Citrus Sinensis ID: 012891


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450----
MSRFSWLRLSRRQLLSSTAVESPINKSHCLQKAATLPQSILHKRGLYYCSSVTGTLADFGTTGMFLARRCIHATGSCYSSKRDPYELLGVPENASQDEIKKAFHMLAKQYHPDANKNNPSAKRKFQEIRDAYETLRDSEKRAQYDRRRSRGSENEKYSAGDAEGFRYAGDAEGFRYAYQTHFSDSFHKIFSEIFEDETSHFAPDIQVELVLSFAEAAKGCTKHVSFDAFVPCDSCHGRGFPADAKTKICSTCRGIGRVTIPPFTSTCSTCKGLGRIIKDHCMTCKGSGVVDGVKEVKVTIPAGVDSGDTIRVPEAGNAGGRGRQHGNLFIKLKVADDPIFSRDGADVYVDSNISFTQAILGGKVDVPTLSGKVQVKIPKGVQPGQLLVLRGKGLAKNGLFLDHGDQYVRFRVNFPTALNERQRAILEEFAEEEINNENNTSAEENWLYQQLSTG
cccccEEEEcccccccccccccccccccEEccccccccccEEccccccccccccccccccccccccccEEEcccccccccccccEEEccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEHHHHHccccEEEEEccccccccccccccccccccccccccccccEEEEccccccccccccccEEcccccccccccCEEEEEEEEEEEcccccccccEEEEcccccccccccccccEEEEEEEEcccccEEccccEEEEEEccHHHHcccccEEEEccccEEEEEcccccccccEEEEccccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHHHccccccccccccHHHHHcccc
*****W**LSRR*************KSHCLQKAATLPQSILHKRGLYYCSSVTGTLADFGTTGMFLARRCIHATGSCYSSKRDPYELLGVPENASQDEIKKAFHMLAKQYHPDANKNNPSAKRKFQEIRDAYETLRDSEKRAQYDRRRSRGSENEK******EGFRYAGDAEGFRYAYQTHFSDSFHKIFSEI*EDE**HFAPDIQVELVLSFAEAAKGCTKHVSFDAFVPCDSCHGRGFPADAKTKICSTCRGIGRVTIPPFTSTCSTCKGLGRIIKDHCMTCKGSGVVDGVKEVKVTIPAGVDSGDTIRV*********GRQHGNLFIKLKVADDPIFSRDGADVYVDSNISFTQAILGGKVDVPTLSGKVQVKIPKGVQPGQLLVLRGKGLAKNGLFLDHGDQYVRFRVNFPTALNERQRAILE********************YQQLST*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRFSWLRLSRRQLLSSTAVESPINKSHCLQKAATLPQSILHKRGLYYCSSVTGTLADFGTTGMFLARRCIHATGSCYSSKRDPYELLGVPENASQDEIKKAFHMLAKQYHPDANKNNPSAKRKFQEIRDAYETLRDSEKRAQYDRRRSRGSENEKYSAGDAEGFRYAGDAEGFRYAYQTHFSDSFHKIFSEIFEDETSHFAPDIQVELVLSFAEAAKGCTKHVSFDAFVPCDSCHGRGFPADAKTKICSTCRGIGRVTIPPFTSTCSTCKGLGRIIKDHCMTCKGSGVVDGVKEVKVTIPAGVDSGDTIRVPEAGNAGGRGRQHGNLFIKLKVADDPIFSRDGADVYVDSNISFTQAILGGKVDVPTLSGKVQVKIPKGVQPGQLLVLRGKGLAKNGLFLDHGDQYVRFRVNFPTALNERQRAILEEFAEEEINNENNTSAEENWLYQQLSTG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chaperone protein dnaJ 1, mitochondrial Have a continuous role in plant development probably in the structural organization of compartments.probableQ38813

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LZ8, chain A
Confidence level:very confident
Coverage over the Query: 204-238,256-258,289-431
View the alignment between query and template
View the model in PyMOL
Template: 1NLT, chain A
Confidence level:very confident
Coverage over the Query: 199-416
View the alignment between query and template
View the model in PyMOL
Template: 3BVO, chain A
Confidence level:confident
Coverage over the Query: 44-147
View the alignment between query and template
View the model in PyMOL