Citrus Sinensis ID: 012938

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450---
MVSKDSPPNPASNMLHQFIISDSITAQNLANQHFDTYGSALRGNNILPHSFGVLPSIQSLGERISRSMDLVHVHAPAVAEESSEISHTRHLMDLLGASNETNDQSQRLSLSLGSHMLVPSGHYNQSPNYLFYGDEAREVCNPGVDQHVSEGYSFNSNSINRACSIDGTESFAYAVGNSRFLRPAQSLLEEVVNVGKNIDMSDERYISKLYHGSRRGGLRLSSELKAEMCNTGTLSAEKQELHLRIAKLISLLEEVESKYEIYYNQMEEVVSSYEVIAGLGAAKSYTSLALQAMSRHFCSLRDAIISQINIASRRFYQDLPKISSGLSQLSLFDREARHHRMSLQQLGMFHSQRQVWRPIRGLPETSVGILRSWLFEHFLHPYPNDSEKQLLASQTGLTKNQVSNWFINARVRLWKPMIEEMYREEFADSSEDSNPSFAGSSATREGGADQAGD
ccccccccccccccHHHHHcccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHcccccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccccccccccccc
cccccccccccHHHHHHHcccccccccccccccccccccHccccccccccccccccccccccccccccccccccccHcccccccccccHHHHHHHcccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccccccccccccccccccccccc
mvskdsppnpasnmlHQFIISDSITAQNLANQHFDtygsalrgnnilphsfgvlpsIQSLGERISRSMDLVHvhapavaeesseishTRHLMDLlgasnetndqSQRLSLSLgshmlvpsghynqspnylfygdearevcnpgvdqhvsegysfnsnsinracsidgtesfayavgnsrflrpAQSLLEEVVNVgknidmsdeRYISklyhgsrrgglrlsSELKAEMCNTGTLSAEKQELHLRIAKLISLLEEVESKYEIYYNQMEEVVSSYEVIAGLGAAKSYTSLALQAMSRHFCSLRDAIISQINIASRRFyqdlpkissglsqlsLFDREARHHRMSLQQlgmfhsqrqvwrpirglpetsvGILRSWLFehflhpypndseKQLLASQtgltknqvsnWFINARVRLWKPMIEEMYReefadssedsnpsfagssatreggadqagd
mvskdsppnpaSNMLHQFIISDSITAQNLANQHFDTYGSALRGNNILPHSFGVLPSIQSLGERISRSMDLVHVHAPAvaeesseisHTRHLMDLLGASNETNDQSQRLSLSLGSHMLVPSGHYNQSPNYLFYGDEAREVCNPGVDQHVSEGYSFNSNSINRACSIDGTESFAYAVGNSRFLRPAQSLLEEVVNVgknidmsderyisklyhgsrrgglrlSSELKAEMCNTGTLSAEKQELHLRIAKLISLLEEVESKYEIYYNQMEEVVSSYEVIAGLGAAKSYTSLALQAMSRHFCSLRDAIISQINIASRRFYQDLPKISSGLSQLSLFDREARHHRMSLQQLGMFHSQRQVWRPIRGLPETSVGILRSWLFEHFLHPYPNDSEKQLLASQTgltknqvsnwfiNARVRLWKPMIEEMYREEfadssedsnpsfagssatreggadqagd
MVSKDSPPNPASNMLHQFIISDSITAQNLANQHFDTYGSALRGNNILPHSFGVLPSIQSLGERISRSMDLVHVHAPAVAEESSEISHTRHLMDLLGASNETNDQSQRLSLSLGSHMLVPSGHYNQSPNYLFYGDEAREVCNPGVDQHVSEGYSFNSNSINRACSIDGTESFAYAVGNSRFLRPAQSLLEEVVNVGKNIDMSDERYISKLYHGSRRGGLRLSSELKAEMCNTGTLSAEKQELHLRIAKLISLLEEVESKYEIYYNQMEEVVSSYEVIAGLGAAKSYTSLALQAMSRHFCSLRDAIISQINIASRRFYQDLPKISSGLSQLSLFDREARHHRMSLQQLGMFHSQRQVWRPIRGLPETSVGILRSWLFEHFLHPYPNDSEKQLLASQTGLTKNQVSNWFINARVRLWKPMIEEMYREEFADSSEDSNPSFAGSSATREGGADQAGD
**************LHQFIISDSITAQNLANQHFDTYGSALRGNNILPHSFGVLPSIQSLGERISRSMDLVHVH*****************************************************NYLFYGDEAREVCNPGVDQHVSEGYSFNSNSINRACSIDGTESFAYAVGNSRFLRPAQSLLEEVVNVGKNIDMSDERYISKLYHGSRRGGLRL*****AEMCNTGTLSAEKQELHLRIAKLISLLEEVESKYEIYYNQMEEVVSSYEVIAGLGAAKSYTSLALQAMSRHFCSLRDAIISQINIASRRFYQDLPKISSGLSQLSLFDREARHHRMSLQQLGMFHSQRQVWRPIRGLPETSVGILRSWLFEHFLHPYPND**KQLLASQTGLTKNQVSNWFINARVRLWKPMIEEMY*******************************
*********************************************************************************************************************************************************************************SRFLRPAQSLLEEVVNVGK**********************************************LRIAKLISLLEEVESKYEIYYNQMEEVVSSYEVIAGLGAAKSYTSLALQAMSRHFCS*******************************************************************VGILRSWLFEHFLHPYPNDSEKQLLASQTGLTKNQVSNWFINARVRLWKP*************************************
**********ASNMLHQFIISDSITAQNLANQHFDTYGSALRGNNILPHSFGVLPSIQSLGERISRSMDLVHVHA************TRHLMDLLGASNETNDQSQRLSLSLGSHMLVPSGHYNQSPNYLFYGDEAREVCNPGVDQHVSEGYSFNSNSINRACSIDGTESFAYAVGNSRFLRPAQSLLEEVVNVGKNIDMSDERYISKLYHGSRRGGLRLSSELKAEMCNTGTLSAEKQELHLRIAKLISLLEEVESKYEIYYNQMEEVVSSYEVIAGLGAAKSYTSLALQAMSRHFCSLRDAIISQINIASRRFYQDLPKISSGLSQLSLFDREARHHRMSLQQLGMFHSQRQVWRPIRGLPETSVGILRSWLFEHFLHPYPNDSEKQLLASQTGLTKNQVSNWFINARVRLWKPMIEEMYREE****************************
**************L***IISDSITAQ*LANQHFDTYGSALRGNNILPHSFGVLPS****************************ISHTRHLMDLLGASNETNDQSQRLSLSLGSHMLVPSGHYNQSPNYLFYGDEAREVCNPGVDQHVSEGYSFNSNSINRACSIDGTESFAYAVGNSRFLRPAQSLLEEVVNVGK***************************************AEKQELHLRIAKLISLLEEVESKYEIYYNQMEEVVSSYEVIAGLGAAKSYTSLALQAMSRHFCSLRDAIISQINIASRRFYQ******SGLSQLSLFDREARHHRMSLQQLGMFHSQRQVWRPIRGLPETSVGILRSWLFEHFLHPYPNDSEKQLLASQTGLTKNQVSNWFINARVRLWKPMIEEMYREEFAD*************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSKDSPPNPASNMLHQFIISDSITAQNLANQHFDTYGSALRGNNILPHSFGVLPSIQSLGERISRSMDLVHVHAPAVAEESSEISHTRHLMDLLGASNETNDQSQRLSLSLGSHMLVPSGHYNQSPNYLFYGDEAREVCNPGVDQHVSEGYSFNSNSINRACSIDGTESFAYAVGNSRFLRPAQSLLEEVVNVGKNIDMSDERYISKLYHGSRRGGLRLSSELKAEMCNTGTLSAExxxxxxxxxxxxxxxxxxxxxYEIYYNQMEEVVSSYEVIAGLGAAKSYTSLALQAMSRHFCSLRDAIISQINIASRRFYQDLPKISSGLSQLSLFDREARHHRMSLQQLGMFHSQRQVWRPIRGLPETSVGILRSWLFEHFLHPYPNDSEKQLLASQTGLTKNQVSNWFINARVRLWKPMIEEMYREEFADSSEDSNPSFAGSSATREGGADQAGD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query453 2.2.26 [Sep-21-2011]
Q1PFD1290 BEL1-like homeodomain pro yes no 0.562 0.879 0.598 1e-85
Q9FXG8538 BEL1-like homeodomain pro no no 0.565 0.475 0.490 4e-67
Q9SIW1482 BEL1-like homeodomain pro no no 0.551 0.518 0.492 2e-65
Q9FWS9524 BEL1-like homeodomain pro no no 0.571 0.494 0.479 2e-64
O65685 532 BEL1-like homeodomain pro no no 0.845 0.719 0.365 1e-62
Q9SJ56 680 BEL1-like homeodomain pro no no 0.514 0.342 0.453 5e-54
Q9SW80 739 BEL1-like homeodomain pro no no 0.540 0.331 0.460 5e-53
Q94KL5 627 BEL1-like homeodomain pro no no 0.547 0.395 0.453 2e-51
Q8S897 431 BEL1-like homeodomain pro no no 0.474 0.498 0.459 3e-50
Q9LZM8 575 BEL1-like homeodomain pro no no 0.611 0.481 0.372 1e-47
>sp|Q1PFD1|BLH11_ARATH BEL1-like homeodomain protein 11 OS=Arabidopsis thaliana GN=BLH11 PE=2 SV=1 Back     alignment and function desciption
 Score =  317 bits (812), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 158/264 (59%), Positives = 209/264 (79%), Gaps = 9/264 (3%)

Query: 177 NSRFLRPAQSLLEEVVNVG-KNIDMSDERYISKLYHGSRRGGLRLSSELKAEMCNTGTLS 235
           +SR+ +  Q L+EEV+++G + +++ +   I++L+ G RR G  LSSE+K+E+C++G +S
Sbjct: 19  DSRYAKAVQCLVEEVIDIGGREVELCNNILINQLFPGRRRPGFALSSEIKSELCSSGFMS 78

Query: 236 -AEKQELHLRIAKLISLLEEVESKYEIYYNQMEEVVSSYEVIAGLGAAKSYTSLALQAMS 294
             E  E+H++I KL+SLL++VE ++E Y NQ+E+V+SS+E IAG G++K YT LALQAM+
Sbjct: 79  LPENHEIHIKITKLLSLLQQVEERFEQYCNQLEQVISSFEEIAGEGSSKVYTGLALQAMT 138

Query: 295 RHFCSLRDAIISQINIASRRF---YQDLPKI-SSGLSQLSLFDREARHHRMSLQQLGMFH 350
           RHF SL +AIISQ+N   RRF   +QD+PKI SSGLSQLSLFD        SLQ+LG+  
Sbjct: 139 RHFGSLEEAIISQLNSVRRRFIISHQDVPKIISSGLSQLSLFDGNTTSS--SLQRLGLVQ 196

Query: 351 S-QRQVWRPIRGLPETSVGILRSWLFEHFLHPYPNDSEKQLLASQTGLTKNQVSNWFINA 409
             QR  W+PIRGLPETSV ILR+WLF+HFLHPYPN++EK +LASQTGL+KNQVSNWFINA
Sbjct: 197 GPQRHAWKPIRGLPETSVAILRAWLFQHFLHPYPNEAEKLVLASQTGLSKNQVSNWFINA 256

Query: 410 RVRLWKPMIEEMYREEFADSSEDS 433
           RVRLWKPMIEEMYREEF DS ++S
Sbjct: 257 RVRLWKPMIEEMYREEFGDSLDES 280

Arabidopsis thaliana (taxid: 3702)
>sp|Q9FXG8|BLH10_ARATH BEL1-like homeodomain protein 10 OS=Arabidopsis thaliana GN=BLH10 PE=1 SV=1 Back     alignment and function description
>sp|Q9SIW1|BLH7_ARATH BEL1-like homeodomain protein 7 OS=Arabidopsis thaliana GN=BLH7 PE=2 SV=1 Back     alignment and function description
>sp|Q9FWS9|BLH3_ARATH BEL1-like homeodomain protein 3 OS=Arabidopsis thaliana GN=BLH3 PE=1 SV=1 Back     alignment and function description
>sp|O65685|BLH6_ARATH BEL1-like homeodomain protein 6 OS=Arabidopsis thaliana GN=BLH6 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJ56|BLH1_ARATH BEL1-like homeodomain protein 1 OS=Arabidopsis thaliana GN=BLH1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SW80|BLH2_ARATH BEL1-like homeodomain protein 2 OS=Arabidopsis thaliana GN=BLH2 PE=1 SV=3 Back     alignment and function description
>sp|Q94KL5|BLH4_ARATH BEL1-like homeodomain protein 4 OS=Arabidopsis thaliana GN=BLH4 PE=2 SV=2 Back     alignment and function description
>sp|Q8S897|BLH5_ARATH BEL1-like homeodomain protein 5 OS=Arabidopsis thaliana GN=BLH5 PE=2 SV=2 Back     alignment and function description
>sp|Q9LZM8|BLH9_ARATH BEL1-like homeodomain protein 9 OS=Arabidopsis thaliana GN=BLH9 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query453
225458165470 PREDICTED: BEL1-like homeodomain protein 0.991 0.955 0.7 0.0
255538764469 bel1 homeotic protein, putative [Ricinus 0.995 0.961 0.656 1e-172
147766087533 hypothetical protein VITISV_001986 [Viti 0.909 0.772 0.694 1e-166
224066121445 predicted protein [Populus trichocarpa] 0.947 0.964 0.662 1e-163
356509666440 PREDICTED: BEL1-like homeodomain protein 0.916 0.943 0.599 1e-142
224082920383 predicted protein [Populus trichocarpa] 0.841 0.994 0.663 1e-138
356518014447 PREDICTED: BEL1-like homeodomain protein 0.907 0.919 0.585 1e-134
31323445393 bell-like homeodomain protein 1, partial 0.827 0.954 0.557 1e-112
145337579290 BEL1-like homeodomain 11 [Arabidopsis th 0.562 0.879 0.598 7e-84
297842287290 predicted protein [Arabidopsis lyrata su 0.562 0.879 0.590 3e-83
>gi|225458165|ref|XP_002281033.1| PREDICTED: BEL1-like homeodomain protein 11 [Vitis vinifera] gi|302142555|emb|CBI19758.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/470 (70%), Positives = 381/470 (81%), Gaps = 21/470 (4%)

Query: 1   MVSKDSPPNPASNMLHQFIISDSITAQN-LANQHFDTYGSALRGNNILPHSFGVLPSIQS 59
           MVS++S PNP S++LHQFIISDS T+ N   N HFD YGS LRG+N  P S GVLPSIQS
Sbjct: 1   MVSQESSPNPTSSILHQFIISDSFTSPNQFENHHFDAYGSHLRGSNTFPQSLGVLPSIQS 60

Query: 60  LGERISRSMDLVHVHAPAVAEESSEISHTRHLMDLLGASNETNDQSQRLSLSLGSHMLVP 119
           LGER+SRS+DLV   APAV EES EISHTRH MDLLGA+NE+N Q+ RLSLSLGSH+L+P
Sbjct: 61  LGERMSRSIDLVQ--APAVGEES-EISHTRHFMDLLGAANESNHQAHRLSLSLGSHVLMP 117

Query: 120 SGHYNQSP--------NYLFYGDEAREVCNPGVDQ------HVSEGYSFNSNSINRACSI 165
           S HY Q P        NYLF G+EARE CNPGV++      +VS  ++  S S+NR+CS 
Sbjct: 118 SVHYRQRPLNSDFVSSNYLFSGEEAREACNPGVERLCDDYSYVSSAFATPSTSLNRSCST 177

Query: 166 D-GTESFAYAVGNSRFLRPAQSLLEEVVNVG-KNIDMSDERYISKLYHGSRRGGLRLSSE 223
             GTESF  AVGNSR+LRP QSLLEEVVN G K ID+S+E+YI +L    RRG L  +SE
Sbjct: 178 SYGTESFVNAVGNSRYLRPTQSLLEEVVNAGGKAIDLSNEKYIGRLSRSGRRGALGFASE 237

Query: 224 LKAEMCNTGTLSAEKQELHLRIAKLISLLEEVESKYEIYYNQMEEVVSSYEVIAGLGAAK 283
           LKAE+C  G+LSAEKQ++ + IAKLI LLEEVES+YE YY+QME+VVSS+EVIAG+GAAK
Sbjct: 238 LKAELCGNGSLSAEKQDIQIEIAKLIGLLEEVESRYEEYYHQMEDVVSSFEVIAGVGAAK 297

Query: 284 SYTSLALQAMSRHFCSLRDAIISQINIASRRFYQDLPKISSGLSQLSLFDREARHHRMSL 343
           SYT+LALQAM RHFCSLRDAIISQIN+A R+   DLPKIS+G SQLSLFD+E R++RM+L
Sbjct: 298 SYTALALQAMFRHFCSLRDAIISQINVARRKLSHDLPKISTGFSQLSLFDQEGRNNRMTL 357

Query: 344 QQLGMFHSQRQVWRPIRGLPETSVGILRSWLFEHFLHPYPNDSEKQLLASQTGLTKNQVS 403
           QQLGMF S RQ WRPIRGLPETSV ILRSWLFEHFLHPYPNDSEK +LASQTGLTKNQVS
Sbjct: 358 QQLGMFQSHRQAWRPIRGLPETSVAILRSWLFEHFLHPYPNDSEKLMLASQTGLTKNQVS 417

Query: 404 NWFINARVRLWKPMIEEMYREEFADSSEDSNPSFAGSSATREGGADQAGD 453
           NWFINARVRLWKPMIEEMY+EEFA+SS +S+P    SS+TREGGA   G+
Sbjct: 418 NWFINARVRLWKPMIEEMYKEEFAESSVESDP-LVASSSTREGGASDNGE 466

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255538764|ref|XP_002510447.1| bel1 homeotic protein, putative [Ricinus communis] gi|223551148|gb|EEF52634.1| bel1 homeotic protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147766087|emb|CAN65695.1| hypothetical protein VITISV_001986 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224066121|ref|XP_002302013.1| predicted protein [Populus trichocarpa] gi|222843739|gb|EEE81286.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356509666|ref|XP_003523567.1| PREDICTED: BEL1-like homeodomain protein 11-like [Glycine max] Back     alignment and taxonomy information
>gi|224082920|ref|XP_002306891.1| predicted protein [Populus trichocarpa] gi|222856340|gb|EEE93887.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356518014|ref|XP_003527679.1| PREDICTED: BEL1-like homeodomain protein 11-like [Glycine max] Back     alignment and taxonomy information
>gi|31323445|gb|AAP47024.1|AF375965_1 bell-like homeodomain protein 1, partial [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|145337579|ref|NP_177676.2| BEL1-like homeodomain 11 [Arabidopsis thaliana] gi|122244097|sp|Q1PFD1.1|BLH11_ARATH RecName: Full=BEL1-like homeodomain protein 11; Short=BEL1-like protein 11 gi|91806093|gb|ABE65775.1| homeodomain-containing protein [Arabidopsis thaliana] gi|225898082|dbj|BAH30373.1| hypothetical protein [Arabidopsis thaliana] gi|332197598|gb|AEE35719.1| BEL1-like homeodomain 11 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297842287|ref|XP_002889025.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297334866|gb|EFH65284.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query453
TAIR|locus:2018457290 BLH11 "BEL1-like homeodomain 1 0.562 0.879 0.598 9.7e-80
TAIR|locus:2013154538 BEL10 "AT1G19700" [Arabidopsis 0.655 0.552 0.455 1.3e-65
TAIR|locus:2018398524 BLH3 "AT1G75410" [Arabidopsis 0.569 0.492 0.477 6.1e-62
TAIR|locus:2139614 532 BLH6 "AT4G34610" [Arabidopsis 0.668 0.569 0.433 1.1e-60
TAIR|locus:2042609482 BLH7 "AT2G16400" [Arabidopsis 0.551 0.518 0.492 8.1e-60
TAIR|locus:2039250 680 BLH1 "AT2G35940" [Arabidopsis 0.699 0.466 0.415 5.3e-56
TAIR|locus:2115000 739 BLH2 "AT4G36870" [Arabidopsis 0.706 0.433 0.402 9.9e-54
TAIR|locus:2049035 627 BLH4 "BEL1-like homeodomain 4" 0.600 0.433 0.434 9.2e-52
TAIR|locus:2177856 611 BEL1 "AT5G41410" [Arabidopsis 0.437 0.324 0.483 8.6e-47
TAIR|locus:2185183 575 RPL "AT5G02030" [Arabidopsis t 0.567 0.446 0.397 7.9e-46
TAIR|locus:2018457 BLH11 "BEL1-like homeodomain 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 801 (287.0 bits), Expect = 9.7e-80, P = 9.7e-80
 Identities = 158/264 (59%), Positives = 209/264 (79%)

Query:   177 NSRFLRPAQSLLEEVVNVG-KNIDMSDERYISKLYHGSRRGGLRLSSELKAEMCNTGTLS 235
             +SR+ +  Q L+EEV+++G + +++ +   I++L+ G RR G  LSSE+K+E+C++G +S
Sbjct:    19 DSRYAKAVQCLVEEVIDIGGREVELCNNILINQLFPGRRRPGFALSSEIKSELCSSGFMS 78

Query:   236 A-EKQELHLRIAKLISLLEEVESKYEIYYNQMEEVVSSYEVIAGLGAAKSYTSLALQAMS 294
               E  E+H++I KL+SLL++VE ++E Y NQ+E+V+SS+E IAG G++K YT LALQAM+
Sbjct:    79 LPENHEIHIKITKLLSLLQQVEERFEQYCNQLEQVISSFEEIAGEGSSKVYTGLALQAMT 138

Query:   295 RHFCSLRDAIISQINIASRRF---YQDLPKI-SSGLSQLSLFDREARHHRMSLQQLGMFH 350
             RHF SL +AIISQ+N   RRF   +QD+PKI SSGLSQLSLFD        SLQ+LG+  
Sbjct:   139 RHFGSLEEAIISQLNSVRRRFIISHQDVPKIISSGLSQLSLFDGNTTSS--SLQRLGLVQ 196

Query:   351 S-QRQVWRPIRGLPETSVGILRSWLFEHFLHPYPNDSEKQLLASQTGLTKNQVSNWFINA 409
               QR  W+PIRGLPETSV ILR+WLF+HFLHPYPN++EK +LASQTGL+KNQVSNWFINA
Sbjct:   197 GPQRHAWKPIRGLPETSVAILRAWLFQHFLHPYPNEAEKLVLASQTGLSKNQVSNWFINA 256

Query:   410 RVRLWKPMIEEMYREEFADSSEDS 433
             RVRLWKPMIEEMYREEF DS ++S
Sbjct:   257 RVRLWKPMIEEMYREEFGDSLDES 280
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
TAIR|locus:2013154 BEL10 "AT1G19700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018398 BLH3 "AT1G75410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139614 BLH6 "AT4G34610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042609 BLH7 "AT2G16400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039250 BLH1 "AT2G35940" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115000 BLH2 "AT4G36870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049035 BLH4 "BEL1-like homeodomain 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177856 BEL1 "AT5G41410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2185183 RPL "AT5G02030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query453
pfam07526139 pfam07526, POX, Associated with HOX 2e-50
smart00574140 smart00574, POX, domain associated with HOX domain 1e-33
pfam0592040 pfam05920, Homeobox_KN, Homeobox KN domain 2e-19
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 7e-12
smart0038957 smart00389, HOX, Homeodomain 1e-09
pfam0004657 pfam00046, Homeobox, Homeobox domain 3e-06
>gnl|CDD|219452 pfam07526, POX, Associated with HOX Back     alignment and domain information 
 Score =  167 bits (424), Expect = 2e-50
 Identities = 67/137 (48%), Positives = 89/137 (64%), Gaps = 5/137 (3%)

Query: 175 VGNSRFLRPAQSLLEEVVNVGKNI----DMSDERYISKLYHGSRRGGLRLSSELKAEMCN 230
           +  S++L+PAQ LLEE  +VGKN     D S+         G+  G    SS   +   +
Sbjct: 3   LRGSKYLKPAQELLEEFCSVGKNKALDDDSSNGAENGANSSGASSGDGGGSSAGDSSDSS 62

Query: 231 TGTLS-AEKQELHLRIAKLISLLEEVESKYEIYYNQMEEVVSSYEVIAGLGAAKSYTSLA 289
           +  LS AE+QEL  + AKL+S+LEEV+ +Y  YY+QM+ V+SS+E +AGLGAAK YT+LA
Sbjct: 63  SPELSTAERQELQRKKAKLLSMLEEVDRRYRQYYDQMQMVISSFEAVAGLGAAKPYTALA 122

Query: 290 LQAMSRHFCSLRDAIIS 306
           LQAMSRHF  LRDAI  
Sbjct: 123 LQAMSRHFRCLRDAISG 139

The function of this domain is unknown. It is often found in plant proteins associated with pfam00046. Length = 139
>gnl|CDD|214728 smart00574, POX, domain associated with HOX domains Back     alignment and domain information
>gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 453
PF07526140 POX: Associated with HOX; InterPro: IPR006563 This 100.0
smart00574140 POX domain associated with HOX domains. 100.0
KOG0773342 consensus Transcription factor MEIS1 and related H 100.0
KOG0775304 consensus Transcription factor SIX and related HOX 99.86
KOG0774334 consensus Transcription factor PBX and related HOX 99.63
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 99.62
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.4
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.36
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.35
KOG0487308 consensus Transcription factor Abd-B, contains HOX 98.95
KOG0843197 consensus Transcription factor EMX1 and related HO 98.79
KOG0489261 consensus Transcription factor zerknullt and relat 98.74
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 98.69
KOG0488309 consensus Transcription factor BarH and related HO 98.68
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 98.67
KOG0850245 consensus Transcription factor DLX and related pro 98.65
KOG0493342 consensus Transcription factor Engrailed, contains 98.61
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 98.55
KOG0483198 consensus Transcription factor HEX, contains HOX a 98.52
KOG0492246 consensus Transcription factor MSH, contains HOX d 98.46
KOG3802398 consensus Transcription factor OCT-1, contains POU 98.45
KOG2251228 consensus Homeobox transcription factor [Transcrip 98.42
COG5576156 Homeodomain-containing transcription factor [Trans 98.33
KOG0848317 consensus Transcription factor Caudal, contains HO 98.31
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 98.31
KOG0491194 consensus Transcription factor BSH, contains HOX d 98.25
KOG0494332 consensus Transcription factor CHX10 and related H 98.22
KOG0486 351 consensus Transcription factor PTX1, contains HOX 98.1
KOG4577 383 consensus Transcription factor LIM3, contains LIM 98.1
KOG2252558 consensus CCAAT displacement protein and related h 97.98
KOG0847288 consensus Transcription factor, contains HOX domai 97.72
KOG0844 408 consensus Transcription factor EVX1, contains HOX 97.67
KOG0849354 consensus Transcription factor PRD and related pro 97.6
KOG0490235 consensus Transcription factor, contains HOX domai 97.48
KOG0773 342 consensus Transcription factor MEIS1 and related H 97.32
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 97.11
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.03
KOG0490235 consensus Transcription factor, contains HOX domai 95.5
KOG1146 1406 consensus Homeobox protein [General function predi 91.22
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 81.8
>PF07526 POX: Associated with HOX; InterPro: IPR006563 This domain in found exclusively in plant proteins, associated with HOX domains which may suggest these proteins are homeodomain transcription factors Back     alignment and domain information 
Probab=100.00  E-value=3.3e-42  Score=310.20  Aligned_cols=134  Identities=46%  Similarity=0.635  Sum_probs=100.1

Q ss_pred             ccccCCCCchhHHHHHHHHHhcCccc-ccchhhhhhh----ccCCCCCCCcccCchhhh-hhcCCCCCchHHHHHHHHHH
Q 012938          173 YAVGNSRFLRPAQSLLEEVVNVGKNI-DMSDERYISK----LYHGSRRGGLRLSSELKA-EMCNTGTLSAEKQELHLRIA  246 (453)
Q Consensus       173 ~~l~~SryLkpAQeLL~E~~~v~~~~-~~~~~~~~~~----~~~~~~~g~~~~ss~~~~-~~~~~~~~~~er~Elq~kka  246 (453)
                      ++|++|||||||||||||||+|++.. .....+....    ...+...+....+..... ...+.++++++|+|+|+||+
T Consensus         1 q~l~~SryLk~aQeLL~E~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ls~~~~~e~q~kK~   80 (140)
T PF07526_consen    1 QVLLGSRYLKPAQELLDEFCSVGGANKKKSDDSSSGAPGGANSSGSSSSSGGSSSSSSSSDSSSPELSPAERQELQRKKA   80 (140)
T ss_pred             CccccchhHHHHHHHHHHHHcccchhhhcchhhccccccccccCCCCCCCCCCCCCccccCCCCCCCChhhHHHHHHHHH
Confidence            48999999999999999999999631 1111100000    000000011111111111 11234567899999999999


Q ss_pred             HHHHHHHHHHhHHHHHHHHHHHHHHhhhhhhccCccchhhhhHHHHHHHHHhhhHHhHHH
Q 012938          247 KLISLLEEVESKYEIYYNQMEEVVSSYEVIAGLGAAKSYTSLALQAMSRHFCSLRDAIIS  306 (453)
Q Consensus       247 kLl~mL~ev~~ry~qy~~qmq~v~ssFe~~aGlgaa~~ytalal~amSrhfr~LrdaI~~  306 (453)
                      |||.||||||+||+|||||||+|+++||+|||+|+|++||+|||||||||||||||+|++
T Consensus        81 KLl~mL~eVd~RY~qY~~Qmq~VvssFe~vaG~gaA~~YtalAlqamSrhFR~LRdaI~~  140 (140)
T PF07526_consen   81 KLLSMLDEVDRRYRQYYDQMQAVVSSFEAVAGLGAAAPYTALALQAMSRHFRCLRDAISD  140 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcchhhHHHHHHHHHHHHHHHHHHhcC
Confidence            999999999999999999999999999999999999999999999999999999999963

>smart00574 POX domain associated with HOX domains Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query453
3k2a_A67 Crystal Structure Of The Homeobox Domain Of Human H 1e-13
1x2n_A73 Solution Structure Of The Homeobox Domain Of Human 1e-12
2lk2_A89 Solution Nmr Structure Of Homeobox Domain (171-248) 8e-12
2dmn_A83 The Solution Structure Of The Homeobox Domain Of Hu 3e-11
1du6_A64 Solution Structure Of The Truncated Pbx Homeodomain 8e-07
4egc_A559 Crystal Structure Of Mbp-fused Human Six1 Bound To 8e-07
1lfu_P82 Nmr Solution Stucture Of The Extended Pbx Homeodoma 9e-07
1b8i_B63 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 1e-06
1b72_B87 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 1e-06
1puf_B73 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 2e-06
>pdb|3K2A|A Chain A, Crystal Structure Of The Homeobox Domain Of Human Homeobox Protein Meis2 Length = 67 Back     alignment and structure 
Iteration: 1

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 44/62 (70%)
Query: 362 LPETSVGILRSWLFEHFLHPYPNDSEKQLLASQTGLTKNQVSNWFINARVRLWKPMIEEM 421
            P+ +  I R+WLF+H  HPYP++ +K+ LA  TGLT  QV+NWFINAR R+ +P I++ 
Sbjct: 5   FPKVATNIXRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPXIDQS 64
Query: 422 YR 423
            R
Sbjct: 65  NR 66
>pdb|1X2N|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Pknox1 Length = 73 Back     alignment and structure
>pdb|2LK2|A Chain A, Solution Nmr Structure Of Homeobox Domain (171-248) Of Human Homeobox Protein Tgif1, Northeast Structural Genomics Consortium Target Hr4411b Length = 89 Back     alignment and structure
>pdb|2DMN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Tgif2lx Length = 83 Back     alignment and structure
>pdb|1DU6|A Chain A, Solution Structure Of The Truncated Pbx Homeodomain Length = 64 Back     alignment and structure
>pdb|4EGC|A Chain A, Crystal Structure Of Mbp-fused Human Six1 Bound To Human Eya2 Eya Domain Length = 559 Back     alignment and structure
>pdb|1LFU|P Chain P, Nmr Solution Stucture Of The Extended Pbx Homeodomain Bound To Dna Length = 82 Back     alignment and structure
>pdb|1B8I|B Chain B, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 63 Back     alignment and structure
>pdb|1B72|B Chain B, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 87 Back     alignment and structure
>pdb|1PUF|B Chain B, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query453
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 2e-37
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 2e-36
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 1e-35
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 2e-34
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 7e-34
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 5e-33
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 4e-30
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 4e-27
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 7e-27
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 4e-25
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 9e-08
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 2e-07
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 6e-07
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-06
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-06
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 2e-06
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 4e-06
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 1e-04
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 1e-04
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 2e-04
2xsd_C164 POU domain, class 3, transcription factor 1; trans 3e-04
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 4e-04
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 Back     alignment and structure
 Score =  130 bits (329), Expect = 2e-37
 Identities = 32/81 (39%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 351 SQRQVWRPIRG-LPETSVGILRSWLFEHFLHPYPNDSEKQLLASQTGLTKNQVSNWFINA 409
           S     +  +G LP  SV ILR W+++H    YP++ EKQ+L+ +T L+  Q+SNWFINA
Sbjct: 2   SSGSSGKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINA 61

Query: 410 RVRLWKPMIEEMYREEFADSS 430
           R R+   M+++   +    SS
Sbjct: 62  RRRILPDMLQQRRNDPSGPSS 82
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query453
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.75
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.72
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.71
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.7
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.67
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.65
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.65
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.64
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.61
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.6
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.49
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.46
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.46
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.44
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.44
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.43
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.43
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.43
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.42
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.42
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.42
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.42
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.42
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.42
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.41
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.41
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.41
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.41
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.41
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.4
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.4
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.4
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.4
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.39
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.38
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.38
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.37
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.37
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.36
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.36
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.36
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.36
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.36
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.34
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.34
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.34
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.32
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.32
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.31
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.31
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.3
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.3
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.29
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.29
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.29
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.29
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.28
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.28
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.27
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.26
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.25
2e19_A64 Transcription factor 8; homeobox domain, structura 99.21
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.21
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.2
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.19
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.18
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.17
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.17
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.15
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.14
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.11
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.11
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.01
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.94
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.9
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 98.87
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.8
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 95.69
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 92.16
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
Probab=99.75  E-value=3.9e-19  Score=145.15  Aligned_cols=66  Identities=42%  Similarity=0.770  Sum_probs=61.8

Q ss_pred             ccCCCCCCCChhHHHHHHHHHHhhcCCCCCCHHHHHHHHHHhCCChhhhhhhhhhhhhhhchhhHH
Q 012938          354 QVWRPIRGLPETSVGILRSWLFEHFLHPYPNDSEKQLLASQTGLTKNQVSNWFINARVRLWKPMIE  419 (453)
Q Consensus       354 q~~R~Rr~Lpk~~~~iLraWf~eH~~nPYPS~eeK~~LAk~TGLS~sQVsNWFiNaR~Rl~Kpmi~  419 (453)
                      ..+++|+.|++.++.+|+.||.+|..||||+.++|..||..|||+..||.+||+|+|+|.|+++++
T Consensus         6 ~~rk~R~~~s~~q~~~L~~~f~~~~~~pYPs~~~r~~LA~~~gLs~~qV~~WFqNrR~r~k~~~~~   71 (83)
T 2dmn_A            6 SGKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQ   71 (83)
T ss_dssp             CCCCCCSSCCHHHHHHHHHHHHHTTTTCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHTHHHHTC
T ss_pred             CCCCCCCcCCHHHHHHHHHHHHHhccCCCCCHHHHHHHHHHHCcCHHHhhHHhhhhHhhhcHHHHH
Confidence            456778999999999999999999999999999999999999999999999999999999987764
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 453
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 7e-18
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 2e-16
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 4e-15
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5e-08
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 3e-07
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 8e-07
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 6e-06
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 1e-05
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 3e-05
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 3e-05
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 8e-05
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 8e-05
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 1e-04
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 1e-04
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 2e-04
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 2e-04
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 3e-04
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 4e-04
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 4e-04
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 6e-04
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 6e-04
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 0.001
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 0.001
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 0.001
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 0.002
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein pknox1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 75.2 bits (185), Expect = 7e-18
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 1/58 (1%)

Query: 357 RPIRG-LPETSVGILRSWLFEHFLHPYPNDSEKQLLASQTGLTKNQVSNWFINARVRL 413
           +  RG LP+ +  ++RSWLF+H  HPYP + EK+ +A+QT LT  QV+NWFINAR R+
Sbjct: 3   KNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRI 60
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query453
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.75
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.7
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.48
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.47
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.47
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.47
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.47
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.47
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.47
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.47
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.46
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.46
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.45
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.44
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.43
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.42
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.42
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.42
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.42
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.41
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.41
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.4
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.38
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.37
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.35
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.32
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.32
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.29
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.27
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.23
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.17
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein pknox1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.75  E-value=6.2e-19  Score=136.11  Aligned_cols=59  Identities=49%  Similarity=0.848  Sum_probs=55.7

Q ss_pred             CCCCCCCChhHHHHHHHHHHhhcCCCCCCHHHHHHHHHHhCCChhhhhhhhhhhhhhhc
Q 012938          356 WRPIRGLPETSVGILRSWLFEHFLHPYPNDSEKQLLASQTGLTKNQVSNWFINARVRLW  414 (453)
Q Consensus       356 ~R~Rr~Lpk~~~~iLraWf~eH~~nPYPS~eeK~~LAk~TGLS~sQVsNWFiNaR~Rl~  414 (453)
                      +++|+.||++++.+|+.||.+|..||||+.++|..||.+|||+..||.|||+|+|+|+.
T Consensus         3 krkR~~~~~~~~~iL~~wf~~~~~nPyPs~~e~~~La~~~~l~~~qI~~WF~N~R~R~l   61 (62)
T d1x2na1           3 KNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRIL   61 (62)
T ss_dssp             CCSSCCCCHHHHHHHHHHHHHTTTSCCCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhccCCCcCHHHHHHHHHHHCcCHHHhHHHHHHHHHHhc
Confidence            35567899999999999999999999999999999999999999999999999999975
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure