Citrus Sinensis ID: 012763

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------

MASWVLSECGLKPLPHIFPRPRTGINPSKARFLHSKKSITDLKLPSVKCSGDFSRDRNWGLKVSAPLRVAPLEGEDEEERINGVNGIGNNKGVEEEEGSEFDPGAPPPFKLADIRAAIPKHCWVKDPWKSMSYVVRDVVVVFGLAAAAAYLNNWVVWPLYWAAQGTMFWALFVLGHDCGHGSFSNDHKLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKTGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWFNNIHHDIGTHVIHHLFPQIPHYHLIEATEAARPVLGKYYREPKKSGPIPFNLFGDLIRSMSKDHYVSDNGDVVYYQTDPQLNGSSKSG

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEECccccccccccccHHHHccccccccccccccccccccccccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccEEEcccccEEEcccccccccccccc

*ASWVLSECGLKPLPHIFP**********************LKLPSVKCSGDFSRDRNWGLKVS*******************************************PFKLADIRAAIPKHCWVKDPWKSMSYVVRDVVVVFGLAAAAAYLNNWVVWPLYWAAQGTMFWALFVLGHDCGHGSFSNDHKLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRTLDSATRFLRFKIPFPLLAYPFYLWSRSPGKTGSHFDPNSDLFVPSERKDVITSTVCWTAMAALLVGLSFVMGPMQLLKLYGLPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWFNNIHHDIGTHVIHHLFPQIPHYHLIEATEAARPVLGKYYREPKKSGPIPFNLFGDLIRSMSKDHYVSDNGDVVYYQT***********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Temperature-sensitive omega-3 fatty acid desaturase, chloroplastic	Chloroplast omega-3 fatty acid desaturase introduces the third double bond in the biosynthesis of 16:3 and 18:3 fatty acids, important constituents of plant membranes. It is thought to use ferredoxin as an electron donor and to act on fatty acids esterified to galactolipids, sulfolipids and phosphatidylglycerol.	confident	P48622
Omega-3 fatty acid desaturase, chloroplastic	Chloroplast omega-3 fatty acid desaturase introduces the third double bond in the biosynthesis of 16:3 and 18:3 fatty acids, important constituents of plant membranes. It is thought to use ferredoxin as an electron donor and to act on fatty acids esterified to galactolipids, sulfolipids and phosphatidylglycerol.	probable	P48619
Omega-3 fatty acid desaturase, chloroplastic	Chloroplast omega-3 fatty acid desaturase introduces the third double bond in the biosynthesis of 16:3 and 18:3 fatty acids, important constituents of plant membranes. It is thought to use ferredoxin as an electron donor and to act on fatty acids esterified to galactolipids, sulfolipids and phosphatidylglycerol.	probable	P48620

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted