Citrus Sinensis ID: 012827


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-----
MMLRIKRVPTVVSNYQKEETEEAAAAARRVSGCGRNCLNKCCIQGAKLPLYAFKRVNKFKTEMGVHGHEVREPEPPVAFLDSLVLGEWEDRVQRGLFRYDVTACETRVIPGQYGFIAQLNEGRHLKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEASEDGEVQFHPSAPIDVENSPSVVAINVSPIEYGHVLLIPRVLECLPQRIDRDSFLLALYMAAEAGNPYFRLGYNSLGAFATINHLHFQAYYMALPFPIEKAPTKKIISTGSGVKISELLNYPVRGLVFEGGNSLEDLSNTVSDACICLQENNIPYNVLIADCGKRIFLLPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAEVSLSEERYQEVNALIFEAIARGDDANGGVAESVIGEADAKPKSGGEVDAINKNSCPAMVSGTPECLVLQ
ccEEEEEccEEEccccccHHHHHHHHcccccccccccccccccccccccccccccccEEECcccccccccccccccccHHHHHHHHHHHHHHHccccccccccCEEEECcccCEEEEEEccccccccccccccccccccccccccccccccccccccEEEECcccccccccccccccccccccEEEEEcccccccEEEEEcccccccccCCcccHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHccccccccccccccCECccccEEEEEEccccCEEEEEECcccHHHHHHHHHHHHHHHcccccccEEEEEEcccEEEEEccccccccccccccccccccccccEEEEcccccccccHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEcc
*MLRIKRVPTVVSNYQ*************VSGCGRNCLNKCCIQGAKLPLYAFKRVNKFKTEMGVHGHEVREPEPPVAFLDSLVLGEWEDRVQRGLFRYDVTACETRVIPGQYGFIAQLNEGRHLKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEASEDG**QFHPSAPIDVENSPSVVAINVSPIEYGHVLLIPRVLECLPQRIDRDSFLLALYMAAEAGNPYFRLGYNSLGAFATINHLHFQAYYMALPFPIEKAPTKKIISTGSGVKISELLNYPVRGLVFEGGNSLEDLSNTVSDACICLQENNIPYNVLIADCGKRIFLLPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAEVSLSEERYQEVNALIFEAIARGD****************************KNSCPAMVSGTPECLVLQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMLRIKRVPTVVSNYQKEETEEAAAAARRVSGCGRNCLNKCCIQGAKLPLYAFKRVNKFKTEMGVHGHEVREPEPPVAFLDSLVLGEWEDRVQRGLFRYDVTACETRVIPGQYGFIAQLNEGRHLKKRPTEFRVDKVLQPFDGNKFNFTKVGQEEVLFQFEASEDGEVQFHPSAPIDVENSPSVVAINVSPIEYGHVLLIPRVLECLPQRIDRDSFLLALYMAAEAGNPYFRLGYNSLGAFATINHLHFQAYYMALPFPIEKAPTKKIISTGSGVKISELLNYPVRGLVFEGGNSLEDLSNTVSDACICLQENNIPYNVLIADCGKRIFLLPQCYAEKQALGEVSSELLDTQVNPAVWEISGHMVLKRKKDYEEASEENAWRLLAEVSLSEERYQEVNALIFEAIARGDDANGGVAESVIGEADAKPKSGGEVDAINKNSCPAMVSGTPECLVLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GDP-L-galactose phosphorylase 1 Catalyzes a reaction of the Smirnoff-Wheeler pathway, the major route to ascorbate biosynthesis in plants. Acts as a phosphorylase rather than as a transferase. Uses preferentially GDP-L-galactose and GDP-D-glucose as substrates. Lower activity with GDP-L-fucose, very low activity with GDP-D-mannose, and no activity with UDP-D-glucose, UDP-D-galactose or ADP-D-glucose. Highly specific for inorganic phosphate as the guanylyl acceptor.confidentQ8RWE8
GDP-L-galactose phosphorylase 2 Catalyzes a reaction of the Smirnoff-Wheeler pathway, the major route to ascorbate biosynthesis in plants. Acts as a phosphorylase rather than as a transferase. Uses preferentially GDP-L-galactose and GDP-D-glucose as substrates. Lower activity with GDP-L-fucose, very low activity with GDP-D-mannose, and no activity with UDP-D-glucose, UDP-D-galactose or ADP-D-glucose. Highly specific for inorganic phosphate as the guanylyl acceptor.probableQ9FLP9

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.7.-Nucleotidyltransferases.probable
2.7.7.69GDP-L-galactose phosphorylase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3R6F, chain A
Confidence level:confident
Coverage over the Query: 177-254
View the alignment between query and template
View the model in PyMOL
Template: 3ANO, chain A
Confidence level:confident
Coverage over the Query: 134-254
View the alignment between query and template
View the model in PyMOL