Citrus Sinensis ID: 013016


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-
MLIDSDFEPPSDATTRTTSTANSSSMSSESCSSFSRLSFELPTSKSSPENLSLKPHRSSDFAYSAIRSATFGRKTGLTFRDFDLHRRIGAGDIGTVYLCSLNNKYRQDRGHEPCCLYAMKVVNKEVLEKKKKVHRAEMEKKILKMLDHPFLPTLYAEFEASNFSCIVMEFCSGGDLHSLRHKQPHKRFSLTSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIMLSDFDLSLCSNAIPAVESPASSPEAASPRSQTYTRQYSTRLSRFLNRFFGSKKIQTLTPNRLFVAEPVAARSCSFVGTHEYVSPEVASGGSHGNAVDWWAFGIFIYEMIYGRTPFAAPSNETTLRNIVKKPLTFPTQSPSSMSEYHARDLISGLLNKDPCNRLGSKRGAADVKTHPFFKGLNFALIRSLTPPEIPGMRRQKTMPFPDQKIKSQSTAFDYF
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccEEECcccccEEEEEEEEcccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEECccccEEEEEccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccc
************************************************************FAYSAIRSATFGRKTGLTFRDFDLHRRIGAGDIGTVYLCSLNNKYRQDRGHEPCCLYAMKVVNKEVLEKKKKVHRAEMEKKILKMLDHPFLPTLYAEFEASNFSCIVMEFCSGGDLHSLRHKQPHKRFSLTSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIMLSDFDLSLCSNAI*************************TRLSRFLNRFFG*****TLTPNRLFVAEPVAARSCSFVGTHEYVSPEVASGGSHGNAVDWWAFGIFIYEMIYGRTPFAAPSNETTLRNIVKKPLTFPTQSPSSMSEYHARDLISGLLNKDPCNRLGSKRGAADVKTHPFFKGLNFALIRSLTPPEIPGMRRQKTMPFPD*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIDSDFEPPSDATTRTTSTANSSSMSSESCSSFSRLSFELPTSKSSPENLSLKPHRSSDFAYSAIRSATFGRKTGLTFRDFDLHRRIGAGDIGTVYLCSLNNKYRQDRGHEPCCLYAxxxxxxxxxxxxxxxxxxxxxKKILKMLDHPFLPTLYAEFEASNFSCIVMEFCSGGDLHSLRHKQPHKRFSLTSARFYAAEVLVALEYLHMLGIIYRDLKPENVLVRSDGHIMLSDFDLSLCSNAIPAVESPASSPEAASPRSQTYTRQYSTRLSRFLNRFFGSKKIQTLTPNRLFVAEPVAARSCSFVGTHEYVSPEVASGGSHGNAVDWWAFGIFIYEMIYGRTPFAAPSNETTLRNIVKKPLTFPTQSPSSMSEYHARDLISGLLNKDPCNRLGSKRGAADVKTHPFFKGLNFALIRSLTPPEIPGMRRQKTMPFPDQKIKSQSTAFDYF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein kinase PINOID Serine/threonine-protein kinase involved in the regulation of auxin signaling. Acts as a positive regulator of cellular auxin efflux and regulates organ development by enhancing polar auxin transport. Phosphorylates conserved serine residues in the PIN auxin efflux carriers. Phosphorylation of PIN proteins is required and sufficient for apical-basal PIN polarity that enables directional intercellular auxin fluxes, which mediate differential growth, tissue patterning and organogenesis. Acts in association with PIN1 to control the establishment of bilateral symmetry and promotion of cotyledon outgrowth. Regulates root gravitropism through modulation of PIN2-dependent basipetal auxin transport. Required for polarization of PIN3-dependent auxin transport for hypocotyl gravitropic response. The protein kinase activity of PID is essential for its auxin efflux regulatory function. PID kinase and PP2A phosphatase activities antagonistically regulate phosphorylation of PIN proteins, affecting PIN sorting.probableO64682
Protein kinase PINOID Serine/threonine-protein kinase involved in the regulation of auxin signaling. May control polar auxin transport and probably plays a role in the pattern formation and organogenesis in the rice shoot.probableQ2QM77

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RDQ, chain E
Confidence level:very confident
Coverage over the Query: 75-243,302-438
View the alignment between query and template
View the model in PyMOL
Template: 2C30, chain A
Confidence level:very confident
Coverage over the Query: 61-244,300-414
View the alignment between query and template
View the model in PyMOL
Template: 3RP9, chain A
Confidence level:very confident
Coverage over the Query: 80-252,308-417
View the alignment between query and template
View the model in PyMOL
Template: 3G51, chain A
Confidence level:very confident
Coverage over the Query: 77-131,142-237,253-257,309-426
View the alignment between query and template
View the model in PyMOL
Template: 4APC, chain A
Confidence level:confident
Coverage over the Query: 81-234,280-432
View the alignment between query and template
View the model in PyMOL
Template: 2J4Z, chain A
Confidence level:probable
Coverage over the Query: 75-172,210-218,231-236,258-393
View the alignment between query and template
View the model in PyMOL