Citrus Sinensis ID: 012996


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-
MELLIASSSVADTGIGCWDLESGAEQLRYKSCASPPHGLACVGQRFLASSQLREQPSASSGSILYWSWSKPQVEVKSLPAEPIKPIAANSHGTYIAGGGQSGDIYMWEVASGRLLKKWHAHYRAVTCLVFSEDGSFLISGSEDGCVRIWSLLTVFEECESQRASHLYLHSFTGHTLRITDIVIGYGGVSATIVSASEDRTCKVWSLLKGRLLRNIVFPSVIDAIALDPAEHVFYAGSRDGSIYIAALNAESPSTSSYGMHIIGSLSDHSKAVTCLAYSTGDLLISGSEDGMVRVWDPITHNIVRMFRLAKGPVNNILVVRRPLYLNLGSFSNPHTSSRRHGSQLPPPLDKYVTSADEDVDKKGVIRLPSLYNAPRDASYISHRTIENHIKELQQQGSSAATEMEVERLKRECNRTLQMVQQWKKMYENLHEFCVNELLDGDQVDGSKRNVV
cEEEEEEEccccccEEEEEccccCEEEEEEccccccEEEEEccccEECccccccccccccccEEEEEcccccEEEEccccccEEEEEEcccccEEEEECccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEECccccEEEEEcccccccccccccccccEEccccccccEEEEEEcccccccEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEECccccEEEEEcccccccccccccccccccccccccEEEEEEccccEEEEccccccEEEEccccccEEEccccccccEEEEEEEcccccEEEccccccEEEEcccccccccccccccccccccccccccEEccccccccCEEEEEcccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc
MELLIASSSVADTGIGCWDLESGAEQLRYKSCASPPHGLACVGQRFLASSQLREQPSASSGSILYWSWSKPQVEVKSLPAEPIKPIAANSHGTYIAGGGQSGDIYMWEVASGRLLKKWHAHYRAVTCLVFSEDGSFLISGSEDGCVRIWSLLTVFEECESQRASHLYLHSFTGHTLRITDIVIGYGGVSATIVSASEDRTCKVWSLLKGRLLRNIVFPSVIDAIALDPAEHVFYAGSRDGSIYIAALNAESPSTSSYGMHIIGSLSDHSKAVTCLAYSTGDLLISGSEDGMVRVWDPITHNIVRMFRLAKGPVNNILVVRRPLYLNLGSFSNPHTSSRRHGSQLPPPLDKYVTSADEDVDKKGVIRLPSLYNAPRDASYISHRT**********************RLKRECNRTLQMVQQWKKMYENLHEFCVNELLD************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELLIASSSVADTGIGCWDLESGAEQLRYKSCASPPHGLACVGQRFLASSQLREQPSASSGSILYWSWSKPQVEVKSLPAEPIKPIAANSHGTYIAGGGQSGDIYMWEVASGRLLKKWHAHYRAVTCLVFSEDGSFLISGSEDGCVRIWSLLTVFEECESQRASHLYLHSFTGHTLRITDIVIGYGGVSATIVSASEDRTCKVWSLLKGRLLRNIVFPSVIDAIALDPAEHVFYAGSRDGSIYIAALNAESPSTSSYGMHIIGSLSDHSKAVTCLAYSTGDLLISGSEDGMVRVWDPITHNIVRMFRLAKGPVNNILVVRRPLYLNLGSFSNPHTSSRRHGSQLPPPLDKYVTSADEDVDKKGVIRLPSLYNAPRDASYISHRTIENHIKELQQQGSSAATEMExxxxxxxxxxxxxxxxxxxxxYENLHEFCVNELLDGDQVDGSKRNVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WD repeat-containing protein 18 May play a role during development.probableQ9BV38
WD repeat-containing protein 18 May play a role during development.probableQ3SZD4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VYH, chain C
Confidence level:very confident
Coverage over the Query: 3-153,165-296
View the alignment between query and template
View the model in PyMOL
Template: 3OW8, chain A
Confidence level:very confident
Coverage over the Query: 30-153,165-339
View the alignment between query and template
View the model in PyMOL
Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 3-344
View the alignment between query and template
View the model in PyMOL
Template: 2AKF, chain A
Confidence level:probable
Coverage over the Query: 407-432
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3iza, chain A probable Alignment | Template Structure