Citrus Sinensis ID: 012816


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450------
MKNEERKVNPNCIKASNPYHECGERCFKRNGEANALGFKKQSDNHNGVTEGVISVKKNEGRKVDPTCIKASNPYHECGEHCFKRNGEANARGVNKESGSWSFGRKNKASDSQPGTPLTPRAVDKVAVGGQKANGQHARSENYPKKKVESENGKSFSRPEHFSREIHPEDHSLNKEKVRSTQSVPPSENIKMNDMSKSPPKESVTSLPGASPSKNGKDNKVQAPIEIHHSTEDGGEDIPSPADGSRNFSFSGIDLASGDSDDEEAQSVISDSVSVGKYHVRASISSILQSIISRYGDIAANCNLESNSMRAYYLECLCSVVQELQSTSLMQMTKAKVKEMMAVLKDVESAQIDVDWLRNILNEISEAIEFSTQHQTIDAAKANCVNLLESTKKELESQMNELALKEKEVAGLKESVAKTKARLSDLELESNRLEQIIQATQSKVTKFSQKSLADEIL
ccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccEEEccEEEEcccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHccc
******************YHECGERCFK*************************************TCIKASNPYHECGEHCF*********************************************************************************************************************************************************************************************VSVGKYHVRASISSILQSIISRYGDIAANCNLESNSMRAYYLECLCSVVQELQSTSLMQMTKAKVKEMMAVLKDVESAQIDVDWLRNILNEISEAIEFSTQHQTIDAAKANCVNLL**************************************************ATQSKVTKFSQKSLAD**L
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNEERKVNPNCIKASNPYHECGERCFKRNGEANALGFKKQSDNHNGVTEGVISVKKNEGRKVDPTCIKASNPYHECGEHCFKRNGEANARGVNKESGSWSFGRKNKASDSQPGTPLTPRAVDKVAVGGQKANGQHARSENYPKKKVESENGKSFSRPEHFSREIHPEDHSLNKEKVRSTQSVPPSENIKMNDMSKSPPKESVTSLPGASPSKNGKDNKVQAPIEIHHSTEDGGEDIPSPADGSRNFSFSGIDLASGDSDDEEAQSVISDSVSVGKYHVRASISSILQSIISRYGDIAANCNLESNSMRAYYLECLCSVVQELQSTSLMQMTKAKVKEMMAVLKDVESAQIDVDWLRNILNEISEAIEFSTQHQTIDAAKANCxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVTKFSQKSLADEIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DFS, chain A
Confidence level:probable
Coverage over the Query: 386-445
View the alignment between query and template
View the model in PyMOL
Template: 3MQ9, chain A
Confidence level:probable
Coverage over the Query: 350-431
View the alignment between query and template
View the model in PyMOL
Template: 1M1J, chain B
Confidence level:probable
Coverage over the Query: 294-325
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3vkg, chain A probable Alignment | Template Structure