Citrus Sinensis ID: 012869


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450----
MPPQQHEQEQDHLLPLLADDREERAYDPTEKVVVIGLDDGDLDNLSTAPPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQSGAIAGYSLLWLLLWATAVGLLVQLLSARLGVATGRHLAELCREEYPSWARMVLWVMAELALIGSDIQEVIGSAIAIKILSNGILPLWSGVVITALDCFIFLFLENYGVRKLEAVFAVLIATMALSFAWMFGETKPSGSELLIGILVPKLSSKTIQQAVGVVGCIIMPHNVFLHSALVQSRDIDNNKKGRVQEALRYYSIESTLALVVSFMINLFVTTVFAKGFYGTEQANNIGLVNAGQYLQEKYGGGLFPILYIWGIGLLAAGQSSTITGTYAGQFIMGGFLNLRLKKWLRALITRSCAIVPTIIVALVFDTSEDMLDVLNEWLNVLQSVQIPFALIPLLYLVSQEHIMGTFKIGPILKVCLIIALFYILL
ccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHECcccHHHHHcccccccccccHHHHHHHHHcccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHcccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcc
******************************************D*****PPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQSGAIAGYSLLWLLLWATAVGLLVQLLSARLGVATGRHLAELCREEYPSWARMVLWVMAELALIGSDIQEVIGSAIAIKILSNGILPLWSGVVITALDCFIFLFLENYGVRKLEAVFAVLIATMALSFAWMFGETKPSGSELLIGILVPKLSSKTIQQAVGVVGCIIMPHNVFLHSALVQSRDIDNNKKGRVQEALRYYSIESTLALVVSFMINLFVTTVFAKGFYGTEQANNIGLVNAGQYLQEKYGGGLFPILYIWGIGLLAAGQSSTITGTYAGQFIMGGFLNLRLKKWLRALITRSCAIVPTIIVALVFDTSEDMLDVLNEWLNVLQSVQIPFALIPLLYLVSQEHIMGTFKIGPILKVCLIIALFYILL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPQQHEQEQDHLLPLLADDREERAYDPTEKVVVIGLDDGDLDNLSTAPPFSWKKLWLFTGPGFLMSIAFLDPGNLEGDLQSGAIAGYSLLWLLLWATAVGLLVQLLSARLGVATGRHLAELCREEYPSWARMVLWVMAELALIGSDIQEVIGSAIAIKILSNGILPLWSGVVITALDCFIFLFLENYGVRKLEAVFAVLIATMALSFAWMFGETKPSGSELLIGILVPKLSSKTIQQAVGVVGCIIMPHNVFLHSALVQSRDIDNNKKGRVQEALRYYSIESTLALVVSFMINLFVTTVFAKGFYGTEQANNIGLVNAGQYLQEKYGGGLFPILYIWGIGLLAAGQSSTITGTYAGQFIMGGFLNLRLKKWLRALITRSCAIVPTIIVALVFDTSEDMLDVLNEWLNVLQSVQIPFALIPLLYLVSQEHIMGTFKIGPILKVCLIIALFYILL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Metal transporter Nramp6 Probable metal transporter.probableQ2QN30
Metal transporter Nramp3 Vacuolar metal transporter involved in intracellular metal homeostasis. Can transport iron (Fe), manganese (Mn) and cadmium (Cd). Regulates metal accumulation under Fe starvation. Acts redundantly with NRAMP4 to mobilize vacuolar Fe and provide sufficient Fe during seed germination. In association with NRAMP4, required for optimal growth and photosynthesis under Mn deficiency. Exports Mn from vacuoles in leaf mesophyll cells, making Mn available for functional photosystem II in chloroplasts. Involved in basal resistance to the bacterial pathogen E.chrysanthemi.probableQ9SNV9
Divalent metal cation transporter MntH H(+)-stimulated, highly selective, manganese uptake system.probableQ2G2G3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XQ2, chain A
Confidence level:probable
Coverage over the Query: 68-185
View the alignment between query and template
View the model in PyMOL
Template: 3L1L, chain A
Confidence level:probable
Coverage over the Query: 318-359
View the alignment between query and template
View the model in PyMOL