Citrus Sinensis ID: 013022

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-

MAANGNGEFSFGKGTARKGLAKIQTAASQKKQSAICHDDSTPPVKAQTIDELHSLQKKRSAPNTPIKGTQGSFSPLSDEARQKQQLQSISASLASLTRETGPKVVRGDPARKAETPKFAADPGDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGKMKNHDVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTGKIIFCADLFHILIIFDCIKYKINGISL

ccccccccEEEcccccccccccEEEcccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHcccccEEEccccEEEEcccccccccccccccccccccccccccccccccccEEEEEEEEccccccEEEEEEEEccHHHHHHHHcccccccHHHHcccccccEEEEEcccccccccccccccccEEEEEccccEEEEEcccccccHHHHHHHHHHHHcccccEEEccccccccccccEEEEEEEcccccccccccccccccccccEEEcccccEEccccEEEEEcccccccccHHHHHHHcccEEEEEEEcccccccccccccccccccEEEEcccccccccccccccccccc

ccccccccccccccccccccccEEEccccccccccccccccccccHccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEccccccccccccccccccccccccccccHHHccccccEEEEcccHHHHHHHHHHHccccEEcccccEEEcccccccEcHHHEEEEccHHHHccccEccccccccEEEEEEEEEcccccccEEEEEEEccHHHHHHHHHHcEcccHHHHHccccccEEEEEEccccccccccccccccEEEEEccccEEEEEcccccHHHHHHHHHHHHHHHHHcccEEEcEEEEEcccccEEEEEccccccHHHHHcccccEEEEcccEEEccccEEEcccEEEEEcccccccccHHHHHccccccEEEcccEccccccEcccccccccccEEEEEHHHcHHHcHHEEEEEccccc

maangngefsfgkgtaRKGLAKIQTAASQKkqsaichddstppvkaQTIDELHSlqkkrsapntpikgtqgsfsplsdEARQKQQLQSISASLASltretgpkvvrgdparkaetpkfaadpgdhfsftptisvsdsslkfthvlynlspaeLYEQAIKYEQgsfiassgalatlsgaktgrsprdkrvvkdettehelwwgkmknhdvQVFVndqflnwdpqnrvKVRIVSARAYHSLFMhnmcirptpeelenfgtpdftiynagqfpcnrythymtsstsIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMpkrqilslhsgcnmgkdgDVALFFglsgtgkttlstdhnryligddehcwgdngvsnieggcyakcidlsrekepdIWNAIKFGAVLEnvvfdehtrevdysdksvtgkiifCADLFHILIIFDCIKYKINGISL

maangngefsfgkgtaRKGLAKIQTAASqkkqsaichddstppVKAQTIDELHslqkkrsapntpiKGTQGSFSPLSDEARQKQQLQSISAslasltretgpkvvrgdparkaetpkfaadpgdhFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALatlsgaktgrsprdkrvvkdettehelwwgkmknHDVQVFVNdqflnwdpqnrVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTrevdysdksvtGKIIFCADLFHILIIFDCIKYKINGISL

MAANGNGEFSFGKGTARKGLAKIQTAASQKKQSAICHDDSTPPVKAQTIDELHSLQKKRSAPNTPIKGTQGSFSPLSDEARqkqqlqsisaslaslTRETGPKVVRGDPARKAETPKFAADPGDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIassgalatlsgaKTGRSPRDKRVVKDETTEHELWWGKMKNHDVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVAlffglsgtgkttlstDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTGKIIFCADLFHILIIFDCIKYKINGISL

*******************************************************************************************************************************FTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGAL***********************EHELWWGKMKNHDVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTGKIIFCADLFHILIIFDCIKYKING***

*************GT***********************DSTPPVKAQTID*****************************************************************************FTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGKMKNHDVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTGKIIFCADLFHILIIFDCIKYKINGIS*

********FSFGKGTARKG*********************TPPVKAQTIDELHSLQKKRSAPNTPIKGTQG****************SISASLASLTRETGPKVVRGDPARKAETPKFAADPGDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLS*******************EHELWWGKMKNHDVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTGKIIFCADLFHILIIFDCIKYKINGISL

*********************K************ICHDDSTPPVKAQT*DELHSLQKKR********************************SLASLTRET*PKVVR***********************PTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGKMKNHDVQVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTGKIIFCADLFHILIIFDCIKYKINGI*L

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		451	2.2.26 [Sep-21-2011]
Q9T074		671	Phosphoenolpyruvate carbo	yes	no	0.922	0.619	0.773	0.0
P42066		670	Phosphoenolpyruvate carbo	N/A	no	0.922	0.620	0.752	0.0
Q9SLZ0		666	Phosphoenolpyruvate carbo	N/A	no	0.893	0.605	0.733	0.0
P49292		624	Phosphoenolpyruvate carbo	N/A	no	0.813	0.588	0.701	1e-162
Q9XFA2		626	Phosphoenolpyruvate carbo	N/A	no	0.822	0.592	0.701	1e-159
Q75JD5		562	Phosphoenolpyruvate carbo	yes	no	0.736	0.590	0.537	1e-106
Q2S008		530	Phosphoenolpyruvate carbo	yes	no	0.618	0.526	0.587	1e-103
O13434		553	Phosphoenolpyruvate carbo	N/A	no	0.620	0.506	0.595	1e-102
Q7RVS9		561	Phosphoenolpyruvate carbo	N/A	no	0.618	0.497	0.6	1e-100
Q6FRR0		544	Phosphoenolpyruvate carbo	yes	no	0.631	0.523	0.576	1e-100

>sp\|Q9T074\|PCKA_ARATH Phosphoenolpyruvate carboxykinase [ATP] OS=Arabidopsis thaliana GN=PCKA PE=1 SV=1	Back alignment and function desciption

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/450 (77%), Positives = 376/450 (83%), Gaps = 34/450 (7%)

Query: 2   AANGNGEFSFGKGTARKGLAKIQTAASQKKQSAICHDDSTPPVKAQTIDELHSLQKKRSA 61
           A NG+G FSF KG     + KI T A+ K+ S +CHDDS P V A TIDELHSLQKKRSA
Sbjct: 8   ATNGDGGFSFPKGPV---MPKITTGAA-KRGSGVCHDDSGPTVNATTIDELHSLQKKRSA 63

Query: 62  PNTPI-KGTQGSFSPLSDEARQKQQLQSISASLASLTRETGPKVVRGDPARK----AETP 116
           P TPI +    +F+ +S+E RQK QLQSISASLASLTRE+GPKVVRGDPA K    + TP
Sbjct: 64  PTTPINQNAAAAFAAVSEEERQKIQLQSISASLASLTRESGPKVVRGDPAEKKTDGSTTP 123

Query: 117 KFAADPGDHFS-FTP-TISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALAT 174
            +A   G H S F+P T +VSDSSLKFTHVLYNLSPAELYEQAIKYE+GSFI S+GALAT
Sbjct: 124 AYAH--GQHHSIFSPATGAVSDSSLKFTHVLYNLSPAELYEQAIKYEKGSFITSNGALAT 181

Query: 175 LSGAKTGRSPRDKRVVKDETTEHELWWGK------MKNHDV---------------QVFV 213
           LSGAKTGR+PRDKRVV+D TTE ELWWGK      M  H                 +VFV
Sbjct: 182 LSGAKTGRAPRDKRVVRDATTEDELWWGKGSPNIEMDEHTFMVNRERAVDYLNSLEKVFV 241

Query: 214 NDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNR 273
           NDQ+LNWDP+NR+KVRIVSARAYHSLFMHNMCIRPT EELE+FGTPDFTIYNAGQFPCNR
Sbjct: 242 NDQYLNWDPENRIKVRIVSARAYHSLFMHNMCIRPTQEELESFGTPDFTIYNAGQFPCNR 301

Query: 274 YTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKD 333
           YTHYMTSSTS+DLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKR+ILSLHSGCNMGKD
Sbjct: 302 YTHYMTSSTSVDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRRILSLHSGCNMGKD 361

Query: 334 GDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDI 393
           GDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCW + GVSNIEGGCYAKC+DLSREKEPDI
Sbjct: 362 GDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWTETGVSNIEGGCYAKCVDLSREKEPDI 421

Query: 394 WNAIKFGAVLENVVFDEHTREVDYSDKSVT 423
           WNAIKFG VLENVVFDEHTREVDYSDKSVT
Sbjct: 422 WNAIKFGTVLENVVFDEHTREVDYSDKSVT 451

Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 9

>sp\|P42066\|PCKA_CUCSA Phosphoenolpyruvate carboxykinase [ATP] OS=Cucumis sativus GN=PCK PE=2 SV=1	Back alignment and function description

>sp\|Q9SLZ0\|PCKA_MAIZE Phosphoenolpyruvate carboxykinase [ATP] OS=Zea mays PE=2 SV=1	Back alignment and function description

>sp\|P49292\|PCKA1_UROPA Phosphoenolpyruvate carboxykinase [ATP] 1 OS=Urochloa panicoides GN=PCK1 PE=1 SV=1	Back alignment and function description

>sp\|Q9XFA2\|PCKA2_UROPA Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Urochloa panicoides GN=PCK2 PE=2 SV=1	Back alignment and function description

>sp\|Q75JD5\|PCKA_DICDI Phosphoenolpyruvate carboxykinase [ATP] OS=Dictyostelium discoideum GN=pckA PE=1 SV=1	Back alignment and function description

>sp\|Q2S008\|PCKA2_SALRD Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=pckA2 PE=3 SV=1	Back alignment and function description

>sp\|O13434\|PCKA_CANAX Phosphoenolpyruvate carboxykinase [ATP] OS=Candida albicans GN=PCK1 PE=3 SV=1	Back alignment and function description

>sp\|Q7RVS9\|PCKA_NEUCR Phosphoenolpyruvate carboxykinase [ATP] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pck-1 PE=3 SV=1	Back alignment and function description

>sp\|Q6FRR0\|PCKA_CANGA Phosphoenolpyruvate carboxykinase [ATP] OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PCK1 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		451
13785471		658	phosphoenolpyruvate carboxykinase [Flave	0.924	0.633	0.804	0.0
356496541		660	PREDICTED: phosphoenolpyruvate carboxyki	0.926	0.633	0.810	0.0
356531401		661	PREDICTED: phosphoenolpyruvate carboxyki	0.929	0.633	0.806	0.0
13785467		662	phosphoenolpyruvate carboxykinase [Flave	0.924	0.629	0.796	0.0
13785469		662	phosphoenolpyruvate carboxykinase [Flave	0.924	0.629	0.796	0.0
224067088		666	predicted protein [Populus trichocarpa]	0.924	0.626	0.791	0.0
224097184		664	predicted protein [Populus trichocarpa]	0.926	0.629	0.777	0.0
350538279		662	phosphoenolpyruvate carboxykinase [Solan	0.929	0.632	0.773	0.0
255537864		661	Phosphoenolpyruvate carboxykinase [ATP],	0.906	0.618	0.791	0.0
255576017		666	Phosphoenolpyruvate carboxykinase [ATP],	0.920	0.623	0.762	0.0

>gi\|13785471\|dbj\|BAB43909.1\| phosphoenolpyruvate carboxykinase [Flaveria pringlei]	Back alignment and taxonomy information

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/444 (80%), Positives = 383/444 (86%), Gaps = 27/444 (6%)

Query: 1   MAANGNGEFSFGKGTARKGLAKIQTAASQKKQSAICHDDSTPPVKAQTIDELHSLQKKRS 60
           MA+NGNG  + GKG  R GL KIQT   QK+Q+ ICHDDS+ PVK QTIDELHSLQ+K+S
Sbjct: 1   MASNGNGNVA-GKGNGRNGLPKIQT---QKRQNGICHDDSSAPVKVQTIDELHSLQRKKS 56

Query: 61  APNTPIKGTQGSFSPLSDEARQKQQLQSISASLASLTRETGPKVVRGDPARKAETPKFAA 120
           AP TP+ G QG+F+  S++ RQKQQLQSISASLASLTRETGPKVVRGDPAR+ ETP+ A 
Sbjct: 57  APTTPLDGVQGAFANFSEDERQKQQLQSISASLASLTRETGPKVVRGDPARRPETPRVAH 116

Query: 121 DPGDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKT 180
            P DH+ FTPT + SDSSLKFTHVLYNLSPAELYEQAIKYE+GSFI SSGALATLSGAKT
Sbjct: 117 GP-DHY-FTPTFAASDSSLKFTHVLYNLSPAELYEQAIKYEKGSFITSSGALATLSGAKT 174

Query: 181 GRSPRDKRVVKDETTEHELWWGK---------------------MKNHDVQVFVNDQFLN 219
           GRSP+DKRVV+D+ TE+ELWWGK                       N   +VFVNDQFLN
Sbjct: 175 GRSPKDKRVVRDDVTENELWWGKGSPNIEMDEQTFLVNRERAVDYLNSLEKVFVNDQFLN 234

Query: 220 WDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMT 279
           WDP+NR+KVRIVSARAYHSLFMHNMCIRP+PEELENFGTPDFTIYNAGQFPCNRYTHYMT
Sbjct: 235 WDPENRIKVRIVSARAYHSLFMHNMCIRPSPEELENFGTPDFTIYNAGQFPCNRYTHYMT 294

Query: 280 SSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALF 339
           SSTSIDLNL RREMVILGTQYAGEMKKGLF VMHYLMPKRQILSLHSGCNMGKDGDVALF
Sbjct: 295 SSTSIDLNLGRREMVILGTQYAGEMKKGLFGVMHYLMPKRQILSLHSGCNMGKDGDVALF 354

Query: 340 FGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKF 399
           FGLSGTGKTTLSTDHNRYLIGDDEHCW D GVSNIEGGCYAKCIDLS+EKEPDIWNAIKF
Sbjct: 355 FGLSGTGKTTLSTDHNRYLIGDDEHCWSDKGVSNIEGGCYAKCIDLSKEKEPDIWNAIKF 414

Query: 400 GAVLENVVFDEHTREVDYSDKSVT 423
           G VLENVVFDEHTREVDY DKSVT
Sbjct: 415 GTVLENVVFDEHTREVDYLDKSVT 438

Source: Flaveria pringlei

Species: Flaveria pringlei

Genus: Flaveria

Family: Asteraceae

Order: Asterales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356496541\|ref\|XP_003517125.1\| PREDICTED: phosphoenolpyruvate carboxykinase [ATP]-like [Glycine max]	Back alignment and taxonomy information

>gi\|356531401\|ref\|XP_003534266.1\| PREDICTED: phosphoenolpyruvate carboxykinase [ATP]-like [Glycine max]	Back alignment and taxonomy information

>gi\|13785467\|dbj\|BAB43907.1\| phosphoenolpyruvate carboxykinase [Flaveria trinervia]	Back alignment and taxonomy information

>gi\|13785469\|dbj\|BAB43908.1\| phosphoenolpyruvate carboxykinase [Flaveria trinervia]	Back alignment and taxonomy information

>gi\|224067088\|ref\|XP_002302349.1\| predicted protein [Populus trichocarpa] gi\|222844075\|gb\|EEE81622.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224097184\|ref\|XP_002310867.1\| predicted protein [Populus trichocarpa] gi\|222853770\|gb\|EEE91317.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|350538279\|ref\|NP_001234079.1\| phosphoenolpyruvate carboxykinase [Solanum lycopersicum] gi\|16950587\|gb\|AAG01894.2\| phosphoenolpyruvate carboxykinase [Solanum lycopersicum]	Back alignment and taxonomy information

>gi\|255537864\|ref\|XP_002509997.1\| Phosphoenolpyruvate carboxykinase [ATP], putative [Ricinus communis] gi\|223550698\|gb\|EEF52184.1\| Phosphoenolpyruvate carboxykinase [ATP], putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|255576017\|ref\|XP_002528904.1\| Phosphoenolpyruvate carboxykinase [ATP], putative [Ricinus communis] gi\|223531658\|gb\|EEF33484.1\| Phosphoenolpyruvate carboxykinase [ATP], putative [Ricinus communis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		451
TAIR\|locus:2137594		671	PCK1 "phosphoenolpyruvate carb	0.474	0.318	0.869	1.1e-159
TAIR\|locus:504954890		670	PCK2 "phosphoenolpyruvate carb	0.474	0.319	0.841	5.1e-151
DICTYBASE\|DDB_G0271678		562	pckA "phosphoenolpyruvate carb	0.509	0.409	0.594	2.4e-85
CGD\|CAL0006389		553	PCK1 [Candida albicans (taxid:	0.474	0.386	0.629	8.2e-85
UNIPROTKB\|Q5AAH5		553	PCK1 "Putative uncharacterized	0.474	0.386	0.629	8.2e-85
ASPGD\|ASPL0000045947		600	acuF [Emericella nidulans (tax	0.472	0.355	0.586	1.7e-80
SGD\|S000001805		549	PCK1 "Phosphoenolpyruvate carb	0.485	0.398	0.567	1.1e-78
TIGR_CMR\|BA_5019		528	BA_5019 "phosphoenolpyruvate c	0.472	0.403	0.453	1.1e-54
UNIPROTKB\|P22259		540	pck [Escherichia coli K-12 (ta	0.560	0.468	0.390	9.9e-52
TIGR_CMR\|SO_0162		513	SO_0162 "phosphoenolpyruvate c	0.638	0.561	0.383	2.2e-50

TAIR\|locus:2137594 PCK1 "phosphoenolpyruvate carboxykinase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1025 (365.9 bits), Expect = 1.1e-159, Sum P(2) = 1.1e-159
 Identities = 186/214 (86%), Positives = 195/214 (91%)

Query:   210 QVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQF 269
             +VFVNDQ+LNWDP+NR+KVRIVSARAYHSLFMHNMCIRPT EELE+FGTPDFTIYNAGQF
Sbjct:   238 KVFVNDQYLNWDPENRIKVRIVSARAYHSLFMHNMCIRPTQEELESFGTPDFTIYNAGQF 297

Query:   270 PCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCN 329
             PCNRYTHYMTSSTS+DLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKR+ILSLHSGCN
Sbjct:   298 PCNRYTHYMTSSTSVDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRRILSLHSGCN 357

Query:   330 MGKDGDVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREK 389
             MGKDGDVA               DHNRYLIGDDEHCW + GVSNIEGGCYAKC+DLSREK
Sbjct:   358 MGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWTETGVSNIEGGCYAKCVDLSREK 417

Query:   390 EPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVT 423
             EPDIWNAIKFG VLENVVFDEHTREVDYSDKSVT
Sbjct:   418 EPDIWNAIKFGTVLENVVFDEHTREVDYSDKSVT 451

GO:0004611 "phosphoenolpyruvate carboxykinase activity" evidence=IEA

GO:0004612 "phosphoenolpyruvate carboxykinase (ATP) activity" evidence=IEA;ISS;IMP

GO:0005524 "ATP binding" evidence=IEA;ISS

GO:0005737 "cytoplasm" evidence=ISM

GO:0006094 "gluconeogenesis" evidence=IEA;ISS

GO:0017076 "purine nucleotide binding" evidence=IEA

GO:0005730 "nucleolus" evidence=IDA

GO:0046686 "response to cadmium ion" evidence=IEP

GO:0016036 "cellular response to phosphate starvation" evidence=IEP

GO:0016020 "membrane" evidence=IDA

GO:0005634 "nucleus" evidence=IDA

GO:0005829 "cytosol" evidence=IDA

GO:0009817 "defense response to fungus, incompatible interaction" evidence=IDA

TAIR\|locus:504954890 PCK2 "phosphoenolpyruvate carboxykinase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0271678 pckA "phosphoenolpyruvate carboxykinase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

CGD\|CAL0006389 PCK1 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5AAH5 PCK1 "Putative uncharacterized protein PCK1" [Candida albicans SC5314 (taxid:237561)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000045947 acuF [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

SGD\|S000001805 PCK1 "Phosphoenolpyruvate carboxykinase" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

TIGR_CMR\|BA_5019 BA_5019 "phosphoenolpyruvate carboxykinase (ATP)" [Bacillus anthracis str. Ames (taxid:198094)]	Back alignment and assigned GO terms

UNIPROTKB\|P22259 pck [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_0162 SO_0162 "phosphoenolpyruvate carboxykinase (ATP)" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9T074	PCKA_ARATH	4, ., 1, ., 1, ., 4, 9	0.7733	0.9223	0.6199	yes	no
P42066	PCKA_CUCSA	4, ., 1, ., 1, ., 4, 9	0.7528	0.9223	0.6208	N/A	no
Q9SLZ0	PCKA_MAIZE	4, ., 1, ., 1, ., 4, 9	0.7336	0.8935	0.6051	N/A	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	4.1.1.49	0.946
3rd Layer	4.1.1	0.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		451
PLN02597		555	PLN02597, PLN02597, phosphoenolpyruvate carboxykin	0.0
cd00484		508	cd00484, PEPCK_ATP, Phosphoenolpyruvate carboxykin	0.0
PTZ00311		561	PTZ00311, PTZ00311, phosphoenolpyruvate carboxykin	1e-175
pfam01293		467	pfam01293, PEPCK_ATP, Phosphoenolpyruvate carboxyk	1e-170
PRK09344		526	PRK09344, PRK09344, phosphoenolpyruvate carboxykin	1e-150
COG1866		529	COG1866, PckA, Phosphoenolpyruvate carboxykinase (	1e-126
TIGR00224		532	TIGR00224, pckA, phosphoenolpyruvate carboxykinase	1e-121
cd01919		515	cd01919, PEPCK, Phosphoenolpyruvate carboxykinase	7e-92
cd00820		107	cd00820, PEPCK_HprK, Phosphoenolpyruvate carboxyki	7e-12

>gnl\|CDD\|178207 PLN02597, PLN02597, phosphoenolpyruvate carboxykinase [ATP]	Back alignment and domain information

 Score =  638 bits (1648), Expect = 0.0
 Identities = 281/343 (81%), Positives = 291/343 (84%), Gaps = 29/343 (8%)

Query: 102 PKVVRGDPARKAETPKFAADPGDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYE 161
           PKVVRGDPARK E P             PTI VSDS LKFTHVLYNLSPAELYEQAIKYE
Sbjct: 1   PKVVRGDPARKKEPP--------KSVVAPTIDVSDSGLKFTHVLYNLSPAELYEQAIKYE 52

Query: 162 QGSFIASSGALATLSGAKTGRSPRDKRVVKDETTEHELWWGK------MKNHDV------ 209
           +GSFI S+GALATLSGAKTGRSP+DKRVV+DETTE ELWWGK      M           
Sbjct: 53  KGSFITSTGALATLSGAKTGRSPKDKRVVRDETTEDELWWGKGSPNIEMDEETFLVNRER 112

Query: 210 ---------QVFVNDQFLNWDPQNRVKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPD 260
                    +VFVNDQFLNWDP+NR+KVRIVSARAYHSLFMHNMCIRPTPEELE+FGTPD
Sbjct: 113 AVDYLNSLDKVFVNDQFLNWDPENRIKVRIVSARAYHSLFMHNMCIRPTPEELEDFGTPD 172

Query: 261 FTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQ 320
           FTIYNAGQFPCNRYTHYMTSSTSIDLNL R+EMVILGTQYAGEMKKGLFS+MHYLMP R 
Sbjct: 173 FTIYNAGQFPCNRYTHYMTSSTSIDLNLKRKEMVILGTQYAGEMKKGLFSLMHYLMPMRG 232

Query: 321 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYA 380
           ILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTD NRYLIGDDEHCW DNGVSNIEGGCYA
Sbjct: 233 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDPNRYLIGDDEHCWSDNGVSNIEGGCYA 292

Query: 381 KCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVT 423
           KCIDLS EKEPDIWNAIKFG VLENVVFDEHTREVDYSDKSVT
Sbjct: 293 KCIDLSEEKEPDIWNAIKFGTVLENVVFDEHTREVDYSDKSVT 335

Length = 555

>gnl\|CDD\|238270 cd00484, PEPCK_ATP, Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>gnl\|CDD\|185549 PTZ00311, PTZ00311, phosphoenolpyruvate carboxykinase; Provisional	Back alignment and domain information

>gnl\|CDD\|216417 pfam01293, PEPCK_ATP, Phosphoenolpyruvate carboxykinase	Back alignment and domain information

>gnl\|CDD\|236471 PRK09344, PRK09344, phosphoenolpyruvate carboxykinase; Provisional	Back alignment and domain information

>gnl\|CDD\|224779 COG1866, PckA, Phosphoenolpyruvate carboxykinase (ATP) [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|161774 TIGR00224, pckA, phosphoenolpyruvate carboxykinase (ATP)	Back alignment and domain information

>gnl\|CDD\|238900 cd01919, PEPCK, Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>gnl\|CDD\|238418 cd00820, PEPCK_HprK, Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		451
PLN02597		555	phosphoenolpyruvate carboxykinase [ATP]	100.0
cd00484		508	PEPCK_ATP Phosphoenolpyruvate carboxykinase (PEPCK	100.0
PTZ00311		561	phosphoenolpyruvate carboxykinase; Provisional	100.0
TIGR00224		532	pckA phosphoenolpyruvate carboxykinase (ATP). Invo	100.0
COG1866		529	PckA Phosphoenolpyruvate carboxykinase (ATP) [Ener	100.0
PF01293		466	PEPCK_ATP: Phosphoenolpyruvate carboxykinase The P	100.0
PRK09344		526	phosphoenolpyruvate carboxykinase; Provisional	100.0
cd01919		515	PEPCK Phosphoenolpyruvate carboxykinase (PEPCK), a	100.0
cd00819		579	PEPCK_GTP Phosphoenolpyruvate carboxykinase (PEPCK	99.89
PRK04210		601	phosphoenolpyruvate carboxykinase; Provisional	99.84
PF00821		586	PEPCK: Phosphoenolpyruvate carboxykinase; InterPro	99.78
COG1274		608	PckA Phosphoenolpyruvate carboxykinase (GTP) [Ener	99.59
KOG3749		640	consensus Phosphoenolpyruvate carboxykinase [Energ	98.98
cd00820		107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	97.83
cd01918		149	HprK_C HprK/P, the bifunctional histidine-containi	97.81
PF07475		171	Hpr_kinase_C: HPr Serine kinase C-terminal domain;	97.37
TIGR00679		304	hpr-ser Hpr(Ser) kinase/phosphatase. The hprK gene	97.24
COG1493		308	HprK Serine kinase of the HPr protein, regulates c	96.95
PRK05428		308	HPr kinase/phosphorylase; Provisional	96.88
PRK06217		183	hypothetical protein; Validated	95.68
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	95.53
PF13555		62	AAA_29: P-loop containing region of AAA domain	95.24
KOG3354		191	consensus Gluconate kinase [Carbohydrate transport	95.24
smart00382		148	AAA ATPases associated with a variety of cellular	95.13
cd03220		224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	95.12
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	95.05
PRK11174		588	cysteine/glutathione ABC transporter membrane/ATP-	94.98
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	94.95
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	94.87
PRK07261		171	topology modulation protein; Provisional	94.85
COG1117		253	PstB ABC-type phosphate transport system, ATPase c	94.84
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	94.78
TIGR02868		529	CydC thiol reductant ABC exporter, CydC subunit. T	94.74
COG1132		567	MdlB ABC-type multidrug transport system, ATPase a	94.65
PRK08118		167	topology modulation protein; Reviewed	94.58
COG0529		197	CysC Adenylylsulfate kinase and related kinases [I	94.58
COG4136		213	ABC-type uncharacterized transport system, ATPase	94.56
TIGR00235		207	udk uridine kinase. Model contains a number of lon	94.42
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	94.41
PRK00300		205	gmk guanylate kinase; Provisional	94.4
TIGR01313		163	therm_gnt_kin carbohydrate kinase, thermoresistant	94.4
PRK09825		176	idnK D-gluconate kinase; Provisional	94.36
COG4148		352	ModC ABC-type molybdate transport system, ATPase c	94.34
PRK08233		182	hypothetical protein; Provisional	94.34
COG4175		386	ProV ABC-type proline/glycine betaine transport sy	94.28
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	94.2
PF01583		156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	94.13
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	94.12
cd00227		175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	94.1
PRK05541		176	adenylylsulfate kinase; Provisional	94.07
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	94.04
COG4181		228	Predicted ABC-type transport system involved in ly	94.01
TIGR03797		686	NHPM_micro_ABC2 NHPM bacteriocin system ABC transp	93.99
KOG0055		1228	consensus Multidrug/pheromone exporter, ABC superf	93.97
COG4988		559	CydD ABC-type transport system involved in cytochr	93.96
PRK00889		175	adenylylsulfate kinase; Provisional	93.89
PRK05480		209	uridine/cytidine kinase; Provisional	93.88
PRK00131		175	aroK shikimate kinase; Reviewed	93.8
TIGR03375		694	type_I_sec_LssB type I secretion system ATPase, Ls	93.74
PRK06620		214	hypothetical protein; Validated	93.69
COG3842		352	PotA ABC-type spermidine/putrescine transport syst	93.69
COG0396		251	sufC Cysteine desulfurase activator ATPase [Posttr	93.67
TIGR00958		711	3a01208 Conjugate Transporter-2 (CT2) Family prote	93.67
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	93.66
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	93.64
TIGR03796		710	NHPM_micro_ABC1 NHPM bacteriocin system ABC transp	93.63
PF00005		137	ABC_tran: ABC transporter This structure is on hol	93.61
cd03225		211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	93.6
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	93.59
KOG0058		716	consensus Peptide exporter, ABC superfamily [Intra	93.54
cd03270		226	ABC_UvrA_I The excision repair protein UvrA domain	93.54
TIGR02857		529	CydD thiol reductant ABC exporter, CydD subunit. U	93.48
TIGR01166		190	cbiO cobalt transport protein ATP-binding subunit.	93.45
cd03255		218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	93.42
PRK13657		588	cyclic beta-1,2-glucan ABC transporter; Provisiona	93.41
COG3840		231	ThiQ ABC-type thiamine transport system, ATPase co	93.39
KOG0055		1228	consensus Multidrug/pheromone exporter, ABC superf	93.39
TIGR00960		216	3a0501s02 Type II (General) Secretory Pathway (IIS	93.37
TIGR01193		708	bacteriocin_ABC ABC-type bacteriocin transporter.	93.35
TIGR02673		214	FtsE cell division ATP-binding protein FtsE. This	93.35
PRK06762		166	hypothetical protein; Provisional	93.27
cd03262		213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	93.26
cd03265		220	ABC_DrrA DrrA is the ATP-binding protein component	93.26
cd03269		210	ABC_putative_ATPase This subfamily is involved in	93.24
cd03260		227	ABC_PstB_phosphate_transporter Phosphate uptake is	93.23
TIGR02315		243	ABC_phnC phosphonate ABC transporter, ATP-binding	93.23
cd03292		214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	93.17
PF03193		161	DUF258: Protein of unknown function, DUF258; Inter	93.16
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	93.16
cd03226		205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	93.15
cd03219		236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	93.15
cd03261		235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	93.13
cd03257		228	ABC_NikE_OppD_transporters The ABC transporter sub	93.11
cd03259		213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	93.06
TIGR02204		576	MsbA_rel ABC transporter, permease/ATP-binding pro	93.06
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	93.03
PF13479		213	AAA_24: AAA domain	93.03
PRK03846		198	adenylylsulfate kinase; Provisional	92.99
cd03263		220	ABC_subfamily_A The ABCA subfamily mediates the tr	92.97
cd03224		222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	92.94
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	92.93
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	92.89
cd03258		233	ABC_MetN_methionine_transporter MetN (also known a	92.88
cd03293		220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	92.85
cd03268		208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	92.82
cd03266		218	ABC_NatA_sodium_exporter NatA is the ATPase compon	92.82
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	92.82
PF00004		132	AAA: ATPase family associated with various cellula	92.82
cd03256		241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	92.81
TIGR03410		230	urea_trans_UrtE urea ABC transporter, ATP-binding	92.81
PRK10790		592	putative multidrug transporter membrane\ATP-bindin	92.76
TIGR03608		206	L_ocin_972_ABC putative bacteriocin export ABC tra	92.76
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	92.75
PRK11124		242	artP arginine transporter ATP-binding subunit; Pro	92.74
PRK11160		574	cysteine/glutathione ABC transporter membrane/ATP-	92.71
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	92.7
cd03216		163	ABC_Carb_Monos_I This family represents the domain	92.68
COG4525		259	TauB ABC-type taurine transport system, ATPase com	92.68
TIGR01978		243	sufC FeS assembly ATPase SufC. SufC is part of the	92.68
cd03301		213	ABC_MalK_N The N-terminal ATPase domain of the mal	92.6
COG4619		223	ABC-type uncharacterized transport system, ATPase	92.58
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	92.58
PRK10908		222	cell division protein FtsE; Provisional	92.56
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	92.55
cd03218		232	ABC_YhbG The ABC transporters belonging to the Yhb	92.51
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	92.5
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	92.47
PRK15177		213	Vi polysaccharide export ATP-binding protein VexC;	92.47
PRK14527		191	adenylate kinase; Provisional	92.44
PRK13540		200	cytochrome c biogenesis protein CcmA; Provisional	92.43
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	92.43
cd03246		173	ABCC_Protease_Secretion This family represents the	92.42
PRK13539		207	cytochrome c biogenesis protein CcmA; Provisional	92.37
cd03264		211	ABC_drug_resistance_like ABC-type multidrug transp	92.37
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	92.36
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	92.35
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	92.34
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	92.32
PRK13538		204	cytochrome c biogenesis protein CcmA; Provisional	92.32
PRK14267		253	phosphate ABC transporter ATP-binding protein; Pro	92.29
TIGR03864		236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	92.28
cd03295		242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	92.28
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	92.27
PRK10895		241	lipopolysaccharide ABC transporter ATP-binding pro	92.27
cd03296		239	ABC_CysA_sulfate_importer Part of the ABC transpor	92.26
COG1118		345	CysA ABC-type sulfate/molybdate transport systems,	92.24
TIGR02323		253	CP_lyasePhnK phosphonate C-P lyase system protein	92.21
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	92.19
cd03254		229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	92.18
TIGR00972		247	3a0107s01c2 phosphate ABC transporter, ATP-binding	92.17
PRK14247		250	phosphate ABC transporter ATP-binding protein; Pro	92.16
TIGR01359		183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	92.15
TIGR03265		353	PhnT2 putative 2-aminoethylphosphonate ABC transpo	92.13
cd03245		220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	92.12
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	92.11
PRK11248		255	tauB taurine transporter ATP-binding subunit; Prov	92.09
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	92.07
cd03215		182	ABC_Carb_Monos_II This family represents domain II	92.05
PRK10744		260	pstB phosphate transporter ATP-binding protein; Pr	92.03
cd02027		149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	92.0
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	91.99
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	91.99
TIGR01189		198	ccmA heme ABC exporter, ATP-binding protein CcmA.	91.98
PRK14255		252	phosphate ABC transporter ATP-binding protein; Pro	91.96
cd03298		211	ABC_ThiQ_thiamine_transporter ABC-type thiamine tr	91.96
PRK14242		253	phosphate transporter ATP-binding protein; Provisi	91.93
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	91.93
PRK11264		250	putative amino-acid ABC transporter ATP-binding pr	91.92
cd03231		201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	91.91
PRK14241		258	phosphate transporter ATP-binding protein; Provisi	91.9
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	91.9
TIGR03771		223	anch_rpt_ABC anchored repeat-type ABC transporter,	91.88
PRK14273		254	phosphate ABC transporter ATP-binding protein; Pro	91.84
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	91.82
PRK09493		240	glnQ glutamine ABC transporter ATP-binding protein	91.8
PRK10247		225	putative ABC transporter ATP-binding protein YbbL;	91.8
PRK14738		206	gmk guanylate kinase; Provisional	91.8
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	91.8
PRK11247		257	ssuB aliphatic sulfonates transport ATP-binding su	91.79
CHL00131		252	ycf16 sulfate ABC transporter protein; Validated	91.79
TIGR03005		252	ectoine_ehuA ectoine/hydroxyectoine ABC transporte	91.78
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	91.78
TIGR01184		230	ntrCD nitrate transport ATP-binding subunits C and	91.77
TIGR02770		230	nickel_nikD nickel import ATP-binding protein NikD	91.73
TIGR03411		242	urea_trans_UrtD urea ABC transporter, ATP-binding	91.72
PRK13648		269	cbiO cobalt transporter ATP-binding subunit; Provi	91.72
PRK14239		252	phosphate transporter ATP-binding protein; Provisi	91.72
PRK10771		232	thiQ thiamine transporter ATP-binding subunit; Pro	91.69
PRK11432		351	fbpC ferric transporter ATP-binding subunit; Provi	91.63
cd03252		237	ABCC_Hemolysin The ABC-transporter hemolysin B is	91.63
TIGR02324		224	CP_lyasePhnL phosphonate C-P lyase system protein	91.62
TIGR03740		223	galliderm_ABC gallidermin-class lantibiotic protec	91.62
COG0194		191	Gmk Guanylate kinase [Nucleotide transport and met	91.61
PRK06547		172	hypothetical protein; Provisional	91.6
PRK10575		265	iron-hydroxamate transporter ATP-binding subunit;	91.6
PRK14274		259	phosphate ABC transporter ATP-binding protein; Pro	91.6
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	91.6
cd03250		204	ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.	91.59
PRK14248		268	phosphate ABC transporter ATP-binding protein; Pro	91.58
PRK11650		356	ugpC glycerol-3-phosphate transporter ATP-binding	91.58
cd03237		246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	91.58
cd03249		238	ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6)	91.56
PRK09452		375	potA putrescine/spermidine ABC transporter ATPase	91.55
PRK11300		255	livG leucine/isoleucine/valine transporter ATP-bin	91.54
PRK14250		241	phosphate ABC transporter ATP-binding protein; Pro	91.51
PRK14262		250	phosphate ABC transporter ATP-binding protein; Pro	91.51
PRK13649		280	cbiO cobalt transporter ATP-binding subunit; Provi	91.48
PRK13645		289	cbiO cobalt transporter ATP-binding subunit; Provi	91.48
PRK11831		269	putative ABC transporter ATP-binding protein YrbF;	91.48
cd03232		192	ABC_PDR_domain2 The pleiotropic drug resistance-li	91.45
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	91.44
PRK03839		180	putative kinase; Provisional	91.42
PTZ00301		210	uridine kinase; Provisional	91.41
COG1127		263	Ttg2A ABC-type transport system involved in resist	91.35
cd03369		207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	91.34
PRK15056		272	manganese/iron transporter ATP-binding protein; Pr	91.33
PRK14240		250	phosphate transporter ATP-binding protein; Provisi	91.32
PRK14259		269	phosphate ABC transporter ATP-binding protein; Pro	91.31
cd03244		221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	91.31
PRK14256		252	phosphate ABC transporter ATP-binding protein; Pro	91.26
PRK11607		377	potG putrescine transporter ATP-binding subunit; P	91.26
PRK11144		352	modC molybdate transporter ATP-binding protein; Pr	91.25
PRK11701		258	phnK phosphonate C-P lyase system protein PhnK; Pr	91.25
PRK13548		258	hmuV hemin importer ATP-binding subunit; Provision	91.22
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	91.22
PRK15093		330	antimicrobial peptide ABC transporter ATP-binding	91.2
PRK06696		223	uridine kinase; Validated	91.19
TIGR01277		213	thiQ thiamine ABC transporter, ATP-binding protein	91.18
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	91.18
PRK15112		267	antimicrobial peptide ABC system ATP-binding prote	91.16
cd00464		154	SK Shikimate kinase (SK) is the fifth enzyme in th	91.16
PTZ00265		1466	multidrug resistance protein (mdr1); Provisional	91.15
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	91.15
PRK10851		353	sulfate/thiosulfate transporter subunit; Provision	91.14
cd03248		226	ABCC_TAP TAP, the Transporter Associated with Anti	91.14
PRK13638		271	cbiO cobalt transporter ATP-binding subunit; Provi	91.13
PRK14261		253	phosphate ABC transporter ATP-binding protein; Pro	91.11
TIGR03238		504	dnd_assoc_3 dnd system-associated protein 3. cereu	91.11
PRK10619		257	histidine/lysine/arginine/ornithine transporter su	91.11
TIGR02769		265	nickel_nikE nickel import ATP-binding protein NikE	91.1
PRK13547		272	hmuV hemin importer ATP-binding subunit; Provision	91.1
PRK09984		262	phosphonate/organophosphate ester transporter subu	91.09
cd03251		234	ABCC_MsbA MsbA is an essential ABC transporter, cl	91.09
PRK11000		369	maltose/maltodextrin transporter ATP-binding prote	91.09
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	91.09
cd03233		202	ABC_PDR_domain1 The pleiotropic drug resistance (P	91.07
PRK13632		271	cbiO cobalt transporter ATP-binding subunit; Provi	91.07
cd03234		226	ABCG_White The White subfamily represents ABC tran	91.06
cd03267		236	ABC_NatA_like Similar in sequence to NatA, this is	91.03
PRK14253		249	phosphate ABC transporter ATP-binding protein; Pro	91.01
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	91.0
cd03290		218	ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec	91.0
PRK14237		267	phosphate transporter ATP-binding protein; Provisi	90.98
PRK11545		163	gntK gluconate kinase 1; Provisional	90.98
PRK14270		251	phosphate ABC transporter ATP-binding protein; Pro	90.98
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	90.96
PRK14245		250	phosphate ABC transporter ATP-binding protein; Pro	90.95
PRK14272		252	phosphate ABC transporter ATP-binding protein; Pro	90.95
cd03294		269	ABC_Pro_Gly_Bertaine This family comprises the gly	90.94
TIGR01188		302	drrA daunorubicin resistance ABC transporter ATP-b	90.93
PRK14530		215	adenylate kinase; Provisional	90.92
PRK09544		251	znuC high-affinity zinc transporter ATPase; Review	90.91
PRK09183		259	transposase/IS protein; Provisional	90.91
TIGR00455		184	apsK adenylylsulfate kinase (apsK). Important resi	90.91
PRK11614		237	livF leucine/isoleucine/valine transporter ATP-bin	90.9
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	90.89
PRK10418		254	nikD nickel transporter ATP-binding protein NikD;	90.87
PRK09580		248	sufC cysteine desulfurase ATPase component; Review	90.87
PRK10253		265	iron-enterobactin transporter ATP-binding protein;	90.84
TIGR02142		354	modC_ABC molybdenum ABC transporter, ATP-binding p	90.84
PRK14238		271	phosphate transporter ATP-binding protein; Provisi	90.82
PRK14244		251	phosphate ABC transporter ATP-binding protein; Pro	90.8
TIGR00968		237	3a0106s01 sulfate ABC transporter, ATP-binding pro	90.77
cd03300		232	ABC_PotA_N PotA is an ABC-type transporter and the	90.76
PRK13647		274	cbiO cobalt transporter ATP-binding subunit; Provi	90.74
PF01926		116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	90.74
PRK14251		251	phosphate ABC transporter ATP-binding protein; Pro	90.73
PRK10419		268	nikE nickel transporter ATP-binding protein NikE;	90.72
PRK14235		267	phosphate transporter ATP-binding protein; Provisi	90.71
PRK11231		255	fecE iron-dicitrate transporter ATP-binding subuni	90.7
cd04164		157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	90.69
TIGR01288		303	nodI ATP-binding ABC transporter family nodulation	90.69
PRK14268		258	phosphate ABC transporter ATP-binding protein; Pro	90.68
PRK14249		251	phosphate ABC transporter ATP-binding protein; Pro	90.67
COG3638		258	ABC-type phosphate/phosphonate transport system, A	90.63
PRK14269		246	phosphate ABC transporter ATP-binding protein; Pro	90.62
PRK14243		264	phosphate transporter ATP-binding protein; Provisi	90.62
KOG0635		207	consensus Adenosine 5'-phosphosulfate kinase [Inor	90.6
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	90.59
cd03213		194	ABCG_EPDR ABCG transporters are involved in eye pi	90.57
PRK00698		205	tmk thymidylate kinase; Validated	90.57
PRK14531		183	adenylate kinase; Provisional	90.56
PRK13646		286	cbiO cobalt transporter ATP-binding subunit; Provi	90.56
cd03253		236	ABCC_ATM1_transporter ATM1 is an ABC transporter t	90.55
CHL00181		287	cbbX CbbX; Provisional	90.53
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	90.53
cd01876		170	YihA_EngB The YihA (EngB) subfamily. This subfamil	90.53
cd00071		137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	90.52
TIGR03258		362	PhnT 2-aminoethylphosphonate ABC transport system,	90.49
TIGR03873		256	F420-0_ABC_ATP proposed F420-0 ABC transporter, AT	90.46
cd03217		200	ABC_FeS_Assembly ABC-type transport system involve	90.45
PRK11153		343	metN DL-methionine transporter ATP-binding subunit	90.45
TIGR02982		220	heterocyst_DevA ABC exporter ATP-binding subunit,	90.43
PRK14260		259	phosphate ABC transporter ATP-binding protein; Pro	90.4
PRK11022		326	dppD dipeptide transporter ATP-binding subunit; Pr	90.35
PRK14266		250	phosphate ABC transporter ATP-binding protein; Pro	90.32
PRK13634		290	cbiO cobalt transporter ATP-binding subunit; Provi	90.32
PRK03695		248	vitamin B12-transporter ATPase; Provisional	90.32
PRK13635		279	cbiO cobalt transporter ATP-binding subunit; Provi	90.3
cd02028		179	UMPK_like Uridine monophosphate kinase_like (UMPK_	90.29
PRK14252		265	phosphate ABC transporter ATP-binding protein; Pro	90.25
PRK13651		305	cobalt transporter ATP-binding subunit; Provisiona	90.24
PRK14265		274	phosphate ABC transporter ATP-binding protein; Pro	90.23
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	90.18
cd02020		147	CMPK Cytidine monophosphate kinase (CMPK) catalyze	90.15
PRK14275		286	phosphate ABC transporter ATP-binding protein; Pro	90.12
COG4161		242	ArtP ABC-type arginine transport system, ATPase co	90.11
TIGR02314		343	ABC_MetN D-methionine ABC transporter, ATP-binding	90.09
PRK14236		272	phosphate transporter ATP-binding protein; Provisi	90.06
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	90.06
PRK09473		330	oppD oligopeptide transporter ATP-binding componen	90.05
PRK14254		285	phosphate ABC transporter ATP-binding protein; Pro	90.03
cd03236		255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	90.0
PRK11308		327	dppF dipeptide transporter ATP-binding subunit; Pr	89.99
PRK13650		279	cbiO cobalt transporter ATP-binding subunit; Provi	89.97
CHL00095		821	clpC Clp protease ATP binding subunit	89.97
PRK14271		276	phosphate ABC transporter ATP-binding protein; Pro	89.97
PRK08533		230	flagellar accessory protein FlaH; Reviewed	89.93
cd03279		213	ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex	89.88
PRK15079		331	oligopeptide ABC transporter ATP-binding protein O	89.85
PRK13641		287	cbiO cobalt transporter ATP-binding subunit; Provi	89.85
smart00072		184	GuKc Guanylate kinase homologues. Active enzymes c	89.84
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	89.82
PRK13639		275	cbiO cobalt transporter ATP-binding subunit; Provi	89.82
cd03271		261	ABC_UvrA_II The excision repair protein UvrA domai	89.82
PRK13652		277	cbiO cobalt transporter ATP-binding subunit; Provi	89.81
COG0444		316	DppD ABC-type dipeptide/oligopeptide/nickel transp	89.8
PRK13640		282	cbiO cobalt transporter ATP-binding subunit; Provi	89.8
cd03283		199	ABC_MutS-like MutS-like homolog in eukaryotes. The	89.78
PRK05057		172	aroK shikimate kinase I; Reviewed	89.74
PRK14737		186	gmk guanylate kinase; Provisional	89.74
PRK13633		280	cobalt transporter ATP-binding subunit; Provisiona	89.73
PRK13637		287	cbiO cobalt transporter ATP-binding subunit; Provi	89.72
PRK13644		274	cbiO cobalt transporter ATP-binding subunit; Provi	89.66
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	89.64
COG1131		293	CcmA ABC-type multidrug transport system, ATPase c	89.63
cd04159		159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	89.6
PRK13642		277	cbiO cobalt transporter ATP-binding subunit; Provi	89.59
PRK08356		195	hypothetical protein; Provisional	89.59
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	89.58
PF13476		202	AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V	89.58
cd03299		235	ABC_ModC_like Archeal protein closely related to M	89.55
PRK13631		320	cbiO cobalt transporter ATP-binding subunit; Provi	89.5
PRK14532		188	adenylate kinase; Provisional	89.49
PRK12339		197	2-phosphoglycerate kinase; Provisional	89.48
TIGR02237		209	recomb_radB DNA repair and recombination protein R	89.45
PRK02496		184	adk adenylate kinase; Provisional	89.35
PRK11176		582	lipid transporter ATP-binding/permease protein; Pr	89.34
PRK13636		283	cbiO cobalt transporter ATP-binding subunit; Provi	89.34
PRK14258		261	phosphate ABC transporter ATP-binding protein; Pro	89.34
cd01394		218	radB RadB. The archaeal protein radB shares simila	89.3
cd03288		257	ABCC_SUR2 The SUR domain 2. The sulfonylurea recep	89.25
PRK13546		264	teichoic acids export protein ATP-binding subunit;	89.23
cd02024		187	NRK1 Nicotinamide riboside kinase (NRK) is an enzy	89.22
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	89.2
cd03272		243	ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein	89.19
PRK13643		288	cbiO cobalt transporter ATP-binding subunit; Provi	89.19
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	89.19
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	89.16
cd03297		214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	89.16
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	89.13
PHA02530		300	pseT polynucleotide kinase; Provisional	89.13
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	89.13
cd01428		194	ADK Adenylate kinase (ADK) catalyzes the reversibl	89.12
cd04155		173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	89.1
cd03240		204	ABC_Rad50 The catalytic domains of Rad50 are simil	89.08
PRK14246		257	phosphate ABC transporter ATP-binding protein; Pro	89.06
KOG4238		627	consensus Bifunctional ATP sulfurylase/adenosine 5	89.03
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	88.96
COG4555		245	NatA ABC-type Na+ transport system, ATPase compone	88.89
PRK01184		184	hypothetical protein; Provisional	88.88
PRK10938		490	putative molybdenum transport ATP-binding protein	88.86
cd03278		197	ABC_SMC_barmotin Barmotin is a tight junction-asso	88.81
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	88.79
TIGR03269		520	met_CoM_red_A2 methyl coenzyme M reductase system,	88.72
PRK13537		306	nodulation ABC transporter NodI; Provisional	88.69
cd02026		273	PRK Phosphoribulokinase (PRK) is an enzyme involve	88.67
TIGR00231		161	small_GTP small GTP-binding protein domain. This m	88.66
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	88.65
PRK14263		261	phosphate ABC transporter ATP-binding protein; Pro	88.64
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	88.63
PRK04040		188	adenylate kinase; Provisional	88.61
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	88.58
PHA00729		226	NTP-binding motif containing protein	88.58
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	88.53
PRK14264		305	phosphate ABC transporter ATP-binding protein; Pro	88.45
TIGR01618		220	phage_P_loop phage nucleotide-binding protein. Thi	88.39
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	88.39
COG2274		709	SunT ABC-type bacteriocin/lantibiotic exporters, c	88.38
PRK13947		171	shikimate kinase; Provisional	88.38
PF05729		166	NACHT: NACHT domain	88.35
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	88.31
PRK06893		229	DNA replication initiation factor; Validated	88.27
TIGR03522		301	GldA_ABC_ATP gliding motility-associated ABC trans	88.26
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	88.23
TIGR03269		520	met_CoM_red_A2 methyl coenzyme M reductase system,	88.22
PRK13975		196	thymidylate kinase; Provisional	88.22
PRK10938		490	putative molybdenum transport ATP-binding protein	88.21
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	88.19
PLN02772		398	guanylate kinase	88.15
PRK10522		547	multidrug transporter membrane component/ATP-bindi	88.15
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	88.12
TIGR01351		210	adk adenylate kinases. Adenylate kinase (EC 2.7.4.	88.1
PRK08084		235	DNA replication initiation factor; Provisional	88.09
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	88.08
cd03289		275	ABCC_CFTR2 The CFTR subfamily domain 2. The cystic	88.07
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	88.06
TIGR02633		500	xylG D-xylose ABC transporter, ATP-binding protein	88.06
cd04160		167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	88.05
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	88.0
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	87.99
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	87.96
COG3265		161	GntK Gluconate kinase [Carbohydrate transport and	87.94
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	87.93
PRK07667		193	uridine kinase; Provisional	87.92
cd01672		200	TMPK Thymidine monophosphate kinase (TMPK), also k	87.91
cd03291		282	ABCC_CFTR1 The CFTR subfamily domain 1. The cystic	87.89
PRK06526		254	transposase; Provisional	87.86
PRK03731		171	aroL shikimate kinase II; Reviewed	87.85
cd04156		160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	87.8
PF09439		181	SRPRB: Signal recognition particle receptor beta s	87.8
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	87.71
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	87.69
COG1123		539	ATPase components of various ABC-type transport sy	87.62
PRK04182		180	cytidylate kinase; Provisional	87.6
cd00876		160	Ras Ras family. The Ras family of the Ras superfam	87.54
PF13173		128	AAA_14: AAA domain	87.51
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	87.46
PRK15064		530	ABC transporter ATP-binding protein; Provisional	87.46
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	87.45
TIGR02203		571	MsbA_lipidA lipid A export permease/ATP-binding pr	87.42
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	87.4
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	87.4
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	87.4
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	87.35
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	87.31
PRK13536		340	nodulation factor exporter subunit NodI; Provision	87.31
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	87.31
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	87.3
PRK13946		184	shikimate kinase; Provisional	87.16
PRK10865		857	protein disaggregation chaperone; Provisional	87.15
PRK15064		530	ABC transporter ATP-binding protein; Provisional	87.14
PRK08903		227	DnaA regulatory inactivator Hda; Validated	87.13
PRK05537		568	bifunctional sulfate adenylyltransferase subunit 1	87.11
cd04138		162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	87.09
cd04123		162	Rab21 Rab21 subfamily. The localization and functi	87.03
COG1100		219	GTPase SAR1 and related small G proteins [General	87.0
COG1122		235	CbiO ABC-type cobalt transport system, ATPase comp	87.0
smart00175		164	RAB Rab subfamily of small GTPases. Rab GTPases ar	86.95
PF00025		175	Arf: ADP-ribosylation factor family The prints ent	86.95
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	86.94
PF00625		183	Guanylate_kin: Guanylate kinase; InterPro: IPR0081	86.93
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	86.92
TIGR00041		195	DTMP_kinase thymidylate kinase. Function: phosphor	86.92
PRK14257		329	phosphate ABC transporter ATP-binding protein; Pro	86.91
cd01128		249	rho_factor Transcription termination factor rho is	86.83
TIGR01842		544	type_I_sec_PrtD type I secretion system ABC transp	86.79
TIGR01194		555	cyc_pep_trnsptr cyclic peptide transporter. This m	86.77
PRK10416		318	signal recognition particle-docking protein FtsY;	86.76
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	86.7
PRK14528		186	adenylate kinase; Provisional	86.7
KOG0061		613	consensus Transporter, ABC superfamily (Breast can	86.7
TIGR02633		500	xylG D-xylose ABC transporter, ATP-binding protein	86.7
TIGR02173		171	cyt_kin_arch cytidylate kinase, putative. Proteins	86.58
PRK15453		290	phosphoribulokinase; Provisional	86.56
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	86.54
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	86.52
cd03273		251	ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein	86.48
PRK11147		635	ABC transporter ATPase component; Reviewed	86.46
PRK10789		569	putative multidrug transporter membrane\ATP-bindin	86.44
PRK11819		556	putative ABC transporter ATP-binding protein; Revi	86.41
cd04139		164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	86.36
PRK09087		226	hypothetical protein; Validated	86.35
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	86.33
PRK10646		153	ADP-binding protein; Provisional	86.31
PRK10261		623	glutathione transporter ATP-binding protein; Provi	86.3
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	86.27
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	86.19
cd03274		212	ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein	86.14
cd04119		168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	86.12
TIGR01192		585	chvA glucan exporter ATP-binding protein. This mod	86.11
PLN02165		334	adenylate isopentenyltransferase	86.11
cd03243		202	ABC_MutS_homologs The MutS protein initiates DNA m	86.07
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	86.06
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	86.05
TIGR02236		310	recomb_radA DNA repair and recombination protein R	86.03
TIGR03719		552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	85.96
cd00154		159	Rab Rab family. Rab GTPases form the largest famil	85.94
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	85.91
PRK10261		623	glutathione transporter ATP-binding protein; Provi	85.9

>PLN02597 phosphoenolpyruvate carboxykinase [ATP]	Back alignment and domain information

Probab=100.00  E-value=4.8e-114  Score=902.30  Aligned_cols=331  Identities=85%  Similarity=1.330  Sum_probs=316.5

Q ss_pred             CccccCCCccccCCCCCCCCCCCCCCcCccccccccCcccceeEecCCHHHHHHHHHHhcCCcEEecccceEeecCCccc
Q 013022          102 PKVVRGDPARKAETPKFAADPGDHFSFTPTISVSDSSLKFTHVLYNLSPAELYEQAIKYEQGSFIASSGALATLSGAKTG  181 (451)
Q Consensus       102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~l~~~gl~~~~v~~Nls~~eLye~A~~~~eGt~lt~~GAL~v~TG~~TG  181 (451)
                      |+|+.|||+++..+++.        .-++...+..+|++..+|+||+++++|||+|+++++|++++++|+|+|+||++||
T Consensus         1 ~~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~~~~~v~~nl~~~~Lye~Al~~~eG~l~~~~GaL~v~TGk~TG   72 (555)
T PLN02597          1 PKVVRGDPARKKEPPKS--------VVAPTIDVSDSGLKFTHVLYNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTG   72 (555)
T ss_pred             CccccCCccccCcCccc--------ccccccccccccCCcceEEeCCCHHHHHHHHHHhCCCeEEecCCCEEecCCCcCC
Confidence            78999999888765543        4677888999999999999999999999999999999877779999999999999


Q ss_pred             CCCCCeeeecCCCcccccccCC------CCccc---------------ccEEEEEeeecCCCCCeEEEEEechhhhHHHH
Q 013022          182 RSPRDKRVVKDETTEHELWWGK------MKNHD---------------VQVFVNDQFLNWDPQNRVKVRIVSARAYHSLF  240 (451)
Q Consensus       182 RSpkDK~IV~d~~t~~~v~Wg~------~~e~~---------------k~lyv~D~~vG~d~~~~l~vRvite~a~~alf  240 (451)
                      |||+|||||+++.++++||||+      |++++               +++||+|+|+|+||+|++++|+|+++|||+||
T Consensus        73 RSP~DKfIV~d~~t~~~iwWg~g~vN~p~~~~~f~~l~~~~~~~l~~~~~lfv~D~~~Gad~~~r~~vRvite~aw~alF  152 (555)
T PLN02597         73 RSPKDKRVVRDETTEDELWWGKGSPNIEMDEETFLVNRERAVDYLNSLDKVFVNDQFLNWDPENRIKVRIVSARAYHSLF  152 (555)
T ss_pred             CCcccceecCCCCcccceeccCCccCccCCHHHHHHHHHHHHHHHccCCCEEEEeeeeccCccceeeEEEEeCHHHHHHH
Confidence            9999999999999999999964      55543               46999999999999999999999999999999


Q ss_pred             HHhcCCCCChHhhccCCCCCEEEEEcCCCCCCcccCCCCcccEEEEeccCCeEEEEccccchhhhhHHHHHHHHhcccCC
Q 013022          241 MHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQ  320 (451)
Q Consensus       241 l~NLfirp~~eel~~fg~PDftI~~~P~f~~~~~~~g~~s~t~i~id~~~~~vlI~GT~YaGEmKKgifTl~n~~l~~~G  320 (451)
                      |+|||+||..+|++.|++||||||++|+|+++|+.+|++|+++|++|+++++++|+||+|+|||||++||+|||+|+++|
T Consensus       153 ~~nmfirP~~~el~~f~~PdftIi~ap~f~a~~~~~g~~Se~~i~in~~~~~~lI~GT~YaGE~KK~iFs~~~~ll~~rg  232 (555)
T PLN02597        153 MHNMCIRPTPEELEDFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLKRKEMVILGTQYAGEMKKGLFSLMHYLMPMRG  232 (555)
T ss_pred             HHhcCCCCChHHhccCCCCCEEEEeCCCCCCCccccCCCCCcEEEEEccCCeEEEEccchhhhhHHHHHHHHHHHHHHCC
Confidence            99999999999999998899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeeccccccCCCCCEEEEEecCCCCcccccccCCCceecCCceeecCCCceeccccEEEEeeCCCCCCChhHhhhcccc
Q 013022          321 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFG  400 (451)
Q Consensus       321 ~LpmH~sanvg~~G~valffGLSGTGKTTLSad~~r~lIgDDe~~w~d~Gvfn~EgGcYaK~idLs~e~EP~I~~Ai~~g  400 (451)
                      +||||||||++++|++++|||||||||||||+||+|.||+||||+|+++||||||||||||||+|++|+||+||+||+||
T Consensus       233 ~l~mHasaNv~~~g~~~lffGlSGtGKTTLsad~~~~li~DDEHgW~~~GVfNfEGGCYAK~i~Ls~e~EPeI~~Ai~fg  312 (555)
T PLN02597        233 ILSLHSGCNMGKDGDVALFFGLSGTGKTTLSTDPNRYLIGDDEHCWSDNGVSNIEGGCYAKCIDLSEEKEPDIWNAIKFG  312 (555)
T ss_pred             cEeecCeeccCCCCcEEEEEecCCCCccceecCCCCceeecccccccCCceEeecCceEEEecCCCcccchHHHHhcCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceEeeeEEcCCCCccccCCCCccCcceeEeeccCcccccc
Q 013022          401 AVLENVVFDEHTREVDYSDKSVTGKIIFCADLFHILIIFD  440 (451)
Q Consensus       401 avLENVv~D~~~~~vDf~d~s~TeNtR~~yPi~~I~~~~~  440 (451)
                      ||||||+||++++.|||+|.|+||||||+|||+|||++..
T Consensus       313 avLENVv~d~~~~~~df~D~s~TeNtR~aYPi~~I~na~~  352 (555)
T PLN02597        313 TVLENVVFDEHTREVDYSDKSVTENTRASYPIEYIPNAKI  352 (555)
T ss_pred             ceEEeeEECCCCCccCCcCCcccccceEEeEHHhccccCC
Confidence            9999999999999999999999999999999999999963

>cd00484 PEPCK_ATP Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>PTZ00311 phosphoenolpyruvate carboxykinase; Provisional	Back alignment and domain information

>TIGR00224 pckA phosphoenolpyruvate carboxykinase (ATP)	Back alignment and domain information

>COG1866 PckA Phosphoenolpyruvate carboxykinase (ATP) [Energy production and conversion]	Back alignment and domain information

>PF01293 PEPCK_ATP: Phosphoenolpyruvate carboxykinase The Prosite pattern is specific to the ATP binding region; InterPro: IPR001272 Phosphoenolpyruvate carboxykinase (PEPCK) catalyses the first committed (rate-limiting) step in hepatic gluconeogenesis, namely the reversible decarboxylation of oxaloacetate to phosphoenolpyruvate (PEP) and carbon dioxide, using either ATP or GTP as a source of phosphate

Back alignment and domain information

>PRK09344 phosphoenolpyruvate carboxykinase; Provisional	Back alignment and domain information

>cd01919 PEPCK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>cd00819 PEPCK_GTP Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>PRK04210 phosphoenolpyruvate carboxykinase; Provisional	Back alignment and domain information

>PF00821 PEPCK: Phosphoenolpyruvate carboxykinase; InterPro: IPR008209 Phosphoenolpyruvate carboxykinase (PEPCK) catalyses the first committed (rate-limiting) step in hepatic gluconeogenesis, namely the reversible decarboxylation of oxaloacetate to phosphoenolpyruvate (PEP) and carbon dioxide, using either ATP or GTP as a source of phosphate	Back alignment and domain information

>COG1274 PckA Phosphoenolpyruvate carboxykinase (GTP) [Energy production and conversion]	Back alignment and domain information

>KOG3749 consensus Phosphoenolpyruvate carboxykinase [Energy production and conversion]	Back alignment and domain information

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria	Back alignment and domain information

>PF07475 Hpr_kinase_C: HPr Serine kinase C-terminal domain; InterPro: IPR011104 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []	Back alignment and domain information

>TIGR00679 hpr-ser Hpr(Ser) kinase/phosphatase	Back alignment and domain information

>COG1493 HprK Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms]	Back alignment and domain information

>PRK05428 HPr kinase/phosphorylase; Provisional	Back alignment and domain information

>PRK06217 hypothetical protein; Validated	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit	Back alignment and domain information

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family	Back alignment and domain information

>PRK09825 idnK D-gluconate kinase; Provisional	Back alignment and domain information

>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein	Back alignment and domain information

>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein	Back alignment and domain information

>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems	Back alignment and domain information

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit	Back alignment and domain information

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit	Back alignment and domain information

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional	Back alignment and domain information

>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein	Back alignment and domain information

>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter	Back alignment and domain information

>TIGR02673 FtsE cell division ATP-binding protein FtsE	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively	Back alignment and domain information

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient	Back alignment and domain information

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane	Back alignment and domain information

>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine	Back alignment and domain information

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)	Back alignment and domain information

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>PF13479 AAA_24: AAA domain	Back alignment and domain information

>PRK03846 adenylylsulfate kinase; Provisional	Back alignment and domain information

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance	Back alignment and domain information

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system	Back alignment and domain information

>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE	Back alignment and domain information

>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01978 sufC FeS assembly ATPase SufC	Back alignment and domain information

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>PRK10908 cell division protein FtsE; Provisional	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional	Back alignment and domain information

>PRK14527 adenylate kinase; Provisional	Back alignment and domain information

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import	Back alignment and domain information

>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein	Back alignment and domain information

>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family	Back alignment and domain information

>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA	Back alignment and domain information

>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP	Back alignment and domain information

>PRK14242 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional	Back alignment and domain information

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter	Back alignment and domain information

>PRK14241 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit	Back alignment and domain information

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional	Back alignment and domain information

>PRK14738 gmk guanylate kinase; Provisional	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional	Back alignment and domain information

>CHL00131 ycf16 sulfate ABC transporter protein; Validated	Back alignment and domain information

>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D	Back alignment and domain information

>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD	Back alignment and domain information

>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD	Back alignment and domain information

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14239 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E	Back alignment and domain information

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL	Back alignment and domain information

>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit	Back alignment and domain information

>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C	Back alignment and domain information

>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor	Back alignment and domain information

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1	Back alignment and domain information

>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed	Back alignment and domain information

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional	Back alignment and domain information

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)	Back alignment and domain information

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14240 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C	Back alignment and domain information

>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11144 modC molybdate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional	Back alignment and domain information

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional	Back alignment and domain information

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants	Back alignment and domain information

>PTZ00265 multidrug resistance protein (mdr1); Provisional	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK10851 sulfate/thiosulfate transporter subunit; Provisional	Back alignment and domain information

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules	Back alignment and domain information

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03238 dnd_assoc_3 dnd system-associated protein 3	Back alignment and domain information

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional	Back alignment and domain information

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE	Back alignment and domain information

>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional	Back alignment and domain information

>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins	Back alignment and domain information

>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors	Back alignment and domain information

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake	Back alignment and domain information

>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>cd03290 ABCC_SUR1_N The SUR domain 1	Back alignment and domain information

>PRK14237 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11545 gntK gluconate kinase 1; Provisional	Back alignment and domain information

>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea	Back alignment and domain information

>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit	Back alignment and domain information

>PRK14530 adenylate kinase; Provisional	Back alignment and domain information

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>TIGR00455 apsK adenylylsulfate kinase (apsK)	Back alignment and domain information

>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional	Back alignment and domain information

>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed	Back alignment and domain information

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK14238 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D	Back alignment and domain information

>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse	Back alignment and domain information

>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional	Back alignment and domain information

>PRK14235 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes	Back alignment and domain information

>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI	Back alignment and domain information

>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14243 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>PRK00698 tmk thymidylate kinase; Validated	Back alignment and domain information

>PRK14531 adenylate kinase; Provisional	Back alignment and domain information

>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>cd01876 YihA_EngB The YihA (EngB) subfamily	Back alignment and domain information

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2	Back alignment and domain information

>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT	Back alignment and domain information

>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component	Back alignment and domain information

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family	Back alignment and domain information

>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK03695 vitamin B12-transporter ATPase; Provisional	Back alignment and domain information

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13651 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor	Back alignment and domain information

>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK14236 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional	Back alignment and domain information

>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor	Back alignment and domain information

>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends	Back alignment and domain information

>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional	Back alignment and domain information

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>smart00072 GuKc Guanylate kinase homologues	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes	Back alignment and domain information

>PRK05057 aroK shikimate kinase I; Reviewed	Back alignment and domain information

>PRK14737 gmk guanylate kinase; Provisional	Back alignment and domain information

>PRK13633 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>cd04159 Arl10_like Arl10-like subfamily	Back alignment and domain information

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK08356 hypothetical protein; Provisional	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A	Back alignment and domain information

>cd03299 ABC_ModC_like Archeal protein closely related to ModC	Back alignment and domain information

>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14532 adenylate kinase; Provisional	Back alignment and domain information

>PRK12339 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PRK02496 adk adenylate kinase; Provisional	Back alignment and domain information

>PRK11176 lipid transporter ATP-binding/permease protein; Provisional	Back alignment and domain information

>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>cd03288 ABCC_SUR2 The SUR domain 2	Back alignment and domain information

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+)	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP)	Back alignment and domain information

>cd04155 Arl3 Arl3 subfamily	Back alignment and domain information

>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains	Back alignment and domain information

>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>KOG4238 consensus Bifunctional ATP sulfurylase/adenosine 5'-phosphosulfate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK01184 hypothetical protein; Provisional	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2	Back alignment and domain information

>PRK13537 nodulation ABC transporter NodI; Provisional	Back alignment and domain information

>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>TIGR00231 small_GTP small GTP-binding protein domain	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>PRK04040 adenylate kinase; Provisional	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01618 phage_P_loop phage nucleotide-binding protein	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2	Back alignment and domain information

>PRK13975 thymidylate kinase; Provisional	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01351 adk adenylate kinases	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>cd04160 Arfrp1 Arfrp1 subfamily	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor	Back alignment and domain information

>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PRK03731 aroL shikimate kinase II; Reviewed	Back alignment and domain information

>cd04156 ARLTS1 ARLTS1 subfamily	Back alignment and domain information

>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>PRK04182 cytidylate kinase; Provisional	Back alignment and domain information

>cd00876 Ras Ras family	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>PRK13536 nodulation factor exporter subunit NodI; Provisional	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PRK13946 shikimate kinase; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated	Back alignment and domain information

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily	Back alignment and domain information

>cd04123 Rab21 Rab21 subfamily	Back alignment and domain information

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]	Back alignment and domain information

>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>smart00175 RAB Rab subfamily of small GTPases	Back alignment and domain information

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR00041 DTMP_kinase thymidylate kinase	Back alignment and domain information

>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family	Back alignment and domain information

>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14528 adenylate kinase; Provisional	Back alignment and domain information

>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR02173 cyt_kin_arch cytidylate kinase, putative	Back alignment and domain information

>PRK15453 phosphoribulokinase; Provisional	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>PRK11147 ABC transporter ATPase component; Reviewed	Back alignment and domain information

>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>cd04139 RalA_RalB RalA/RalB subfamily	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>PRK10646 ADP-binding protein; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>cd04119 RJL RJL (RabJ-Like) subfamily	Back alignment and domain information

>TIGR01192 chvA glucan exporter ATP-binding protein	Back alignment and domain information

>PLN02165 adenylate isopentenyltransferase	Back alignment and domain information

>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>TIGR02236 recomb_radA DNA repair and recombination protein RadA	Back alignment and domain information

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family	Back alignment and domain information

>cd00154 Rab Rab family	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		451
1ii2_A		524	Crystal Structure Of Phosphoenolpyruvate Carboxykin		2e-64
1yvy_A		532	Crystal Strucutre Of Anaerobiospirillum Succinicipr		3e-52
1k3c_A		540	Phosphoenolpyruvate Carboxykinase In Complex With A		6e-52
1ayl_A		541	Phosphoenolpyruvate Carboxykinase Length = 541		6e-52
2py7_X		540	Crystal Structure Of E. Coli Phosphoenolpyruvate Ca		2e-51
1ygg_A		560	Crystal Structure Of Phosphoenolpyruvate Carboxykin		2e-49
1oen_A		540	Phosphoenolpyruvate Carboxykinase Length = 540		3e-49
1j3b_A		529	Crystal Structure Of Atp-dependent Phosphoenolpyruv		5e-49

>pdb|1II2|A Chain A, Crystal Structure Of Phosphoenolpyruvate Carboxykinase (Pepck) From Trypanosoma Cruzi Length = 524