Citrus Sinensis ID: 012768


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450------
MSMSTLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDLGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRLNNPWPELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHGGSLPSTREEKREFKELLKSKMVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLQSADSSFFPFSIAIGRPWIFAEADCLAIEQRVRNNLKKLGREPESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQKYLTDEDYSVAMGFYILLRAVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAELHAVAAFIGGVASQEVIKVVFLS
ccHHHHHHHHHHHHHHHHHccEEEEcccHHHHHHHHHHHHccccEEEEECcccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEccccHHHHcccccccccccEEEEccccHHHHHHHHHHHHHccccEEEEEEEEEEEEEEEEEcccccccccccccccccccccccHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccc
MSMSTLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDLGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRLNNPWPELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHG*******E*KREFKELLKSKMVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLQSADSSFFPFSIAIGRPWIFAEADCLAIEQRVRNNLKKLGREPESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQKYLTDEDYSVAMGFYILLRAVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAELHAVAAFIGGVASQEVIKVVFLS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSMSTLRIWGEQGQAALEKASVCLLNCGPTGSETLKNLVLGGIGSITVIDGSKVEVGDLGNNFMLDESCVGESKAKSVCAFLQELNDAVKAKFIEEYPEALIEMNPPFFSQFTLVVATQLGEEKMIKLDRICREANVMLIFARSYGLTGFVRISVKEHTVVESKPDHFLDDLRLNNPWPELRKFAETFDLNVPDPVAHKHTPYVVILIKMSEEWTNSHGGSLPSTREEKREFKELLKSKMVAIDEDNYKEAIEASFKVFAPPGIKLALSKVLQSADSSFFPFSIAIGRPWIFAEADCLAIEQRVRNNLKKLGREPESISKATIKSFCRNARKLKVCRYRLLEDEFSNPSVPDIQKYLTDEDYSVAMGFYILLRAVDRFAANYNNYPGEFDGPMDEDISRLKTTAVSVLNDLGCNGSTLTEDLINEMCRFGAAELHAVAAFIGGVASQEVIKVVFLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NEDD8-activating enzyme E1 regulatory subunit Regulatory subunit of the dimeric ECR1-AXR1 E1 enzyme. E1 activates NEDD8/RUB1 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-ECR1 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of RCE1. Plays an important role in auxin response.probableP42744
NEDD8-activating enzyme E1 regulatory subunit Regulatory subunit of the dimeric uba3-nae1 E1 enzyme. E1 activates nedd8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a nedd8-uba3 thioester and free AMP. E1 finally transfers nedd8 to the catalytic cysteine of ube2m.probableQ7SXP2
NEDD8-activating enzyme E1 regulatory subunit Regulatory subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. Necessary for cell cycle progression through the S-M checkpoint. Overexpression of NAE1 causes apoptosis through deregulation of NEDD8 conjugation.probableQ13564

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CMM, chain A
Confidence level:very confident
Coverage over the Query: 2-190,202-260,276-281,312-454
View the alignment between query and template
View the model in PyMOL
Template: 1TT5, chain A
Confidence level:very confident
Coverage over the Query: 2-454
View the alignment between query and template
View the model in PyMOL