrogenase; Provisional 95.89
PRK13940414 glutamyl-tRNA reductase; Provisional 95.88
PRK12549284 shikimate 5-dehydrogenase; Reviewed 95.81
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.81
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 95.78
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 95.77
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 95.75
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 95.74
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.72
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 95.68
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.68
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 95.68
PTZ00317559 NADP-dependent malic enzyme; Provisional 95.68
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.67
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.65
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.64
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 95.62
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.6
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 95.58
PLN00203519 glutamyl-tRNA reductase 95.54
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 95.52
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.5
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 95.49
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.45
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.43
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.41
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.39
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.39
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 95.35
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 95.33
PRK13304265 L-aspartate dehydrogenase; Reviewed 95.31
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 95.3
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 95.27
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 95.26
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 95.26
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 95.24
PRK12862 763 malic enzyme; Reviewed 95.23
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 95.21
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 95.16
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.09
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 95.03
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.0
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.96
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 94.88
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 94.87
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.87
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 94.86
TIGR01532 325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 94.85
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 94.84
COG0057 335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 94.79
PRK06349 426 homoserine dehydrogenase; Provisional 94.76
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 94.63
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 94.58
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.54
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 94.47
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 94.47
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 94.45
PRK13535 336 erythrose 4-phosphate dehydrogenase; Provisional 94.4
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 94.23
PRK08328231 hypothetical protein; Provisional 94.22
PRK08223287 hypothetical protein; Validated 94.09
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.09
COG2085211 Predicted dinucleotide-binding enzymes [General fu 94.07
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.04
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 94.03
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 94.01
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 93.99
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 93.95
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.8
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 93.8
PLN02272 421 glyceraldehyde-3-phosphate dehydrogenase 93.79
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 93.76
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 93.76
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.63
PRK07680273 late competence protein ComER; Validated 93.51
PLN02358 338 glyceraldehyde-3-phosphate dehydrogenase 93.51
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 93.47
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 93.47
COG0569225 TrkA K+ transport systems, NAD-binding component [ 93.46
TIGR01534 327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 93.33
KOG2018 430 consensus Predicted dinucleotide-utilizing enzyme 93.33
PRK15425 331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 93.27
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 93.15
PRK12480330 D-lactate dehydrogenase; Provisional 93.15
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 93.13
PRK13301267 putative L-aspartate dehydrogenase; Provisional 93.09
KOG1370434 consensus S-adenosylhomocysteine hydrolase [Coenzy 93.08
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 93.04
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 93.01
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 92.93
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 92.84
TIGR00036266 dapB dihydrodipicolinate reductase. 92.83
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.8
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 92.79
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 92.72
PLN03096 395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 92.62
PRK15059292 tartronate semialdehyde reductase; Provisional 92.56
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.53
PRK06719157 precorrin-2 dehydrogenase; Validated 92.49
PRK14027283 quinate/shikimate dehydrogenase; Provisional 92.41
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 92.39
PRK14851 679 hypothetical protein; Provisional 92.38
PRK07340304 ornithine cyclodeaminase; Validated 92.36
PRK12548289 shikimate 5-dehydrogenase; Provisional 92.33
PRK03659601 glutathione-regulated potassium-efflux system prot 92.3
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 92.07
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 91.99
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 91.97
PRK06718202 precorrin-2 dehydrogenase; Reviewed 91.92
PLN02306386 hydroxypyruvate reductase 91.84
PRK07877 722 hypothetical protein; Provisional 91.66
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 91.56
PRK13403 335 ketol-acid reductoisomerase; Provisional 91.46
PRK07729 343 glyceraldehyde-3-phosphate dehydrogenase; Validate 91.4
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 91.39
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 91.34
COG5322351 Predicted dehydrogenase [General function predicti 91.29
PTZ00023 337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 91.28
PRK05479 330 ketol-acid reductoisomerase; Provisional 91.27
PRK07403 337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 91.22
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 91.17
PRK06567 1028 putative bifunctional glutamate synthase subunit b 91.16
COG2344211 AT-rich DNA-binding protein [General function pred 91.15
PRK14852 989 hypothetical protein; Provisional 91.14
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 91.09
PRK12550272 shikimate 5-dehydrogenase; Reviewed 90.99
PRK06141314 ornithine cyclodeaminase; Validated 90.99
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 90.77
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 90.68
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 90.64
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 90.62
PRK08300302 acetaldehyde dehydrogenase; Validated 90.56
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 90.14
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 90.13
cd01483143 E1_enzyme_family Superfamily of activating enzymes 90.06
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.87
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 89.85
PRK14982340 acyl-ACP reductase; Provisional 89.84
PRK13303265 L-aspartate dehydrogenase; Provisional 89.83
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 89.82
PRK08605332 D-lactate dehydrogenase; Validated 89.81
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 89.8
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 89.79
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 89.74
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 89.73
PTZ00353 342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 89.59
PRK08289 477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 89.55
KOG0409327 consensus Predicted dehydrogenase [General functio 89.53
PRK03562621 glutathione-regulated potassium-efflux system prot 89.38
PRK08955 334 glyceraldehyde-3-phosphate dehydrogenase; Validate 89.25
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.18
PLN02688266 pyrroline-5-carboxylate reductase 89.11
PLN02858 1378 fructose-bisphosphate aldolase 88.76
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 88.5
PRK10669558 putative cation:proton antiport protein; Provision 88.38
PLN02712667 arogenate dehydrogenase 88.34
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 88.24
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 88.23
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.18
COG2130340 Putative NADP-dependent oxidoreductases [General f 88.13
KOG2380 480 consensus Prephenate dehydrogenase (NADP+) [Amino 88.12
PRK07417279 arogenate dehydrogenase; Reviewed 88.1
KOG0068406 consensus D-3-phosphoglycerate dehydrogenase, D-is 88.06
PLN02237 442 glyceraldehyde-3-phosphate dehydrogenase B 87.83
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.82
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 87.78
PRK06046326 alanine dehydrogenase; Validated 87.64
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 87.56
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.56
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 87.51
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 87.26
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.19
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 87.13
PRK15116268 sulfur acceptor protein CsdL; Provisional 86.94
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.88
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 86.71
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 86.68
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 86.66
PRK04148134 hypothetical protein; Provisional 86.56
PLN02858 1378 fructose-bisphosphate aldolase 86.56
KOG0089309 consensus Methylenetetrahydrofolate dehydrogenase/ 86.39
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.3
KOG2336 422 consensus Molybdopterin biosynthesis-related prote 86.09
PRK05717255 oxidoreductase; Validated 86.01
KOG0455 364 consensus Homoserine dehydrogenase [Amino acid tra 85.73
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 85.72
PLN02256304 arogenate dehydrogenase 85.62
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 85.42
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 85.37
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 85.0
PRK08618325 ornithine cyclodeaminase; Validated 84.98
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.82
PRK05225 487 ketol-acid reductoisomerase; Validated 84.8
PRK06153393 hypothetical protein; Provisional 84.78
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 84.54
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 84.19
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 84.03
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 84.0
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 83.96
PTZ00082 321 L-lactate dehydrogenase; Provisional 83.78
TIGR03628114 arch_S11P archaeal ribosomal protein S11P. This mo 83.68
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 83.49
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.45
PRK08628258 short chain dehydrogenase; Provisional 83.21
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 83.15
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 83.11
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 82.91
PRK07523255 gluconate 5-dehydrogenase; Provisional 82.83
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 82.74
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 82.72
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 82.72
PRK09607132 rps11p 30S ribosomal protein S11P; Reviewed 82.51
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 82.51
PRK06849 389 hypothetical protein; Provisional 82.45
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 82.44
PRK12828239 short chain dehydrogenase; Provisional 82.41
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 82.26
PRK07060245 short chain dehydrogenase; Provisional 82.14
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 82.08
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 82.06
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 82.03
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 82.02
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 81.9
PLN02896 353 cinnamyl-alcohol dehydrogenase 81.82
PRK09496453 trkA potassium transporter peripheral membrane com 81.75
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 81.71
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 81.48
PRK06138252 short chain dehydrogenase; Provisional 81.37
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 81.1
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 80.96
PLN02206 442 UDP-glucuronate decarboxylase 80.79
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 80.78
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.69
PRK06841255 short chain dehydrogenase; Provisional 80.58
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 80.49
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 80.48
PRK11891429 aspartate carbamoyltransferase; Provisional 80.43
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 80.4
cd01974435 Nitrogenase_MoFe_beta Nitrogenase_MoFe_beta: Nitro 80.39
PRK07774250 short chain dehydrogenase; Provisional 80.09
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 80.05
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
Probab=100.00  E-value=5e-130  Score=1014.08  Aligned_cols=410  Identities=83%  Similarity=1.344  Sum_probs=405.5

Q ss_pred             CCHHHHHHHHHHHHHHHcCCChHHHHhhcCCCeEEEEEEEEEcCCCcEEEEEEEEEEeeccCCCCCCCeeeecCCCHHHH
Q 012750           47 MNALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDNARGPMKGGIRYHPEVDPDEV  126 (457)
Q Consensus        47 ~~~~~~~~~~~~~a~~~~~~~~~~~~~L~~p~r~~~v~~pv~~d~G~~~~f~G~rv~h~~a~GPakGGiR~~~~~~~~ev  126 (457)
                      +++|++++.+|++|+++++++|++.++|++|+|+++|+|||+||||++++|+|||||||+++||+||||||||++|++||
T Consensus         1 ~~~~~~~~~~~~~a~~~~~~~~~~~~~l~~p~r~~~v~~p~~~d~g~~~~~~gyRvqh~~~~GP~kGGiR~~p~v~~~ev   80 (410)
T PLN02477          1 MNALAATNRNFREAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDNARGPMKGGIRYHPEVDPDEV   80 (410)
T ss_pred             CCHHHHHHHHHHHHHHHcCCCHHHHHHHhcCceEEEEEEEEEECCCcEEEeeeeEeeecCccCCCCCCeeecCCCCHHHH
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhcCCCCCCcceEEeCCCCCCCHHHHHHHHHHHHHHHhhccCCCCcccCCCCCCCHHHHHHHHHHhhhh
Q 012750          127 NALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERLTRVFTQKIHDLIGIHTDIPAPDMGTNAQTMAWILDEYSKF  206 (457)
Q Consensus       127 ~~LA~~Mt~K~Al~~lP~GGaKGgI~~dP~~~s~~ele~~~r~f~~~l~~~iG~~~dipapDvgT~~~~m~wi~d~~~~~  206 (457)
                      ++||+||||||||++||||||||||.+||+++|+.|+|+++|+|+++|.+++||+.|||||||||++++|+||+|+|+++
T Consensus        81 ~~La~~MT~K~Al~~lP~GGgKggI~~dP~~~s~~e~e~l~r~f~~~l~~~iG~~~DipapDvgt~~~~M~w~~d~y~~~  160 (410)
T PLN02477         81 NALAQLMTWKTAVANIPYGGAKGGIGCDPRDLSESELERLTRVFTQKIHDLIGIHTDVPAPDMGTNAQTMAWILDEYSKF  160 (410)
T ss_pred             HHHHHHHHHHHHhcCCCCcCceeeeccCCccCCHHHHHHHHHHHHHHHHHhcCCCCCcccCCCCCCHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hCCCCceecCcccCCCCCCCCCcchHHHHHHHHHHHHHHhCCCCCCCeEEEEecChHHHHHHHHHHHCCCEEEEEECCCC
Q 012750          207 HGHSPAVVTGKPIDLGGSLGREAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGGKVIAVSDITG  286 (457)
Q Consensus       207 ~g~~~~~~tGkp~~~GGs~gr~~aTg~Gv~~~~~~~l~~~g~~l~g~~vaIqGfGnVG~~~a~~L~~~GakVVaVsD~~G  286 (457)
                      .|++|+++||||+.+|||.+|+++||+||+++++++++++|.+++|+||+||||||||+++|++|.++|+|||||||++|
T Consensus       161 ~g~~~~~vtGkp~~~gGs~~r~~aTg~Gv~~~~~~~~~~~g~~l~g~~VaIqGfGnVG~~~A~~L~e~GakVVaVsD~~G  240 (410)
T PLN02477        161 HGFSPAVVTGKPIDLGGSLGREAATGRGVVFATEALLAEHGKSIAGQTFVIQGFGNVGSWAAQLIHEKGGKIVAVSDITG  240 (410)
T ss_pred             hCCCCceEeCCCcccCCCCCCCccchHHHHHHHHHHHHHcCCCccCCEEEEECCCHHHHHHHHHHHHcCCEEEEEECCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeCCCCCCHHHHHHhHhhcCCcccCCCCeecCCCcccccccceeeccccCCcccccccccccceEEEecCCCCCCHHHH
Q 012750          287 AVKNADGIDIHKLLAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENAADVKAKFIIEAANHPTDPEAD  366 (457)
Q Consensus       287 ~iynp~GLDi~~L~~~~~~~g~~~~~~~~~~i~~~ell~~~~DIliPaA~~~~It~~na~~i~akiIvEgAN~p~t~~a~  366 (457)
                      ++|||+|||+++|++++++++++.+|++++.++++++|..+||||+|||++++||++|+++++||+|+||||+|+||+|+
T Consensus       241 ~iy~~~GLD~~~L~~~k~~~g~l~~~~~a~~i~~~e~l~~~~DvliP~Al~~~I~~~na~~i~ak~I~egAN~p~t~ea~  320 (410)
T PLN02477        241 AVKNENGLDIPALRKHVAEGGGLKGFPGGDPIDPDDILVEPCDVLIPAALGGVINKENAADVKAKFIVEAANHPTDPEAD  320 (410)
T ss_pred             eEECCCCCCHHHHHHHHHhcCchhccccceEecCccceeccccEEeeccccccCCHhHHHHcCCcEEEeCCCCCCCHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhCCCeEecccccccCCceehhHHHhhhcccCCCCHHHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHH
Q 012750          367 EILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEEDKVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRV  446 (457)
Q Consensus       367 ~iL~~rGI~viPD~laNaGGVi~S~~E~~qn~~~~~w~~e~v~~~l~~~m~~~~~~v~~~a~~~~~~~r~aA~~~A~~rv  446 (457)
                      ++|++|||+|+||+++||||||+|||||+||+++++|++++|+++|+++|.++|+++++.|+++++++|+|||++|++||
T Consensus       321 ~~L~~rGI~~~PD~~aNaGGVivs~~E~~qn~~~~~w~~~~v~~~l~~~m~~~~~~v~~~a~~~~~~~r~aA~~~a~~rv  400 (410)
T PLN02477        321 EILRKKGVVVLPDIYANSGGVTVSYFEWVQNIQGFMWEEEKVNRELDRYMTDAFKALKEMCKTHNCSLRMGAFTLGVNRV  400 (410)
T ss_pred             HHHHHCCcEEEChHHhCCCCeeeeHHHhhhccccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCcCHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCcc
Q 012750          447 ARATTLRGWE  456 (457)
Q Consensus       447 ~~a~~~rG~~  456 (457)
                      +++|+.|||.
T Consensus       401 ~~a~~~rG~~  410 (410)
T PLN02477        401 ARATVLRGWE  410 (410)
T ss_pred             HHHHHhhCCC
Confidence            9999999984



>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>KOG2250 consensus Glutamate/leucine/phenylalanine/valine dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00324 glutamate dehydrogenase 2; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF02812 ELFV_dehydrog_N: Glu/Leu/Phe/Val dehydrogenase, dimerisation domain; InterPro: IPR006097 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase Back     alignment and domain information
>COG2902 NAD-specific glutamate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>smart00839 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>KOG0089 consensus Methylenetetrahydrofolate dehydrogenase/methylenetetrahydrofolate cyclohydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG2336 consensus Molybdopterin biosynthesis-related protein [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>KOG0455 consensus Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03628 arch_S11P archaeal ribosomal protein S11P Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK09607 rps11p 30S ribosomal protein S11P; Reviewed Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>cd01974 Nitrogenase_MoFe_beta Nitrogenase_MoFe_beta: Nitrogenase MoFe protein, beta subunit Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query457
1b3b_A415 Thermotoga Maritima Glutamate Dehydrogenase Mutant 1e-109
1b26_A416 Glutamate Dehydrogenase Length = 416 1e-108
2tmg_A415 Thermotoga Maritima Glutamate Dehydrogenase Mutant 1e-102
1bvu_A418 Glutamate Dehydrogenase From Thermococcus Litoralis 1e-102
3k92_A424 Crystal Structure Of A E93k Mutant Of The Majour Ba 1e-101
1gtm_A419 Structure Of Glutamate Dehydrogenase Length = 419 3e-99
1euz_A419 Glutamate Dehydrogenase From Thermococcus Profundus 2e-98
3k8z_A423 Crystal Structure Of Gudb1 A Decryptified Secondary 2e-95
3aoe_A424 Crystal Structure Of Hetero-Hexameric Glutamate Deh 2e-90
3aog_A440 Crystal Structure Of Glutamate Dehydrogenase (Gdhb) 2e-90
2yfq_A421 Crystal Structure Of Glutamate Dehydrogenase From P 4e-84
1v9l_A421 L-Glutamate Dehydrogenase From Pyrobaculum Islandic 7e-84
1nqt_A496 Crystal Structure Of Bovine Glutamate Dehydrogenase 7e-76
1l1f_A505 Structure Of Human Glutamate Dehydrogenase-Apo Form 1e-75
1nr1_A496 Crystal Structure Of The R463a Mutant Of Human Glut 1e-75
3mw9_A501 Bovine Glutamate Dehydrogenase Complexed With Nadh, 2e-74
3etd_A501 Structure Of Glutamate Dehydrogenase Complexed With 2e-74
3aoe_E419 Crystal Structure Of Hetero-Hexameric Glutamate Deh 2e-71
1hwy_A501 Bovine Glutamate Dehydrogenase Complexed With Nad A 8e-71
2yfh_A448 Structure Of A Chimeric Glutamate Dehydrogenase Len 9e-48
3sbo_A447 Structure Of E.Coli Gdh From Native Source Length = 8e-47
4fcc_A450 Glutamate Dehydrogenase From E. Coli Length = 450 1e-46
2yfg_E447 Structural Determinants Of Cofactor Specificity And 1e-46
1hrd_A449 Glutamate Dehydrogenase Length = 449 5e-45
1k89_A449 K89l Mutant Of Glutamate Dehydrogenase Length = 449 3e-44
1aup_A449 Glutamate Dehydrogenase Length = 449 2e-43
3r3j_A456 Kinetic And Structural Characterization Of Plasmodi 3e-43
2bma_A470 The Crystal Structure Of Plasmodium Falciparum Glut 5e-33
1c1d_B355 L-Phenylalanine Dehydrogenase Structure In Ternary 9e-21
1c1x_B355 L-Phenylalanine Dehydrogenase Structure In Ternary 9e-21
1bxg_A356 Phenylalanine Dehydrogenase Structure In Ternary Co 9e-21
1bxg_B356 Phenylalanine Dehydrogenase Structure In Ternary Co 9e-21
1bw9_B356 Phenylalanine Dehydrogenase Structure In Ternary Co 1e-20
1c1x_A355 L-Phenylalanine Dehydrogenase Structure In Ternary 1e-20
1bw9_A356 Phenylalanine Dehydrogenase Structure In Ternary Co 1e-20
1c1d_A355 L-Phenylalanine Dehydrogenase Structure In Ternary 1e-20
3vpx_A364 Crystal Structure Of Leucine Dehydrogenase From A P 3e-18
1leh_A364 Leucine Dehydrogenase From Bacillus Sphaericus Leng 1e-17
>pdb|1B3B|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant N97d, G376k Length = 415 Back     alignment and structure

Iteration: 1

Score = 392 bits (1007), Expect = e-109, Method: Compositional matrix adjust. Identities = 196/401 (48%), Positives = 268/401 (66%), Gaps = 2/401 (0%) Query: 56 NFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDNARGPMKGGI 115 F AA ++ L+S L L P R + VE + DDG + + G+RVQH+ ARGP KGGI Sbjct: 12 QFNRAASLMDLESDLAEVLRRPKRVLIVEFPVRMDDGHVEVFTGYRVQHNVARGPAKGGI 71 Query: 116 RYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERLTRVFTQKIH 175 RYHP+V DEV ALA MTWKTAV D+P+GG KGG+ PK+LS +ELERL+R F +I Sbjct: 72 RYHPDVTLDEVKALAFWMTWKTAVMDLPFGGGKGGVRVDPKKLSRNELERLSRRFFSEIQ 131 Query: 176 DLIGIHTDIPAPDMGTNAQTMAWILDEYSKFHGHSP-AVVTGKPIDLGGSLGREAATGRG 234 +IG + DIPAPD+ TNA +AW +D YS GH+ +VTGKP++LGGS GRE ATGRG Sbjct: 132 VIIGPYNDIPAPDVNTNADVIAWYMDTYSMNVGHTVLGIVTGKPVELGGSKGREEATGRG 191 Query: 235 VVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLI-HERGGKVIAVSDITGAVKNADG 293 V + G + T +QGFGNVG +AA LI E G KV+AVSD G + N +G Sbjct: 192 VKVCAGLAMDVLGIDPKKATVAVQGFGNVGQFAALLISQELGSKVVAVSDSRGGIYNPEG 251 Query: 294 IDIHKLLAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENAADVKAKFI 353 D+ +L+ +K + G++ + G+ + ELL + D+L+P AL G + NA +KAK + Sbjct: 252 FDVEELIRYKKEHGTVVTYPKGERITNEELLELDVDILVPAALEGAIHAGNAERIKAKAV 311 Query: 354 IEAANHPTDPEADEILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEEDKVNNELR 413 +E AN PT PEADEILS+RG+ ++PDI AN+GGVTVSYFEWVQ++Q F W+ D+V N L Sbjct: 312 VEGANGPTTPEADEILSRRGILVVPDILANAGGVTVSYFEWVQDLQSFFWDLDQVRNALE 371 Query: 414 RYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRVARATTLRG 454 + M +AF+++ + + +N ++R A+ L ++RVA AT RG Sbjct: 372 KMMKKAFNDVMKVKEKYNVDMRTAAYILAIDRVAYATKKRG 412
>pdb|1B26|A Chain A, Glutamate Dehydrogenase Length = 416 Back     alignment and structure
>pdb|2TMG|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant S128r, T158e, N117r, S160e Length = 415 Back     alignment and structure
>pdb|1BVU|A Chain A, Glutamate Dehydrogenase From Thermococcus Litoralis Length = 418 Back     alignment and structure
>pdb|3K92|A Chain A, Crystal Structure Of A E93k Mutant Of The Majour Bacillus Su Glutamate Dehydrogenase Rocg Length = 424 Back     alignment and structure
>pdb|1GTM|A Chain A, Structure Of Glutamate Dehydrogenase Length = 419 Back     alignment and structure
>pdb|1EUZ|A Chain A, Glutamate Dehydrogenase From Thermococcus Profundus In The Unligated State Length = 419 Back     alignment and structure
>pdb|3K8Z|A Chain A, Crystal Structure Of Gudb1 A Decryptified Secondary Glutamate Dehydrogenase From B. Subtilis Length = 423 Back     alignment and structure
>pdb|3AOE|A Chain A, Crystal Structure Of Hetero-Hexameric Glutamate Dehydrogenase From Thermus Thermophilus (Leu Bound Form) Length = 424 Back     alignment and structure
>pdb|3AOG|A Chain A, Crystal Structure Of Glutamate Dehydrogenase (Gdhb) From Thermus Thermophilus (Glu Bound Form) Length = 440 Back     alignment and structure
>pdb|2YFQ|A Chain A, Crystal Structure Of Glutamate Dehydrogenase From Peptoniphilus Asaccharolyticus Length = 421 Back     alignment and structure
>pdb|1V9L|A Chain A, L-Glutamate Dehydrogenase From Pyrobaculum Islandicum Complexed With Nad Length = 421 Back     alignment and structure
>pdb|1NQT|A Chain A, Crystal Structure Of Bovine Glutamate Dehydrogenase-adp Complex Length = 496 Back     alignment and structure
>pdb|1L1F|A Chain A, Structure Of Human Glutamate Dehydrogenase-Apo Form Length = 505 Back     alignment and structure
>pdb|1NR1|A Chain A, Crystal Structure Of The R463a Mutant Of Human Glutamate Dehydrogenase Length = 496 Back     alignment and structure
>pdb|3MW9|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nadh, Gtp, Glu Length = 501 Back     alignment and structure
>pdb|3ETD|A Chain A, Structure Of Glutamate Dehydrogenase Complexed With Bithionol Length = 501 Back     alignment and structure
>pdb|3AOE|E Chain E, Crystal Structure Of Hetero-Hexameric Glutamate Dehydrogenase From Thermus Thermophilus (Leu Bound Form) Length = 419 Back     alignment and structure
>pdb|1HWY|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nad And 2-Oxoglutarate Length = 501 Back     alignment and structure
>pdb|2YFH|A Chain A, Structure Of A Chimeric Glutamate Dehydrogenase Length = 448 Back     alignment and structure
>pdb|3SBO|A Chain A, Structure Of E.Coli Gdh From Native Source Length = 447 Back     alignment and structure
>pdb|4FCC|A Chain A, Glutamate Dehydrogenase From E. Coli Length = 450 Back     alignment and structure
>pdb|2YFG|E Chain E, Structural Determinants Of Cofactor Specificity And Domain Flexibility In Bacterial Glutamate Dehydrogenases Length = 447 Back     alignment and structure
>pdb|1HRD|A Chain A, Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|1K89|A Chain A, K89l Mutant Of Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|1AUP|A Chain A, Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|3R3J|A Chain A, Kinetic And Structural Characterization Of Plasmodium Falciparum Glutamate Dehydrogenase 2 Length = 456 Back     alignment and structure
>pdb|2BMA|A Chain A, The Crystal Structure Of Plasmodium Falciparum Glutamate Dehydrogenase, A Putative Target For Novel Antimalarial Drugs Length = 470 Back     alignment and structure
>pdb|1C1D|B Chain B, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nadh And L-Phenylalanine Length = 355 Back     alignment and structure
>pdb|1C1X|B Chain B, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And L-3-Phenyllactate Length = 355 Back     alignment and structure
>pdb|1BXG|A Chain A, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Beta-Phenylpropionate Length = 356 Back     alignment and structure
>pdb|1BXG|B Chain B, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Beta-Phenylpropionate Length = 356 Back     alignment and structure
>pdb|1BW9|B Chain B, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Phenylpyruvate Length = 356 Back     alignment and structure
>pdb|1C1X|A Chain A, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And L-3-Phenyllactate Length = 355 Back     alignment and structure
>pdb|1BW9|A Chain A, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Phenylpyruvate Length = 356 Back     alignment and structure
>pdb|1C1D|A Chain A, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nadh And L-Phenylalanine Length = 355 Back     alignment and structure
>pdb|3VPX|A Chain A, Crystal Structure Of Leucine Dehydrogenase From A Psychrophilic Bacterium Sporosarcina Psychrophila. Length = 364 Back     alignment and structure
>pdb|1LEH|A Chain A, Leucine Dehydrogenase From Bacillus Sphaericus Length = 364 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query457
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 0.0
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 0.0
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 0.0
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 0.0
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 0.0
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 0.0
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 0.0
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 0.0
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 1e-157
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 1e-155
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1e-142
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 1e-139
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 1e-138
2yfg_A447 NADP-specific glutamate dehydrogenase; oxidoreduct 1e-128
3ing_A 325 Homoserine dehydrogenase; NP_394635.1, structural 3e-04
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Length = 415 Back     alignment and structure
 Score =  678 bits (1753), Expect = 0.0
 Identities = 195/410 (47%), Positives = 267/410 (65%), Gaps = 2/410 (0%)

Query: 48  NALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDNA 107
           +        F  AA ++ L+S L   L  P R + VE  +  DDG +  + G+RVQH+ A
Sbjct: 4   SLYEMAVEQFNRAASLMDLESDLAEVLRRPKRVLIVEFPVRMDDGHVEVFTGYRVQHNVA 63

Query: 108 RGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERLT 167
           RGP KGGIRYHP+V  DEV ALA  MTWKTAV ++P+GG KGG+   PK+LS  ELERL+
Sbjct: 64  RGPAKGGIRYHPDVTLDEVKALAFWMTWKTAVMNLPFGGGKGGVRVDPKKLSRRELERLS 123

Query: 168 RVFTQKIHDLIGIHTDIPAPDMGTNAQTMAWILDEYSKFHGH-SPAVVTGKPIDLGGSLG 226
           R F ++I  +IG + DIPAPD+ TNA  +AW +DEY    GH    +VTGKP++LGGS G
Sbjct: 124 RRFFREIQVIIGPYNDIPAPDVNTNADVIAWYMDEYEMNVGHTVLGIVTGKPVELGGSKG 183

Query: 227 REAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLI-HERGGKVIAVSDIT 285
           RE ATGRGV       +   G   +  T  +QGFGNVG +AA LI  E G KV+AVSD  
Sbjct: 184 REEATGRGVKVCAGLAMDVLGIDPKKATVAVQGFGNVGQFAALLISQELGSKVVAVSDSR 243

Query: 286 GAVKNADGIDIHKLLAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENA 345
           G + N +G D+ +L+ +K + G++  +  G+ +   ELL  + D+L+P AL G +   NA
Sbjct: 244 GGIYNPEGFDVEELIRYKKEHGTVVTYPKGERITNEELLELDVDILVPAALEGAIHAGNA 303

Query: 346 ADVKAKFIIEAANHPTDPEADEILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEE 405
             +KAK ++E AN PT PEADEILS+RG+ ++PDI AN+GGVTVSYFEWVQ++Q F W+ 
Sbjct: 304 ERIKAKAVVEGANGPTTPEADEILSRRGILVVPDILANAGGVTVSYFEWVQDLQSFFWDL 363

Query: 406 DKVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRVARATTLRGW 455
           D+V N L + M  AF+++  + + +N ++R  A+ L ++RVA AT  RG 
Sbjct: 364 DQVRNALEKMMKGAFNDVMKVKEKYNVDMRTAAYILAIDRVAYATKKRGI 413


>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Length = 440 Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Length = 421 Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Length = 424 Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Length = 419 Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Length = 419 Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Length = 421 Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Length = 501 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Length = 364 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Length = 355 Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Length = 449 Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Length = 456 Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Length = 470 Back     alignment and structure
>2yfg_A NADP-specific glutamate dehydrogenase; oxidoreductase; 2.50A {Escherichia coli} PDB: 3sbo_A 2yfg_E Length = 447 Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Length = 325 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query457
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 100.0
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 100.0
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 100.0
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 100.0
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 100.0
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 100.0
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 100.0
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 100.0
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 100.0
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 100.0
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 100.0
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 100.0
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 100.0
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 100.0
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 97.85
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 97.81
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 97.68
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.66
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.58
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.56
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 97.53
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 97.5
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.46
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 97.39
3l07_A285 Bifunctional protein fold; structural genomics, ID 97.35
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 97.34
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.33
3do5_A 327 HOM, homoserine dehydrogenase; NP_069768.1, putati 97.32
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 97.32
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 97.31
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 97.28
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.24
3p2o_A285 Bifunctional protein fold; structural genomics, ce 97.23
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 97.22
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 97.22
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 97.2
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 97.19
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 97.13
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.13
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 97.12
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 97.11
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 97.07
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 97.02
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.02
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 97.02
3l6d_A306 Putative oxidoreductase; structural genomics, prot 97.0
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 96.99
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 96.97
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 96.91
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 96.89
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.86
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 96.82
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 96.81
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 96.81
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 96.79
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 96.78
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 96.75
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 96.71
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 96.71
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 96.71
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 96.68
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 96.68
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 96.66
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 96.65
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 96.64
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 96.63
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 96.62
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 96.56
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 96.55
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.53
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 96.51
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 96.47
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 96.45
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 96.44
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 96.44
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 96.43
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 96.42
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.37
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 96.37
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 96.37
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 96.36
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 96.3
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 96.25
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 96.24
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 96.19
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.18
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 96.15
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 96.14
3qha_A296 Putative oxidoreductase; seattle structural genomi 96.1
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.08
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.07
3c8m_A 331 Homoserine dehydrogenase; structural genomics, APC 96.06
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 96.02
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 96.01
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.98
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 95.95
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 95.93
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 95.81
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 95.81
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 95.78
2g82_O 331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 95.76
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 95.76
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 95.75
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 95.73
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 95.71
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 95.7
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 95.55
1rm4_O 337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 95.49
4ezb_A317 Uncharacterized conserved protein; structural geno 95.48
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 95.46
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 95.43
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 95.42
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.41
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 95.41
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 95.4
3b1j_A 339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 95.33
1gq2_A555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 95.25
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 95.23
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 95.22
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 95.19
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 95.14
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 95.13
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 95.12
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 95.11
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 95.1
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 95.09
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 95.09
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 95.08
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 95.04
1o0s_A605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 95.0
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 94.99
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 94.94
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 94.92
1obf_O 335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 94.92
2ejw_A 332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 94.91
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 94.9
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 94.83
1vpd_A299 Tartronate semialdehyde reductase; structural geno 94.82
2x5j_O 339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 94.76
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 94.67
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 94.64
1pj3_A564 NAD-dependent malic enzyme, mitochondrial; oxidati 94.58
1hdg_O 332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 94.57
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 94.55
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 94.54
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 94.49
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 94.46
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 94.45
3nv9_A487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 94.45
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 94.44
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 94.42
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 94.37
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 94.32
3cmc_O 334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 94.3
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 94.23
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 94.2
1ebf_A 358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 94.04
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 93.99
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.95
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 93.94
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 93.9
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 93.9
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 93.89
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 93.88
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 93.87
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 93.83
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 93.73
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 93.72
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 93.65
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 93.62
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 93.56
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 93.55
1gad_O 330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 93.49
1ydw_A 362 AX110P-like protein; structural genomics, protein 93.46
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 93.46
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 93.38
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 93.3
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 93.27
2ep7_A 342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 93.26
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 93.21
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 93.17
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 93.12
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 93.11
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 93.11
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 93.1
1id1_A153 Putative potassium channel protein; RCK domain, E. 93.09
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 93.05
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 92.99
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 92.92
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 92.9
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 92.8
4had_A 350 Probable oxidoreductase protein; structural genomi 92.79
1yb4_A295 Tartronic semialdehyde reductase; structural genom 92.74
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 92.73
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 92.61
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 92.58
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 92.56
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 92.55
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 92.51
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 92.49
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 92.37
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 92.36
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 92.28
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 92.25
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 92.23
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 92.15
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 92.15
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 92.11
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 92.05
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 92.04
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 91.94
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 91.83
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 91.83
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 91.75
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 91.72
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 91.67
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 91.58
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 91.49
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 91.29
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 91.18
2d59_A144 Hypothetical protein PH1109; COA binding, structur 91.04
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 91.04
3doc_A 335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 90.95
2b4r_O 345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 90.88
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 90.87
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 90.78
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 90.75
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 90.69
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 90.63
4g65_A 461 TRK system potassium uptake protein TRKA; structur 90.62
3hja_A 356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 90.59
3pym_A 332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 90.57
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 90.57
4h3v_A 390 Oxidoreductase domain protein; structural genomics 90.47
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 90.29
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 90.25
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 90.05
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 90.02
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 90.0
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 89.97
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 89.88
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 89.86
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 89.81
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 89.76
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 89.72
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 89.7
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 89.67
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 89.57
3lvf_P 338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 89.55
4dib_A 345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 89.44
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 89.4
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 89.35
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 89.33
2duw_A145 Putative COA-binding protein; ligand binding prote 89.26
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 88.83
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 88.71
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 88.55
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 88.35
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 88.17
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 88.15
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 88.07
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 88.06
3e03_A274 Short chain dehydrogenase; structural genomics, PS 88.02
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 87.94
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 87.89
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 87.8
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 87.78
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 87.78
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 87.61
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 87.37
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 87.34
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 87.19
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 87.18
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 86.98
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 86.93
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 86.92
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 86.86
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 86.67
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 86.45
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 86.34
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 86.32
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 86.32
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 86.2
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 86.19
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 86.18
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 86.09
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 86.08
4hb9_A 412 Similarities with probable monooxygenase; flavin, 86.07
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 85.84
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 85.83
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 85.81
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 85.8
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 85.71
3v1y_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 85.6
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 85.54
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 85.23
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 85.12
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 84.96
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 84.63
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 84.46
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 84.21
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 84.16
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 84.08
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 84.06
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 84.03
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 84.0
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 83.95
3ius_A286 Uncharacterized conserved protein; APC63810, silic 83.88
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 83.87
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 83.87
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 83.81
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 83.77
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 83.72
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 84.19
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 83.63
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 83.61
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 83.61
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 83.57
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 83.56
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 83.53
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 83.28
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 83.27
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 83.16
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 83.16
3edm_A259 Short chain dehydrogenase; structural genomics, ox 83.04
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 83.02
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 82.92
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 82.89
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 82.83
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 82.68
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 82.67
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 82.65
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 82.59
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 82.56
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 82.51
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 82.47
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 82.37
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 82.31
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 82.29
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 82.21
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 82.12
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 82.11
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 81.89
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 81.88
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 81.8
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 81.79
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 81.72
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 81.71
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 81.69
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 81.66
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 81.6
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 81.58
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 81.56
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 81.49
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 81.47
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 81.46
4eso_A255 Putative oxidoreductase; NADP, structural genomics 81.44
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 81.4
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 81.32
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 81.27
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 81.27
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 81.23
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 81.22
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 81.12
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 81.07
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 81.02
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 80.95
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 80.92
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 80.89
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 80.86
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 80.8
4g65_A461 TRK system potassium uptake protein TRKA; structur 80.74
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 80.69
4dqx_A277 Probable oxidoreductase protein; structural genomi 80.68
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 80.65
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 80.64
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 80.63
3imf_A257 Short chain dehydrogenase; structural genomics, in 80.54
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 80.52
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 80.36
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 80.18
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 80.16
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 80.11
1nff_A260 Putative oxidoreductase RV2002; directed evolution 80.09
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 80.03
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
Probab=100.00  E-value=1.3e-127  Score=997.46  Aligned_cols=411  Identities=42%  Similarity=0.791  Sum_probs=404.0

Q ss_pred             hcCCHHHHHHHHHHHHHHHcCCChHHHHhhcCCCeEEEEEEEEEcCCCcEEEEEEEEEEeeccCCCCCCCeeeecCCCHH
Q 012750           45 IVMNALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDNARGPMKGGIRYHPEVDPD  124 (457)
Q Consensus        45 ~~~~~~~~~~~~~~~a~~~~~~~~~~~~~L~~p~r~~~v~~pv~~d~G~~~~f~G~rv~h~~a~GPakGGiR~~~~~~~~  124 (457)
                      +..++|+++++||++|+++++++|+++++|++|+|+++|+|||+||||++++|+|||||||+++||+||||||||++|++
T Consensus        13 ~~~~~~~~~~~~~~~a~~~~~~~~~~~~~l~~p~r~~~~~vp~~~d~G~~~v~~GyRvqhn~a~GP~kGGiR~~p~v~~~   92 (424)
T 3k92_A           13 EALNLFLSTQTIIKEALRKLGYPGDMYELMKEPQRMLTVRIPVKMDNGSVKVFTGYRSQHNDAVGPTKGGVRFHPEVNEE   92 (424)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTCCHHHHHHHSSCSEEEEEEEEEECTTSCEEEEEEEEEECCCSSSSEECCEEEETTCCHH
T ss_pred             ccCCHHHHHHHHHHHHHHHcCCCHHHHHHhcCCCeEEEEEEEEEecCCcEEEEEEEEEEECCcCCCCCCCeEecCCCCHH
Confidence            45679999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhcCCCCCCcceEEeCCCCCCCHHHHHHHHHHHHHHHhhccCCCCcccCCCCCCCHHHHHHHHHHhh
Q 012750          125 EVNALAQLMTWKTAVADIPYGGAKGGIGCSPKELSNSELERLTRVFTQKIHDLIGIHTDIPAPDMGTNAQTMAWILDEYS  204 (457)
Q Consensus       125 ev~~LA~~Mt~K~Al~~lP~GGaKGgI~~dP~~~s~~ele~~~r~f~~~l~~~iG~~~dipapDvgT~~~~m~wi~d~~~  204 (457)
                      ||++||++|||||||++||||||||||++||+++|+.|+||++|+|+++|.+++||+.||||||+||++++|+||+|+|+
T Consensus        93 ev~~La~~mt~KnAl~~lP~GGgKggi~~DP~~~s~~El~r~~r~f~~~l~~~iG~~~dipApDvgt~~~~m~~~~~~y~  172 (424)
T 3k92_A           93 KVKALSIWMTLKCGIANLPYGGGKGGIICDPRTMSFGELERLSRGYVRAISQIVGPTKDIPAPDVYTNSQIMAWMMDEYS  172 (424)
T ss_dssp             HHHHHHHHHHHHHHHTTCSCEEEEEEEECCGGGSCHHHHHHHHHHHHHHHGGGCBTTTEECCBCTTCCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHhcCCCCCCcceEEecCCCCCCHHHHHHHHHHHHHHHHHhcCCCCCccCCcCCCCHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhCCC-CceecCcccCCCCCCCCCcchHHHHHHHHHHHHHHhCCCCCCCeEEEEecChHHHHHHHHHHHCCCEEEEEEC
Q 012750          205 KFHGHS-PAVVTGKPIDLGGSLGREAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGGKVIAVSD  283 (457)
Q Consensus       205 ~~~g~~-~~~~tGkp~~~GGs~gr~~aTg~Gv~~~~~~~l~~~g~~l~g~~vaIqGfGnVG~~~a~~L~~~GakVVaVsD  283 (457)
                      +++|++ |+++||||..+|||.+|.++|||||+++++++++++|.+++|+||+||||||||+++|++|++.|+|||+|||
T Consensus       173 ~~~g~~~~~~vTGkp~~~GGs~~r~~aTg~Gv~~~~~~~~~~~g~~l~g~~vaVqG~GnVG~~aa~~l~e~GakVVavsD  252 (424)
T 3k92_A          173 RLREFDSPGFITGKPLVLGGSQGRETATAQGVTICIEEAVKKKGIKLQNARIIIQGFGNAGSFLAKFMHDAGAKVIGISD  252 (424)
T ss_dssp             HHHTSCCGGGCSSCCGGGTCCTTTTTHHHHHHHHHHHHHHHHTTCCGGGCEEEEECCSHHHHHHHHHHHHHTCEEEEEEC
T ss_pred             HHhCCCCcceeecccccCCCcCCCcccHHHHHHHHHHHHHHHcCCCcccCEEEEECCCHHHHHHHHHHHHCCCEEEEEEC
Confidence            999974 7999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCeeeCCCCCCHHHHHHhHhhcCCcccCCCCeecCCCcccccccceeeccccCCcccccccccccceEEEecCCCCCCH
Q 012750          284 ITGAVKNADGIDIHKLLAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENAADVKAKFIIEAANHPTDP  363 (457)
Q Consensus       284 ~~G~iynp~GLDi~~L~~~~~~~g~~~~~~~~~~i~~~ell~~~~DIliPaA~~~~It~~na~~i~akiIvEgAN~p~t~  363 (457)
                      ++|++|||+|||+++|++++++++++.+|+ ++.++++++|+.+||||+|||++|+||++|+++++||+|+||||+|+||
T Consensus       253 ~~G~iyd~~GlD~~~l~~~~~~~g~i~~~~-a~~~~~~~i~~~~~DIliPcA~~n~I~~~~a~~l~ak~V~EgAN~p~t~  331 (424)
T 3k92_A          253 ANGGLYNPDGLDIPYLLDKRDSFGMVTNLF-TDVITNEELLEKDCDILVPAAISNQITAKNAHNIQASIVVERANGPTTI  331 (424)
T ss_dssp             SSCEEECTTCCCHHHHHHHCCSSSCCGGGC-SCCBCHHHHHHSCCSEEEECSCSSCBCTTTGGGCCCSEEECCSSSCBCH
T ss_pred             CCCcEECCCCCCHHHHHHHHHHhCCCCCCC-cEEecCccceeccccEEeecCcccccChhhHhhcCceEEEcCCCCCCCH
Confidence            999999999999999999999999999998 7888889999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCeEecccccccCCceehhHHHhhhcccCCCCHHHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHH
Q 012750          364 EADEILSKRGVTILPDIYANSGGVTVSYFEWVQNIQGFMWEEDKVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGV  443 (457)
Q Consensus       364 ~a~~iL~~rGI~viPD~laNaGGVi~S~~E~~qn~~~~~w~~e~v~~~l~~~m~~~~~~v~~~a~~~~~~~r~aA~~~A~  443 (457)
                      +|+++|++|||+|+||+++|||||++|||||+||+++++|++|+|+++|+++|.++++++++.++++++++|+|||++|+
T Consensus       332 eA~~iL~~rGI~~~PD~~aNAGGV~vS~~E~~qn~~~~~w~~eeV~~~l~~~m~~~~~~v~~~a~~~~~~~~~aA~~~a~  411 (424)
T 3k92_A          332 DATKILNERGVLLVPDILASAGGVTVSYFEWVQNNQGYYWSEEEVAEKLRSVMVSSFETIYQTAATHKVDMRLAAYMTGI  411 (424)
T ss_dssp             HHHHHHHHTTCEEECHHHHTTHHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHTCCHHHHHHHHHH
T ss_pred             HHHHHHHHCCCEEECchHhcCCCEEeehhHHHhcccccCCCHHHHHHHHHHHHHHHHHHHHHHHHHhCcCHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHcCcc
Q 012750          444 NRVARATTLRGWE  456 (457)
Q Consensus       444 ~rv~~a~~~rG~~  456 (457)
                      +||+++|+.|||+
T Consensus       412 ~rva~a~~~~G~~  424 (424)
T 3k92_A          412 RKSAEASRFRGWV  424 (424)
T ss_dssp             HHHHHHHHHTTCC
T ss_pred             HHHHHHHHHcCCC
Confidence            9999999999985



>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 457
d1bgva1255 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clost 1e-71
d1b26a1234 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Therm 9e-68
d1gtma1239 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archa 5e-66
d1v9la2176 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyroba 1e-61
d1v9la1242 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrob 4e-61
d1hwxa1293 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow ( 9e-61
d1leha1230 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillu 3e-60
d1b26a2175 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermo 9e-59
d1gtma2178 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archae 3e-58
d1hwxa2208 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (B 3e-52
d1bgva2194 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostr 6e-49
d1c1da1201 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R 3e-40
d1c1da2148 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rh 9e-35
d1leha2134 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus 1e-34
d1b7go1178 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosp 0.003
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 255 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Aminoacid dehydrogenase-like, C-terminal domain
domain: Glutamate dehydrogenase
species: Clostridium symbiosum [TaxId: 1512]
 Score =  224 bits (573), Expect = 1e-71
 Identities = 72/253 (28%), Positives = 113/253 (44%), Gaps = 14/253 (5%)

Query: 217 KPIDLGGSLGREAATGRGVVYATEALLAEHGQAIRDLTFVIQGFGNVGSWAARLIHERGG 276
           K    GGSL R  ATG G VY  EA++      +   T  + GFGNV   AA+ + E G 
Sbjct: 1   KARSFGGSLVRPEATGYGSVYYVEAVMKHENDTLVGKTVALAGFGNVAWGAAKKLAELGA 60

Query: 277 KVIAVSDITGAVKNADGIDIHKLLAH--------KDKTGSLKDFDGGDSMEPSELLAHEC 328
           K + +S   G + + +GI   + + +        ++K     D  G       +    + 
Sbjct: 61  KAVTLSGPDGYIYDPEGITTEEKINYMLEMRASGRNKVQDYADKFGVQFFPGEKPWGQKV 120

Query: 329 DVLIPCALGGVLKRENAADVKA---KFIIEAANHPTDPEADEILSK-RGVTILPDIYANS 384
           D+++PCA    +  E A  + A   K+ IE AN PT  EA   L +   + + P    N+
Sbjct: 121 DIIMPCATQNDVDLEQAKKIVANNVKYYIEVANMPTTNEALRFLMQQPNMVVAPSKAVNA 180

Query: 385 GGVTVSYFEWVQNIQGFMWEEDKVNNELRRYMIRAFHNIKGMCQTHNC--NLRMGAFTLG 442
           GGV VS FE  QN +   W  ++V+++L + M           + +    NL  GA  +G
Sbjct: 181 GGVLVSGFEMSQNSERLSWTAEEVDSKLHQVMTDIHDGSAAAAERYGLGYNLVAGANIVG 240

Query: 443 VNRVARATTLRGW 455
             ++A A   +G 
Sbjct: 241 FQKIADAMMAQGI 253


>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 239 Back     information, alignment and structure
>d1v9la2 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 176 Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 242 Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 293 Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 230 Back     information, alignment and structure
>d1b26a2 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 175 Back     information, alignment and structure
>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 178 Back     information, alignment and structure
>d1hwxa2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 208 Back     information, alignment and structure
>d1bgva2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 194 Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 Back     information, alignment and structure
>d1c1da2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 148 Back     information, alignment and structure
>d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 134 Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 178 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query457
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 100.0
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 100.0
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 100.0
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 100.0
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 100.0
d1b26a2175 Glutamate dehydrogenase {Thermotoga maritima [TaxI 100.0
d1gtma2178 Glutamate dehydrogenase {Archaeon Pyrococcus furio 100.0
d1v9la2176 Glutamate dehydrogenase {Pyrobaculum islandicum [T 100.0
d1hwxa2208 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 100.0
d1bgva2194 Glutamate dehydrogenase {Clostridium symbiosum [Ta 100.0
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 100.0
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 100.0
d1c1da2148 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 100.0
d1leha2134 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 100.0
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 97.94
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.91
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.77
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.71
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.21
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 97.19
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 97.12
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.02
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.96
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.78
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.76
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 96.73
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.71
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 96.66
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 96.63
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.61
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.59
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.57
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 96.56
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.52
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 96.23
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.2
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.18
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.18
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.12
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 95.98
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 95.9
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 95.87
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.77
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.74
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.66
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.45
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 95.25
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.22
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.17
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 95.12
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 95.03
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 94.99
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 94.97
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.73
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.55
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 94.48
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 94.19
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.18
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.02
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 93.92
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.85
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 93.66
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.57
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.48
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 93.12
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 93.12
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.08
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 92.99
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.9
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 92.67
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 92.64
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.44
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.33
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.18
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 92.16
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 92.15
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 92.04
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 91.88
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 91.84
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 91.69
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 91.6
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 91.6
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 91.48
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 91.24
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 91.09
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 91.09
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.95
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.87
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 90.85
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 90.57
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 90.45
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 90.42
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 90.32
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 90.27
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 90.05
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 89.95
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 89.92
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 89.82
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 89.64
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 89.63
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 89.47
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 89.29
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 89.26
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 89.24
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.24
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 89.18
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 89.18
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 89.13
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 89.12
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 88.97
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 88.96
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 88.95
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 88.89
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 88.76
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 88.5
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 88.46
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 88.43
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 88.39
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 88.38
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 88.28
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 88.04
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 88.0
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 88.0
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 87.94
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 87.86
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 87.83
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 87.82
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 87.63
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 87.52
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 87.47
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 87.45
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 87.36
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 87.31
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 87.16
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 87.14
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 87.06
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 87.03
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 87.02
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 86.98
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 86.91
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 86.85
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 86.83
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 86.82
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 86.67
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 86.67
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 86.59
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 86.58
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 86.55
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 86.5
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 86.22
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 86.18
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 86.09
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 86.08
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 85.8
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 85.79
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 85.78
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 85.62
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 85.54
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 85.46
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 85.46
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 85.36
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 85.15
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 85.11
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 84.86
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 84.84
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 84.76
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 84.72
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 84.71
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 84.7
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 84.7
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 84.69
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 84.67
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 84.64
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 84.6
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 84.37
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 84.34
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 84.3
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 84.22
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 84.1
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 84.0
d1o0sa1308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 83.99
d1id1a_153 Rck domain from putative potassium channel Kch {Es 83.98
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 83.98
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 83.8
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 83.78
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 83.71
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 83.56
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 83.51
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 83.44
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 83.4
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 83.39
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 83.3
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 83.21
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 83.01
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 82.85
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 82.75
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 82.66
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 82.59
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 82.48
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 82.46
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 82.4
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 82.39
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 82.35
d1gq2a1298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 82.33
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 81.93
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 81.82
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 81.79
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 81.68
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 81.62
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 81.55
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 81.39
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 81.3
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 81.1
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 81.0
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 80.87
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 80.82
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 80.77
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 80.64
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 80.59
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 80.42
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 80.32
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 80.14
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 80.1
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Aminoacid dehydrogenase-like, C-terminal domain
domain: Glutamate dehydrogenase
species: Archaeon Pyrococcus furiosus [TaxId: 2261]
Probab=100.00  E-value=1.4e-68  Score=517.66  Aligned_cols=235  Identities=43%  Similarity=0.747  Sum_probs=230.6

Q ss_pred             CCCCCCCcchHHHHHHHHHHHHHHhCCC-CCCCeEEEEecChHHHHHHHHHHH-CCCEEEEEECCCCeeeCCCCCCHHHH
Q 012750          222 GGSLGREAATGRGVVYATEALLAEHGQA-IRDLTFVIQGFGNVGSWAARLIHE-RGGKVIAVSDITGAVKNADGIDIHKL  299 (457)
Q Consensus       222 GGs~gr~~aTg~Gv~~~~~~~l~~~g~~-l~g~~vaIqGfGnVG~~~a~~L~~-~GakVVaVsD~~G~iynp~GLDi~~L  299 (457)
                      |||.||.+||||||+++++++++.+|.+ ++|+||+||||||||+++|++|.+ .|+|||+|+|++|++|||+|||++++
T Consensus         1 GGs~gR~eATg~Gv~~~~~~~~~~~g~~~l~g~~v~IqGfGnVG~~~a~~L~~~~G~kvv~vsD~~g~i~~~~G~d~~~l   80 (239)
T d1gtma1           1 GGSLGRIEATARGASYTIREAAKVLGWDTLKGKTIAIQGYGNAGYYLAKIMSEDFGMKVVAVSDSKGGIYNPDGLNADEV   80 (239)
T ss_dssp             TCCTTTTTHHHHHHHHHHHHHHHHTTCSCSTTCEEEEECCSHHHHHHHHHHHHTTCCEEEEEECSSCEEEEEEEECHHHH
T ss_pred             CCCCCCcchhhHHHHHHHHHHHHHhCCCCcCCCEEEEECCCHHHHHHHHHHHHhcCcceeeccccccceecCCcCCHHHH
Confidence            8999999999999999999999999976 999999999999999999999975 69999999999999999999999999


Q ss_pred             HHhHhhcCCcccCCCCeecCCCcccccccceeeccccCCcccccccccccceEEEecCCCCCCHHHHHHHHhCCCeEecc
Q 012750          300 LAHKDKTGSLKDFDGGDSMEPSELLAHECDVLIPCALGGVLKRENAADVKAKFIIEAANHPTDPEADEILSKRGVTILPD  379 (457)
Q Consensus       300 ~~~~~~~g~~~~~~~~~~i~~~ell~~~~DIliPaA~~~~It~~na~~i~akiIvEgAN~p~t~~a~~iL~~rGI~viPD  379 (457)
                      ++++.+++++.+||+++.++++++|+.+||||+|||++++||++|+++++||+|+||||+|+||+|+++|++|||+|+||
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~i~~~~~DIl~PcA~~~~I~~~~a~~i~ak~I~e~AN~p~t~ea~~~L~~rgI~~iPD  160 (239)
T d1gtma1          81 LKWKNEHGSVKDFPGATNITNEELLELEVDVLAPAAIEEVITKKNADNIKAKIVAEVANGPVTPEADEILFEKGILQIPD  160 (239)
T ss_dssp             HHHHHHHSSSTTCTTSEEECHHHHHHSCCSEEEECSCSCCBCTTGGGGCCCSEEECCSSSCBCHHHHHHHHHTTCEEECH
T ss_pred             HHHHHhccccccCCCCeeecccccccccccEEeeccccccccHHHHHhccccEEEecCCCCCCHHHHHHHHHCCCEEecc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccCCceehhHHHhhhcccCCCCHHHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHHcCcc
Q 012750          380 IYANSGGVTVSYFEWVQNIQGFMWEEDKVNNELRRYMIRAFHNIKGMCQTHNCNLRMGAFTLGVNRVARATTLRGWE  456 (457)
Q Consensus       380 ~laNaGGVi~S~~E~~qn~~~~~w~~e~v~~~l~~~m~~~~~~v~~~a~~~~~~~r~aA~~~A~~rv~~a~~~rG~~  456 (457)
                      +++|||||++||+||+||.++.+|++++|.++|+++|.+++.++++.++++++++|+|||++|++||+++|+.|||+
T Consensus       161 ~~aNAGGVi~s~~E~~qn~~~~~w~~~~v~~~l~~~m~~~~~~v~~~a~~~~~~~r~aA~~~A~~Ria~a~~~rG~v  237 (239)
T d1gtma1         161 FLCNAGGVTVSYFEWVQNITGYYWTIEEVRERLDKKMTKAFYDVYNIAKEKNIHMRDAAYVVAVQRVYQAMLDRGWV  237 (239)
T ss_dssp             HHHTTHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHTSS
T ss_pred             hhhCCcceeEeeeeeccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHcCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999997



>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b26a2 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v9la2 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1hwxa2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bgva2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1c1da2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure