Citrus Sinensis ID: 012924

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450---
MTKTLISSPPFVGTPLPSPSSSLSRHGLHRLPNRRLASTRVRLSFQEIPPILSLDSSIDLNSVFSRTESLLYTLADAAVSLDSASGGAASTSADGATQKNGGWFGFISEAMEFVLKILKDGIDAVHVPYSYGFAIILLTVIVKVATFPLTKKQVESTLAMQNLQPKIKAIQQRYAGNQERIQLETSRLYRQAGVNPLAGCLPTLATIPVWIGLYQALSNVANEGLLTEGFFWIPSLSGPTTIAARQSGSGISWLLPFVDGHPPLGWHDTAAYLVLPVLLVVSQYASMELMKPPQTDDPAQKNTLLVFKFLPLMIGYFSLSVPSGLSIYWFTNNVLSTAQQVWLRKLGGAKPVVTENASEIITAGRAKRSVSQPSRAGDRFRQLKEEEKGKKLNKALPAEDVQTMNSASDSEGESDGEKGQGVLEEAYASNRSKQVPDPSRPRKSKRSKRKRAV
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHccccccccccccccccccHHHHcccc
********PPFVGTPLP*********GLHRLPNRRLASTRVRLSFQEIPPILSLDSSIDLNSVFSRTESLLYTLADAAVSLDSASGGAASTSADGATQKNGGWFGFISEAMEFVLKILKDGIDAVHVPYSYGFAIILLTVIVKVATFPLTKKQVESTLAMQNLQPKIKAIQQRYAGNQERIQLETSRLYRQAGVNPLAGCLPTLATIPVWIGLYQALSNVANEGLLTEGFFWIPSLSGPTTIAARQSGSGISWLLPFVDGHPPLGWHDTAAYLVLPVLLVVSQYASM**************NTLLVFKFLPLMIGYFSLSVPSGLSIYWFTNNVLSTAQQVWLRKLGGAK*******************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKTLISSPPFVGTPLPSPSSSLSRHGLHRLPNRRLASTRVRLSFQEIPPILSLDSSIDLNSVFSRTESLLYTLADAAVSLDSASGGAASTSADGATQKNGGWFGFISEAMEFVLKILKDGIDAVHVPYSYGFAIILLTVIVKVATFPLTKKQVESTLAMQNLQPKIKAIQQRYAGNQERIQLETSRLYRQAGVNPLAGCLPTLATIPVWIGLYQALSNVANEGLLTEGFFWIPSLSGPTTIAARQSGSGISWLLPFVDGHPPLGWHDTAAYLVLPVLLVVSQYASMELMKPPQTDDPAQKNTLLVFKFLPLMIGYFSLSVPSGLSIYWFTNNVLSTAQQVWLRKLGGAKPVVTENASEIITAGRAKRSVSQPSRAGDRFRQLKEEEKGKKLNKALPAEDVQTMNSASDSEGESDGEKGQGVLEEAYASNRSKQVPDPSRPRKSKRSKRKRAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Inner membrane protein ALBINO3, chloroplastic Required for the insertion of some light harvesting chlorophyll-binding proteins (LHCP) into the chloroplast thylakoid membrane. Required for the insertion of LHCB1, LHCB4.1 and LHCB5 proteins into thylakoid membrane, while it is not required for insertion of proteins PsbX, PsbW and PsbY.confidentQ8LBP4
Inner membrane protein PPF-1, chloroplastic May be required for the insertion of some integral membrane proteins into the chloroplast thylakoid membrane. May play a role in inhibiting senescence.probableQ9FY06

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted